Promotions

Buffet haut SCORPION 120 cm – Bois massif de manguier brun sculpté à la main, piètement noir Buffet haut SCORPION 120 cm – Bois massif de manguier brun sculpté à la main, piètement noir 2
  • -30%
Expédié sous 9 à 12 jours ouvrés
Buffet haut

Buffet Haut SCORPION en Bois de Manguier Massif Brun Sculpté - L100cm - Salon & Séjour

L09-40183
803,25 € 1 147,50 €
Le buffet haut SCORPION en bois massif de manguier séduit par son design sculpté 3D artisanal et son style contemporain. Avec ses 6 compartiments spacieux , ses portes à fermeture magnétique et son piètement en métal noir , il offre un rangement fonctionnel et élégant pour salon ou salle à manger. Livré monté, prêt à l'emploi.
Buffet SCORPION 180 cm – Bois massif de manguier brun sculpté à la main, piètement noir Buffet SCORPION 180 cm – Bois massif de manguier brun sculpté à la main, piètement noir 2
  • -30%
Expédié sous 9 à 12 jours ouvrés
Buffet bois

Buffet SCORPION en Bois de Manguier Massif Brun Sculpté 3D -piètement noir -L180cm

L09-40182
816,08 € 1 165,83 €
Le buffet SCORPION en bois de manguier massif brun (180 cm) est l’alliance parfaite entre robustesse artisanale et design contemporain. Avec sa façade sculptée 3D à la main et ses 4 grands compartiments, il offre un volume de rangement généreux derrière ses portes à fermeture magnétique. Une pièce unique, livrée montée, qui apporte chaleur et caractère à...
Buffet SCORPION 140 cm – Bois massif de manguier noir, sculpté à la main, piètement doré Buffet SCORPION 140 cm – Bois massif de manguier noir, sculpté à la main, piètement doré 2
  • -30%
Expédié sous 9 à 12 jours ouvrés
Buffet bois

Buffet SCORPION en Bois de Manguier Massif Noir Sculpté 3D - piètement doré - L140cm

L09-41399
669,08 € 955,83 €
Le buffet mural SCORPION en bois de manguier massif (180 cm) est l'alliance parfaite entre l'artisanat d'art et le design aérien. Sa façade sculptée 3D à la main et son installation suspendue libèrent l'espace au sol tout en offrant un rangement volumineux et moderne. Une pièce unique, robuste et chaleureuse pour un intérieur de caractère.
decozzia.com decozzia.com 2
  • -30%
Expédié sous 9 à 12 jours ouvrés
Chaises de salle à manger

Chaise avec accoudoirs pivotante – chaise design scandinave bouclé gris avec pieds en...

L09-44200
160,42 € 229,17 €
Apportez élégance et confort à votre intérieur avec cette chaise salle à manger avec accoudoirs. Son revêtement en tissu bouclé gris et ses pieds en chêne massif créent un style scandinave chic et chaleureux. Cette chaise confortable avec accoudoirs pivotante à 360° offre une assise idéale pour la salle à manger ou le bureau.
decozzia.com decozzia.com 2
  • -30%
Expédié sous 2 à 3 jours ouvrés
Ensemble meuble TV Mural

Ensemble Mural TV 5 Pièces Noir Brillant avec Éclairage LED - L200cm - Salon & Séjour

L04-246028
433,81 € 619,73 €
L’ensemble mural TV 5 pièces noir brillant (L200 cm) est la solution ultime pour un salon ultra-moderne et ordonné. Alliant finition laquée haute brillance et éclairage LED intégré, il offre un design épuré et une modularité totale. Avec ses deux meubles TV à portes rabattantes et ses vitrines élégantes, il maximise votre espace de rangement tout en...
decozzia.com decozzia.com 2
  • -30%
Expédié sous 2 à 3 jours ouvrés
Ensemble meuble TV Mural

Ensemble Mural TV 5 Pièces Noir et Blanc avec Éclairage LED – L240 cm – Salon & Séjour

L04-243864
496,43 € 709,18 €
Optimisez votre salon avec cet ensemble mural TV 5 pièces au design moderne. Avec ses meubles TV suspendus, armoires et étagère murale , il offre un grand espace de rangement pour vos appareils multimédias, livres et objets décoratifs. L' éclairage LED intégré blanc met en valeur vos éléments décoratifs tout en créant une ambiance contemporaine.
decozzia.com decozzia.com 2
  • -30%
Expédié sous 9 à 12 jours ouvrés
Lampadaires arc

Lampadaire Arc Design Noir & Doré 180 cm – Abat-jour Tissu & Socle Marbre Noir

L09-5758
265,51 € 379,31 €
Apportez une élégance raffinée et un luxe discret à votre intérieur avec ce lampadaire arc noir et doré. Son design original associe un abat-jour en tissu noir chic à un intérieur doré qui sublime la lumière. Ancré par un socle en marbre noir véritable, ce luminaire de 180 cm est la pièce maîtresse idéale pour de glamour.
decozzia.com decozzia.com 2
  • -30%
Expédié sous 9 à 12 jours ouvrés
Lampadaires arc

Lampadaire Arc Design Noir & doré 215 cm – Socle en Marbre Noir Luxe

L09-13069
210,58 € 300,83 €
Redéfinissez l'élégance de votre salon avec ce lampadaire arc noir et doré magistral. Alliant la sobriété du métal noir mat à l'éclat prestigieux d'un intérieur d'abat-jour doré, ce luminaire de 215 cm de hauteur repose sur un socle en marbre noir véritable. C'est la pièce de design ultime pour apporter une ambiance feutrée et luxueuse à vos soirées.
decozzia.com decozzia.com 2
  • -30%
Expédié sous 9 à 12 jours ouvrés
Lampadaires arc

Lampadaire Arc Design Noir en Lin – Socle en Marbre Noir & Finition Toile (200 cm)

L09-35399
243,22 € 347,45 €
Affirmez le caractère de votre salon avec ce lampadaire arc noir d'une élégance absolue. Mariant la noblesse d'un socle en marbre noir massif à la texture organique d'un abat-jour en toile de lin, ce luminaire de 200 cm de hauteur est la pièce maîtresse idéale pour un intérieur glamour et contemporain. Sa structure arquée offre une présence sculpturale...
decozzia.com decozzia.com 2
  • -30%
Expédié sous 9 à 12 jours ouvrés
Lampadaires arc

Lampadaire Arc Design XL Noir – Abat-jour en Fils de Nylon & Socle Marbre Noir

L09-7162
224,31 € 320,45 €
Apportez une signature visuelle forte à votre salon avec ce lampadaire arc noir d'envergure exceptionnelle. Son abat-jour unique, délicatement recouvert de fils de nylon, crée un jeu de lumière texturé et contemporain. Ancré sur un socle en marbre noir , ce luminaire de 225 cm allie la légèreté de sa structure à la noblesse des matériaux pour un intérieur...
decozzia.com decozzia.com 2
  • -30%
Expédié sous 9 à 12 jours ouvrés
Meuble tv suspendu

Meuble TV noir suspendu 160 cm en bois massif – meuble TV mural design gain de place

L09-41995
534,92 € 764,17 €
Ce meuble TV noir suspendu 160 cm en bois massif de manguier allie design moderne et solution gain de place . Fixé au mur, ce meuble TV mural suspendu libère l'espace au sol tout en offrant des rangements pratiques grâce à ses compartiments fermés. Idéal pour un petit salon ou appartement moderne .
decozzia.com decozzia.com 2
  • -30%
Expédié sous 9 à 12 jours ouvrés
Meuble tv suspendu

Meuble TV suspendu brun 160 cm en bois massif – meuble TV mural design gain de place

L09-43238
803,25 € 1 147,50 €
Ce meuble TV suspendu brun 160 cm en bois massif de manguier allie design moderne et solution gain de place . Fixé au mur, ce meuble TV mural suspendu libère l'espace au sol tout en offrant trois compartiments fermés pour organiser vos appareils multimédias dans un salon moderne ou un petit espace.
Table à manger design rond de 120 cm coloris naturel et noir en bois massif et métal Table à manger design rond de 120 cm coloris naturel et noir en bois massif et métal 2
  • -30%
Rupture de stock
Table en bois massif

Table à manger ronde bois et métal Ø120 cm – table ronde design industriel gain de place

L09-39584
451,49 € 644,99 €
Cette table à manger ronde bois et métal Ø120 cm associe un plateau en bois massif naturel et une structure métallique robuste pour un design industriel moderne. Sa forme ronde favorise la convivialité tout en optimisant l'espace, faisant de cette table ronde compacte et gagnant de place une solution idéale pour les salles à manger contemporaines.
View
Table de salle à manger ronde en bois de sheesham 120 cm – finition pierre brune Table de salle à manger ronde en bois de sheesham 120 cm – finition pierre brune 2
  • -30%
Expédié sous 9 à 12 jours ouvrés
Table ronde, ovale

Table à manger ronde bois sheesham Ø120 cm – table ronde compacte gain de place...

L09-48200
569,33 € 813,33 €
La table à manger ronde en bois de sheesham Ø120 cm allie authenticité et design minimaliste. Son plateau rond finition pierre brune polie met en valeur les veines naturelles du bois tandis que son piètement central robuste optimise l'espace. Une table ronde compacte et gain de place , idéale pour les petits espaces et les intérieurs modernes.
Table ronde bois et métal Ø120 cm – table à manger ronde chêne naturel | Decozzia Table ronde bois et métal Ø120 cm – table à manger ronde chêne naturel | Decozzia 2
  • -30%
Rupture de stock
Table ronde, ovale

Table à manger ronde chêne naturel et métal noir Ø120 cm – table ronde design gain de...

L09-47067
174,42 € 249,17 €
Cette table à manger ronde en chêne naturel Ø120 cm avec piètement métal noir séduit par son design minimaliste et chaleureux. Son plateau en bois apporte authenticité tandis que sa structure métallique assure robustesse. Une table ronde compacte et élégante, idéale pour optimiser l’espace dans une salle à manger moderne.
View
Product added to wishlist
Product added to compare.

Ce site utilise des cookies provenant de Google afin de fournir ses services et d'analyser le trafic. Les informations relatives à votre utilisation du site sont partagées avec Google. En cliquant sur "Accepter", vous acceptez l'utilisation des cookies.

Load Time 323.105 ms
Querying Time 206 ms
Queries 1370
Memory Peak Usage 40.5 Mb
Included Files 988 files - 13.21 Mb
PrestaShop Cache - Mb
Global vars 0.61 Mb
PrestaShop Version 8.2.0
PHP Version 8.1.34
MySQL Version 11.4.10-MariaDB
Memory Limit 4048M
Max Execution Time 600s
Smarty Cache enabled
Smarty Compilation auto
  Time Cumulated Time Memory Usage Memory Peak Usage
config 0.695 ms 0.695 ms 3.76 Mb 4.2 Mb
__construct 0.005 ms 0.700 ms - Mb 4.2 Mb
init 3.785 ms 4.485 ms 0.80 Mb 4.9 Mb
checkAccess 0.001 ms 4.486 ms - Mb 4.9 Mb
setMedia 0.936 ms 5.422 ms 0.25 Mb 4.9 Mb
postProcess 0.001 ms 5.423 ms - Mb 4.9 Mb
initHeader 0.000 ms 5.423 ms - Mb 4.9 Mb
initContent 252.064 ms 257.487 ms 23.97 Mb 28.9 Mb
initFooter 0.001 ms 257.488 ms - Mb 28.9 Mb
display 65.617 ms 323.105 ms 10.04 Mb 40.5 Mb
Hook Time Memory Usage
displayProductListFunctionalButtons 12.926 ms 0.13 Mb
displayCountDown 4.745 ms 0.12 Mb
displayBeforeBodyClosingTag 2.435 ms 0.62 Mb
DisplayFooter 2.262 ms 0.83 Mb
DisplayBeforeBodyClosingTag 1.993 ms 0.23 Mb
DisplayHeader 1.160 ms 0.14 Mb
displayNav2 0.636 ms 0.18 Mb
displayNav1 0.422 ms 0.09 Mb
displayMainMenu 0.396 ms 0.17 Mb
displayFooter 0.273 ms 0.09 Mb
displayCustomerLoginFormAfter 0.273 ms 0.07 Mb
renderWidget 0.252 ms 0.12 Mb
DisplayProductPriceBlock 0.140 ms 0.16 Mb
displayAfterBreadcrumb 0.115 ms 0.04 Mb
ProductSearchProvider 0.103 ms - Mb
ActionFrontControllerSetMedia 0.050 ms - Mb
DisplayTop 0.010 ms - Mb
OverrideLayoutTemplate 0.007 ms - Mb
ModuleRoutes 0.005 ms - Mb
ActionDispatcher 0.002 ms - Mb
Header 0.002 ms - Mb
ActionProductSearchAfter 0.002 ms - Mb
22 hook(s) 28.206 ms 3.01 Mb
Module Time Memory Usage
ph_simpleblog 1.002 ms 0.25 Mb
iqitthemeeditor 0.316 ms 0.15 Mb
ps_emailalerts 0.069 ms 0.04 Mb
facebookconversiontrackingplus 2.793 ms 0.99 Mb
revolutpayment 0.495 ms 0.34 Mb
revsliderprestashop 0.372 ms 0.14 Mb
ps_shoppingcart 0.048 ms 0.02 Mb
ps_googleanalytics 2.165 ms 0.28 Mb
iqitcompare 5.986 ms 0.17 Mb
iqitcontactpage 0.044 ms 0.02 Mb
iqitcookielaw 0.334 ms 0.14 Mb
iqitcountdown 4.853 ms 0.13 Mb
iqitelementor 0.182 ms 0.07 Mb
iqitfreedeliverycount 0.041 ms 0.02 Mb
iqitmegamenu 0.492 ms 0.23 Mb
iqitsizecharts 0.057 ms 0.10 Mb
iqitwishlist 9.707 ms 0.75 Mb
iqitextendedproduct 0.070 ms 0.05 Mb
iqitsociallogin 0.323 ms 0.09 Mb
gmerchantcenterpro 6.712 ms 1.20 Mb
stripe_official 0.237 ms 0.11 Mb
abandonedcart 0.230 ms 0.02 Mb
vivawalletsmartcheckout 0.136 ms - Mb
ps_facetedsearch 0.488 ms 0.22 Mb
iqitlinksmanager 0.733 ms 0.17 Mb
ps_languageselector 0.204 ms 0.06 Mb
ps_currencyselector 0.159 ms 0.06 Mb
iqitsearch 0.108 ms 0.01 Mb
ps_customersignin 0.032 ms 0.02 Mb
iqitproductsnav 0.216 ms 0.06 Mb
ps_emailsubscription 0.184 ms 0.08 Mb
31 module(s) 38.787 ms 5.99 Mb

Stopwatch SQL - 1370 queries

# Query Time (ms) Rows Filesort Group By Location
141 
SELECT SQL_NO_CACHE p.id_product FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pl.name FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_product_lang pl ON (p.id_product = pl.id_product AND pl.id_shop = 1 AND pl.id_lang = 1) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_specific_price sp ON (
sp.id_product = p.id_product AND 
sp.id_shop IN (0, 1) AND 
sp.id_currency IN (0, 1) AND 
sp.id_country IN (0, 21) AND 
sp.id_group IN (0, 1) AND 
sp.from_quantity = 1 AND
sp.reduction > 0 AND
sp.id_customer = 0 AND
sp.id_cart = 0 AND 
(sp.from = '0000-00-00 00:00:00' OR '2026-04-28 18:47:54' >= sp.from) AND 
(sp.to = '0000-00-00 00:00:00' OR '2026-04-28 18:47:54' <= sp.to) 
) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (750009, 751249, 751234, 751240, 33203, 33210, 33204, 33209))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND sp.reduction>0 GROUP BY p.id_product) p INNER JOIN een_product_lang pl ON (p.id_product = pl.id_product AND pl.id_shop = 1 AND pl.id_lang = 1) GROUP BY p.id_product ORDER BY p.name ASC, p.id_product DESC
 9.471 ms 28493040 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
147 
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pl.name FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_product_lang pl ON (p.id_product = pl.id_product AND pl.id_shop = 1 AND pl.id_lang = 1) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_specific_price sp ON (
sp.id_product = p.id_product AND 
sp.id_shop IN (0, 1) AND 
sp.id_currency IN (0, 1) AND 
sp.id_country IN (0, 21) AND 
sp.id_group IN (0, 1) AND 
sp.from_quantity = 1 AND
sp.reduction > 0 AND
sp.id_customer = 0 AND
sp.id_cart = 0 AND 
(sp.from = '0000-00-00 00:00:00' OR '2026-04-28 18:47:54' >= sp.from) AND 
(sp.to = '0000-00-00 00:00:00' OR '2026-04-28 18:47:54' <= sp.to) 
) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (750009, 751249, 751234, 751240, 33203, 33210, 33204, 33209))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND sp.reduction>0 GROUP BY p.id_product) p INNER JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=13)) AND ((fp_1.id_feature_value IN (750009, 751249, 751234, 751240, 33203, 33210, 33204, 33209))) GROUP BY fp.id_feature_value
 7.878 ms 6401520 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
159 
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pl.name FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_product_lang pl ON (p.id_product = pl.id_product AND pl.id_shop = 1 AND pl.id_lang = 1) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_specific_price sp ON (
sp.id_product = p.id_product AND 
sp.id_shop IN (0, 1) AND 
sp.id_currency IN (0, 1) AND 
sp.id_country IN (0, 21) AND 
sp.id_group IN (0, 1) AND 
sp.from_quantity = 1 AND
sp.reduction > 0 AND
sp.id_customer = 0 AND
sp.id_cart = 0 AND 
(sp.from = '0000-00-00 00:00:00' OR '2026-04-28 18:47:54' >= sp.from) AND 
(sp.to = '0000-00-00 00:00:00' OR '2026-04-28 18:47:54' <= sp.to) 
) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (750009, 751249, 751234, 751240, 33203, 33210, 33204, 33209))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND sp.reduction>0 GROUP BY p.id_product) p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((sa.quantity>0)) AND ((fp_1.id_feature_value IN (750009, 751249, 751234, 751240, 33203, 33210, 33204, 33209)))
 7.772 ms 12803040 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
145 
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pl.name FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_product_lang pl ON (p.id_product = pl.id_product AND pl.id_shop = 1 AND pl.id_lang = 1) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_specific_price sp ON (
sp.id_product = p.id_product AND 
sp.id_shop IN (0, 1) AND 
sp.id_currency IN (0, 1) AND 
sp.id_country IN (0, 21) AND 
sp.id_group IN (0, 1) AND 
sp.from_quantity = 1 AND
sp.reduction > 0 AND
sp.id_customer = 0 AND
sp.id_cart = 0 AND 
(sp.from = '0000-00-00 00:00:00' OR '2026-04-28 18:47:54' >= sp.from) AND 
(sp.to = '0000-00-00 00:00:00' OR '2026-04-28 18:47:54' <= sp.to) 
) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (750009, 751249, 751234, 751240, 33203, 33210, 33204, 33209))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND sp.reduction>0 GROUP BY p.id_product) p INNER JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=10)) AND ((fp_1.id_feature_value IN (750009, 751249, 751234, 751240, 33203, 33210, 33204, 33209))) GROUP BY fp.id_feature_value
 7.649 ms 6401520 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
157 
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pl.name FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_product_lang pl ON (p.id_product = pl.id_product AND pl.id_shop = 1 AND pl.id_lang = 1) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_specific_price sp ON (
sp.id_product = p.id_product AND 
sp.id_shop IN (0, 1) AND 
sp.id_currency IN (0, 1) AND 
sp.id_country IN (0, 21) AND 
sp.id_group IN (0, 1) AND 
sp.from_quantity = 1 AND
sp.reduction > 0 AND
sp.id_customer = 0 AND
sp.id_cart = 0 AND 
(sp.from = '0000-00-00 00:00:00' OR '2026-04-28 18:47:54' >= sp.from) AND 
(sp.to = '0000-00-00 00:00:00' OR '2026-04-28 18:47:54' <= sp.to) 
) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (750009, 751249, 751234, 751240, 33203, 33210, 33204, 33209))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND sp.reduction>0 GROUP BY p.id_product) p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_stock_available sa_1 ON (p.id_product = sa_1.id_product AND IFNULL(pac.id_product_attribute, 0) = sa_1.id_product_attribute AND sa_1.id_shop = 1  AND sa_1.id_shop_group = 0 ) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((sa.quantity<=0 AND sa_1.out_of_stock IN (0, 2))) AND ((fp_1.id_feature_value IN (750009, 751249, 751234, 751240, 33203, 33210, 33204, 33209)))
 7.545 ms 12803040 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
156 
SELECT SQL_NO_CACHE cp.id_category, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pl.name FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_product_lang pl ON (p.id_product = pl.id_product AND pl.id_shop = 1 AND pl.id_lang = 1) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_specific_price sp ON (
sp.id_product = p.id_product AND 
sp.id_shop IN (0, 1) AND 
sp.id_currency IN (0, 1) AND 
sp.id_country IN (0, 21) AND 
sp.id_group IN (0, 1) AND 
sp.from_quantity = 1 AND
sp.reduction > 0 AND
sp.id_customer = 0 AND
sp.id_cart = 0 AND 
(sp.from = '0000-00-00 00:00:00' OR '2026-04-28 18:47:54' >= sp.from) AND 
(sp.to = '0000-00-00 00:00:00' OR '2026-04-28 18:47:54' <= sp.to) 
) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (750009, 751249, 751234, 751240, 33203, 33210, 33204, 33209))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND sp.reduction>0 GROUP BY p.id_product) p INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (750009, 751249, 751234, 751240, 33203, 33210, 33204, 33209))) AND cg.id_group='1' AND c.level_depth<=2 AND c.nleft>2 AND c.nright<659 GROUP BY cp.id_category
 7.541 ms 6401520 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
158 
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pl.name FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_product_lang pl ON (p.id_product = pl.id_product AND pl.id_shop = 1 AND pl.id_lang = 1) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_specific_price sp ON (
sp.id_product = p.id_product AND 
sp.id_shop IN (0, 1) AND 
sp.id_currency IN (0, 1) AND 
sp.id_country IN (0, 21) AND 
sp.id_group IN (0, 1) AND 
sp.from_quantity = 1 AND
sp.reduction > 0 AND
sp.id_customer = 0 AND
sp.id_cart = 0 AND 
(sp.from = '0000-00-00 00:00:00' OR '2026-04-28 18:47:54' >= sp.from) AND 
(sp.to = '0000-00-00 00:00:00' OR '2026-04-28 18:47:54' <= sp.to) 
) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (750009, 751249, 751234, 751240, 33203, 33210, 33204, 33209))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND sp.reduction>0 GROUP BY p.id_product) p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((sa.out_of_stock=1) OR (sa.quantity>0)) AND ((fp_1.id_feature_value IN (750009, 751249, 751234, 751240, 33203, 33210, 33204, 33209)))
 7.417 ms 12803040 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
142 
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pl.name FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_product_lang pl ON (p.id_product = pl.id_product AND pl.id_shop = 1 AND pl.id_lang = 1) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_specific_price sp ON (
sp.id_product = p.id_product AND 
sp.id_shop IN (0, 1) AND 
sp.id_currency IN (0, 1) AND 
sp.id_country IN (0, 21) AND 
sp.id_group IN (0, 1) AND 
sp.from_quantity = 1 AND
sp.reduction > 0 AND
sp.id_customer = 0 AND
sp.id_cart = 0 AND 
(sp.from = '0000-00-00 00:00:00' OR '2026-04-28 18:47:54' >= sp.from) AND 
(sp.to = '0000-00-00 00:00:00' OR '2026-04-28 18:47:54' <= sp.to) 
) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (750009, 751249, 751234, 751240, 33203, 33210, 33204, 33209))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND sp.reduction>0 GROUP BY p.id_product) p LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((p.on_sale=1)) AND ((fp_1.id_feature_value IN (750009, 751249, 751234, 751240, 33203, 33210, 33204, 33209)))
 7.322 ms 6401520 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
143 
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pl.name FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_product_lang pl ON (p.id_product = pl.id_product AND pl.id_shop = 1 AND pl.id_lang = 1) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_specific_price sp ON (
sp.id_product = p.id_product AND 
sp.id_shop IN (0, 1) AND 
sp.id_currency IN (0, 1) AND 
sp.id_country IN (0, 21) AND 
sp.id_group IN (0, 1) AND 
sp.from_quantity = 1 AND
sp.reduction > 0 AND
sp.id_customer = 0 AND
sp.id_cart = 0 AND 
(sp.from = '0000-00-00 00:00:00' OR '2026-04-28 18:47:54' >= sp.from) AND 
(sp.to = '0000-00-00 00:00:00' OR '2026-04-28 18:47:54' <= sp.to) 
) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (750009, 751249, 751234, 751240, 33203, 33210, 33204, 33209))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND sp.reduction>0 GROUP BY p.id_product) p LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (750009, 751249, 751234, 751240, 33203, 33210, 33204, 33209))) AND p.date_add>'2026-01-29 00:00:00'
 7.243 ms 6401520 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
150 
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pl.name FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_product_lang pl ON (p.id_product = pl.id_product AND pl.id_shop = 1 AND pl.id_lang = 1) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_specific_price sp ON (
sp.id_product = p.id_product AND 
sp.id_shop IN (0, 1) AND 
sp.id_currency IN (0, 1) AND 
sp.id_country IN (0, 21) AND 
sp.id_group IN (0, 1) AND 
sp.from_quantity = 1 AND
sp.reduction > 0 AND
sp.id_customer = 0 AND
sp.id_cart = 0 AND 
(sp.from = '0000-00-00 00:00:00' OR '2026-04-28 18:47:54' >= sp.from) AND 
(sp.to = '0000-00-00 00:00:00' OR '2026-04-28 18:47:54' <= sp.to) 
) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND sp.reduction>0 GROUP BY p.id_product) p INNER JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature=29)) GROUP BY fp.id_feature_value
 6.708 ms 1094116 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
160 
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pl.name FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_product_lang pl ON (p.id_product = pl.id_product AND pl.id_shop = 1 AND pl.id_lang = 1) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_specific_price sp ON (
sp.id_product = p.id_product AND 
sp.id_shop IN (0, 1) AND 
sp.id_currency IN (0, 1) AND 
sp.id_country IN (0, 21) AND 
sp.id_group IN (0, 1) AND 
sp.from_quantity = 1 AND
sp.reduction > 0 AND
sp.id_customer = 0 AND
sp.id_cart = 0 AND 
(sp.from = '0000-00-00 00:00:00' OR '2026-04-28 18:47:54' >= sp.from) AND 
(sp.to = '0000-00-00 00:00:00' OR '2026-04-28 18:47:54' <= sp.to) 
) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (750009, 751249, 751234, 751240, 33203, 33210, 33204, 33209))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND sp.reduction>0 GROUP BY p.id_product) p INNER JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=17)) AND ((fp_1.id_feature_value IN (750009, 751249, 751234, 751240, 33203, 33210, 33204, 33209))) GROUP BY fp.id_feature_value
 1.607 ms 4536 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
148 
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pl.name FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_product_lang pl ON (p.id_product = pl.id_product AND pl.id_shop = 1 AND pl.id_lang = 1) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_specific_price sp ON (
sp.id_product = p.id_product AND 
sp.id_shop IN (0, 1) AND 
sp.id_currency IN (0, 1) AND 
sp.id_country IN (0, 21) AND 
sp.id_group IN (0, 1) AND 
sp.from_quantity = 1 AND
sp.reduction > 0 AND
sp.id_customer = 0 AND
sp.id_cart = 0 AND 
(sp.from = '0000-00-00 00:00:00' OR '2026-04-28 18:47:54' >= sp.from) AND 
(sp.to = '0000-00-00 00:00:00' OR '2026-04-28 18:47:54' <= sp.to) 
) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (750009, 751249, 751234, 751240, 33203, 33210, 33204, 33209))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND sp.reduction>0 GROUP BY p.id_product) p INNER JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=20)) AND ((fp_1.id_feature_value IN (750009, 751249, 751234, 751240, 33203, 33210, 33204, 33209))) GROUP BY fp.id_feature_value
 1.393 ms 2208 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
144 
SELECT SQL_NO_CACHE psi.price_min, MIN(price_min) as min, MAX(price_max) as max FROM een_product p INNER JOIN een_layered_price_index psi ON (psi.id_product = p.id_product AND psi.id_shop = 1 AND psi.id_currency = 1 AND psi.id_country = 21) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_specific_price sp ON (
sp.id_product = p.id_product AND 
sp.id_shop IN (0, 1) AND 
sp.id_currency IN (0, 1) AND 
sp.id_country IN (0, 21) AND 
sp.id_group IN (0, 1) AND 
sp.from_quantity = 1 AND
sp.reduction > 0 AND
sp.id_customer = 0 AND
sp.id_cart = 0 AND 
(sp.from = '0000-00-00 00:00:00' OR '2026-04-28 18:47:54' >= sp.from) AND 
(sp.to = '0000-00-00 00:00:00' OR '2026-04-28 18:47:54' <= sp.to) 
) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (750009, 751249, 751234, 751240, 33203, 33210, 33204, 33209))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND sp.reduction>0
 1.349 ms 1046 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
3 
SELECT SQL_NO_CACHE c.`name`, cl.`id_lang`, IF(cl.`id_lang` IS NULL, c.`value`, cl.`value`) AS value, c.id_shop_group, c.id_shop
FROM `een_configuration` c
LEFT JOIN `een_configuration_lang` cl ON (c.`id_configuration` = cl.`id_configuration`)
 1.285 ms 1696 /classes/Configuration.php:180
152 
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pl.name FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_product_lang pl ON (p.id_product = pl.id_product AND pl.id_shop = 1 AND pl.id_lang = 1) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_specific_price sp ON (
sp.id_product = p.id_product AND 
sp.id_shop IN (0, 1) AND 
sp.id_currency IN (0, 1) AND 
sp.id_country IN (0, 21) AND 
sp.id_group IN (0, 1) AND 
sp.from_quantity = 1 AND
sp.reduction > 0 AND
sp.id_customer = 0 AND
sp.id_cart = 0 AND 
(sp.from = '0000-00-00 00:00:00' OR '2026-04-28 18:47:54' >= sp.from) AND 
(sp.to = '0000-00-00 00:00:00' OR '2026-04-28 18:47:54' <= sp.to) 
) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (750009, 751249, 751234, 751240, 33203, 33210, 33204, 33209))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND sp.reduction>0 GROUP BY p.id_product) p INNER JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=34)) AND ((fp_1.id_feature_value IN (750009, 751249, 751234, 751240, 33203, 33210, 33204, 33209))) GROUP BY fp.id_feature_value
 1.005 ms 224 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
1369 
SELECT SQL_NO_CACHE cp.`id_category`, cp.`id_product`, cl.`name` FROM `een_category_product` cp
LEFT JOIN `een_category` c ON (c.id_category = cp.id_category)
LEFT JOIN `een_category_lang` cl ON (cp.`id_category` = cl.`id_category` AND cl.id_shop = 1 )
INNER JOIN een_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
WHERE cp.`id_product` IN (4525,25043,4412,647720,647723,647724,647719,36884,647808,10087,40017,4997,10086,40036,5964,40049,30894,4471,36882,4100,541226,549338,36837,36524,4489,4440,4482,4493,4458,5009,4447,6318,5018,11341,4448,6696,6531,6362,4508,4516,4322,4320,4324,4318,4408,4355,5013,5965,5962,4827,4337,4333,25042,647713,647718,647717,14272,30772,354868,11959,31013,647913,647902,40048,10088,5977,5052,31035,5050,31006,31007,30633,40046,35913,40047,647701,608048,13237,647862) AND cl.`id_lang` = 1
ORDER BY c.`level_depth` DESC
 0.914 ms 287 Yes /modules/ps_googleanalytics/classes/Wrapper/ProductWrapper.php:109
161 
SELECT SQL_NO_CACHE p.*,
ps.*,
pl.*,
sa.out_of_stock,
IFNULL(sa.quantity, 0) as quantity,
(DATEDIFF(
p.`date_add`,
DATE_SUB(
'2026-04-28 00:00:00',
INTERVAL 90 DAY
)
) > 0) as new
FROM een_product p
LEFT JOIN een_product_lang pl
ON pl.id_product = p.id_product
AND pl.id_shop = 1
AND pl.id_lang = 1
LEFT JOIN een_stock_available sa   ON sa.id_product = p.id_product
AND sa.id_product_attribute = 0
AND sa.id_shop = 1 LEFT JOIN een_product_shop ps
ON ps.id_product = p.id_product
AND ps.id_shop = 1
WHERE p.id_product IN (4525,25043,4412,647720,647723,647724,647719,36884,647808,10087,40017,4997,10086,40036,5964,40049,30894,4471,36882,4100,541226,549338,36837,36524,4489,4440,4482,4493,4458,5009,4447,6318,5018,11341,4448,6696,6531,6362,4508,4516,4322,4320,4324,4318,4408,4355,5013,5965,5962,4827,4337,4333,25042,647713,647718,647717,14272,30772,354868,11959,31013,647913,647902,40048,10088,5977,5052,31035,5050,31006,31007,30633,40046,35913,40047,647701,608048,13237,647862)
 0.824 ms 79 /classes/ProductAssembler.php:95
14 
SELECT SQL_NO_CACHE h.`name` as hook, m.`id_module`, h.`id_hook`, m.`name` as module
FROM `een_module` m
INNER JOIN een_module_shop module_shop
ON (module_shop.id_module = m.id_module AND module_shop.id_shop = 1 AND module_shop.enable_device & 1)
INNER JOIN `een_hook_module` `hm` ON hm.`id_module` = m.`id_module`
INNER JOIN `een_hook` `h` ON hm.`id_hook` = h.`id_hook`
LEFT JOIN `een_module_group` `mg` ON mg.`id_module` = m.`id_module`
WHERE (h.`name` != "paymentOptions") AND (hm.`id_shop` = 1) AND (mg.id_shop = 1 AND  mg.`id_group` IN (1))
GROUP BY hm.id_hook, hm.id_module
ORDER BY hm.`position`
 0.813 ms 244 Yes Yes /classes/Hook.php:1267
175 
SELECT SQL_NO_CACHE `id_hook`, `name`
FROM `een_hook`
UNION
SELECT `id_hook`, ha.`alias` as name
FROM `een_hook_alias` ha
INNER JOIN `een_hook` h ON ha.name = h.name
 0.606 ms 0 /classes/Hook.php:1326
176 
SELECT SQL_NO_CACHE h.id_hook, h.name as h_name, title, description, h.position, hm.position as hm_position, m.id_module, m.name, m.active
FROM `een_hook_module` hm
STRAIGHT_JOIN `een_hook` h ON (h.id_hook = hm.id_hook AND hm.id_shop = 1)
STRAIGHT_JOIN `een_module` as m ON (m.id_module = hm.id_module)
ORDER BY hm.position
 0.563 ms 486 /classes/Hook.php:456
101 
SELECT SQL_NO_CACHE *
FROM `een_gmcp_feeds` ff
WHERE (ff.id_shop=1)
ORDER BY ff.feed_is_default ASC
 0.516 ms 370 Yes /modules/gmerchantcenterpro/models/Feeds.php:62
13 
SELECT SQL_NO_CACHE lower(name) as name
FROM `een_hook` h
WHERE (h.active = 1)
 0.361 ms 1060 /classes/Hook.php:1366
155 
SELECT SQL_NO_CACHE c.`id_category`, cl.`name`
FROM `een_category` c
INNER JOIN een_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `een_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
ORDER BY c.nleft, c.position
 0.317 ms 330 Yes /classes/Category.php:724
854 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 10088) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.301 ms 2 Yes /classes/SpecificPrice.php:576
246 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 647719) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.299 ms 3 Yes /classes/SpecificPrice.php:576
573 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 6362) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.295 ms 2 Yes /classes/SpecificPrice.php:576
885 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 31035) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.291 ms 2 Yes /classes/SpecificPrice.php:576
865 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 5977) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.289 ms 2 Yes /classes/SpecificPrice.php:576
96 
SHOW COLUMNS FROM een_gmcp_feeds LIKE "feed_is_default"
 0.288 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:128
875 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 5052) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.287 ms 2 Yes /classes/SpecificPrice.php:576
139 
SELECT SQL_NO_CACHE DISTINCT f.id_feature, f.*, fl.*, IF(liflv.`url_name` IS NULL OR liflv.`url_name` = "", NULL, liflv.`url_name`) AS url_name, IF(liflv.`meta_title` IS NULL OR liflv.`meta_title` = "", NULL, liflv.`meta_title`) AS meta_title, lif.indexable FROM `een_feature` f  INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1) LEFT JOIN `een_feature_lang` fl ON (f.`id_feature` = fl.`id_feature` AND fl.`id_lang` = 1) LEFT JOIN `een_layered_indexable_feature` lif ON (f.`id_feature` = lif.`id_feature`) LEFT JOIN `een_layered_indexable_feature_lang_value` liflv ON (f.`id_feature` = liflv.`id_feature` AND liflv.`id_lang` = 1) ORDER BY f.`position` ASC
 0.276 ms 29 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:171
140 
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `een_feature_value` v LEFT JOIN `een_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `een_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 29 ORDER BY vl.`value` ASC
 0.266 ms 40 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
16 
SELECT SQL_NO_CACHE `id_hook`, `name` FROM `een_hook`
 0.263 ms 1060 /classes/Hook.php:1326
58 
SHOW TABLES LIKE "een_gmcp_1800"
 0.257 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:88
420 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 36837) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.254 ms 2 Yes /classes/SpecificPrice.php:576
938 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 40046) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.253 ms 2 Yes /classes/SpecificPrice.php:576
948 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 35913) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.250 ms 2 Yes /classes/SpecificPrice.php:576
916 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 31007) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.247 ms 2 Yes /classes/SpecificPrice.php:576
65 
SHOW TABLES LIKE "een_gmcp_1900"
 0.240 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:88
674 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 5965) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.233 ms 2 Yes /classes/SpecificPrice.php:576
594 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 4516) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.226 ms 2 Yes /classes/SpecificPrice.php:576
684 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 5962) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.225 ms 2 Yes /classes/SpecificPrice.php:576
694 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 4827) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.225 ms 2 Yes /classes/SpecificPrice.php:576
212 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 647720) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.220 ms 3 Yes /classes/SpecificPrice.php:576
811 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 31013) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.220 ms 2 Yes /classes/SpecificPrice.php:576
97 
SHOW COLUMNS FROM een_gmcp_discount_association LIKE "channel"
 0.219 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:128
251 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 647719 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 647719 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.217 ms 0 /classes/Cart.php:1430
98 
SHOW COLUMNS FROM een_gmcp_tags LIKE "custom_label_set_postion"
 0.216 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:128
895 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 5050) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.216 ms 2 Yes /classes/SpecificPrice.php:576
906 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 31006) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.215 ms 2 Yes /classes/SpecificPrice.php:576
146 
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `een_feature_value` v LEFT JOIN `een_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `een_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 10 ORDER BY vl.`value` ASC
 0.212 ms 37 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
409 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 549338) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.212 ms 2 Yes /classes/SpecificPrice.php:576
1336 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (13237) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.212 ms 1 Yes Yes /classes/Product.php:4524
172 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 4525) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.209 ms 2 Yes /classes/SpecificPrice.php:576
634 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 4318) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.209 ms 2 Yes /classes/SpecificPrice.php:576
188 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 25043) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.207 ms 2 Yes /classes/SpecificPrice.php:576
583 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 4508) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.206 ms 2 Yes /classes/SpecificPrice.php:576
704 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 4337) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.206 ms 2 Yes /classes/SpecificPrice.php:576
151 
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `een_feature_value` v LEFT JOIN `een_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `een_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 29 ORDER BY vl.`value` ASC
 0.205 ms 40 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
257 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 36884) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.205 ms 2 Yes /classes/SpecificPrice.php:576
737 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 647713) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.205 ms 3 Yes /classes/SpecificPrice.php:576
280 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 10087) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 2 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.204 ms 2 Yes /classes/SpecificPrice.php:576
291 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 40017) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.204 ms 2 Yes /classes/SpecificPrice.php:576
644 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 4408) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.204 ms 2 Yes /classes/SpecificPrice.php:576
725 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 25042) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.204 ms 2 Yes /classes/SpecificPrice.php:576
849 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 40048 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 40048 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.204 ms 0 /classes/Cart.php:1430
624 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 4324) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.203 ms 2 Yes /classes/SpecificPrice.php:576
552 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 6696) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.203 ms 2 Yes /classes/SpecificPrice.php:576
759 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 647717) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.203 ms 3 Yes /classes/SpecificPrice.php:576
791 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 354868) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.202 ms 2 Yes /classes/SpecificPrice.php:576
927 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 30633) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.202 ms 2 Yes /classes/SpecificPrice.php:576
223 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 647723) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.201 ms 3 Yes /classes/SpecificPrice.php:576
269 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 647808) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.201 ms 2 Yes /classes/SpecificPrice.php:576
958 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 40047) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.201 ms 2 Yes /classes/SpecificPrice.php:576
235 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 647724) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.200 ms 3 Yes /classes/SpecificPrice.php:576
614 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 4320) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.200 ms 2 Yes /classes/SpecificPrice.php:576
801 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 11959) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.200 ms 2 Yes /classes/SpecificPrice.php:576
969 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 647701) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.200 ms 2 Yes /classes/SpecificPrice.php:576
1225 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 608048) AND (b.`id_shop` = 1) LIMIT 1
 0.200 ms 1 /src/Adapter/EntityMapper.php:71
542 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 4448) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.199 ms 2 Yes /classes/SpecificPrice.php:576
748 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 647718) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.199 ms 3 Yes /classes/SpecificPrice.php:576
431 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 36524) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.198 ms 2 Yes /classes/SpecificPrice.php:576
714 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 4333) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.198 ms 2 Yes /classes/SpecificPrice.php:576
302 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 4997) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 2 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.198 ms 2 Yes /classes/SpecificPrice.php:576
604 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 4322) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.197 ms 2 Yes /classes/SpecificPrice.php:576
199 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 4412) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.197 ms 2 Yes /classes/SpecificPrice.php:576
844 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 40048) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.197 ms 2 Yes /classes/SpecificPrice.php:576
1283 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4489) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.197 ms 1 Yes Yes /classes/Product.php:4524
313 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 10086) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.196 ms 2 Yes /classes/SpecificPrice.php:576
324 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 40036) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 2 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.196 ms 2 Yes /classes/SpecificPrice.php:576
563 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 6531) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.196 ms 2 Yes /classes/SpecificPrice.php:576
664 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 5013) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.196 ms 2 Yes /classes/SpecificPrice.php:576
769 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 14272) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.196 ms 2 Yes /classes/SpecificPrice.php:576
780 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 30772) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.196 ms 2 Yes /classes/SpecificPrice.php:576
834 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 647902) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.196 ms 2 Yes /classes/SpecificPrice.php:576
441 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 4489) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.195 ms 2 Yes /classes/SpecificPrice.php:576
654 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 4355) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.195 ms 2 Yes /classes/SpecificPrice.php:576
823 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 647913) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.195 ms 2 Yes /classes/SpecificPrice.php:576
979 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 608048) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.195 ms 2 Yes /classes/SpecificPrice.php:576
461 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 4482) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.194 ms 2 Yes /classes/SpecificPrice.php:576
532 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 11341) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.194 ms 2 Yes /classes/SpecificPrice.php:576
989 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 13237) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.194 ms 2 Yes /classes/SpecificPrice.php:576
335 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 5964) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 2 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.194 ms 2 Yes /classes/SpecificPrice.php:576
356 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 30894) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.194 ms 2 Yes /classes/SpecificPrice.php:576
346 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 40049) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.193 ms 2 Yes /classes/SpecificPrice.php:576
378 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 36882) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.193 ms 2 Yes /classes/SpecificPrice.php:576
451 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 4440) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.193 ms 2 Yes /classes/SpecificPrice.php:576
492 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 5009) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.193 ms 2 Yes /classes/SpecificPrice.php:576
1096 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6318) AND (b.`id_shop` = 1) LIMIT 1
 0.193 ms 1 /src/Adapter/EntityMapper.php:71
399 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 541226) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.193 ms 2 Yes /classes/SpecificPrice.php:576
471 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 4493) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.193 ms 2 Yes /classes/SpecificPrice.php:576
1000 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 647862) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.193 ms 2 Yes /classes/SpecificPrice.php:576
871 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5977
ORDER BY f.position ASC
 0.192 ms 11 Yes /classes/Product.php:6021
367 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 4471) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.192 ms 2 Yes /classes/SpecificPrice.php:576
388 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 4100) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 4 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.192 ms 2 Yes /classes/SpecificPrice.php:576
481 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 4458) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.192 ms 2 Yes /classes/SpecificPrice.php:576
522 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 5018) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.192 ms 2 Yes /classes/SpecificPrice.php:576
502 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 4447) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.190 ms 2 Yes /classes/SpecificPrice.php:576
512 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 6318) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.190 ms 2 Yes /classes/SpecificPrice.php:576
860 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 10088
ORDER BY f.position ASC
 0.189 ms 10 Yes /classes/Product.php:6021
1297 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4508) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.189 ms 1 Yes Yes /classes/Product.php:4524
881 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5052
ORDER BY f.position ASC
 0.188 ms 12 Yes /classes/Product.php:6021
20 
SELECT SQL_NO_CACHE m.page, ml.url_rewrite, ml.id_lang
FROM `een_meta` m
LEFT JOIN `een_meta_lang` ml ON (m.id_meta = ml.id_meta AND ml.id_shop = 1 )
ORDER BY LENGTH(ml.url_rewrite) DESC
 0.187 ms 66 Yes /classes/Dispatcher.php:654
102 
SELECT SQL_NO_CACHE *
FROM `een_gmcp_feeds` ff
WHERE (ff.iso_lang="fr") AND (ff.id_shop=1)
ORDER BY ff.feed_is_default ASC
 0.187 ms 370 Yes /modules/gmerchantcenterpro/models/Feeds.php:72
1326 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (31035) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.186 ms 1 Yes Yes /classes/Product.php:4524
578 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6362 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6362 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.185 ms 0 /classes/Cart.php:1430
700 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4827
ORDER BY f.position ASC
 0.183 ms 10 Yes /classes/Product.php:6021
1318 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (11959) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.183 ms 1 Yes Yes /classes/Product.php:4524
1284 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4440) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.183 ms 1 Yes Yes /classes/Product.php:4524
1317 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (354868) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.182 ms 1 Yes Yes /classes/Product.php:4524
870 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5977 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5977 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.181 ms 0 /classes/Cart.php:1430
1304 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4355) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.180 ms 1 Yes Yes /classes/Product.php:4524
1311 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (25042) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.180 ms 1 Yes Yes /classes/Product.php:4524
859 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 10088 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 10088 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.179 ms 0 /classes/Cart.php:1430
1302 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4318) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.179 ms 1 Yes Yes /classes/Product.php:4524
1313 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (647718) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.178 ms 1 Yes Yes /classes/Product.php:4524
911 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 31006 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 31006 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.177 ms 0 /classes/Cart.php:1430
1259 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4525) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.177 ms 1 Yes Yes /classes/Product.php:4524
404 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 541226 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 541226 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.175 ms 0 /classes/Cart.php:1430
880 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5052 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5052 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.175 ms 0 /classes/Cart.php:1430
1306 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5965) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.174 ms 1 Yes Yes /classes/Product.php:4524
1337 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (647862) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.173 ms 1 Yes Yes /classes/Product.php:4524
890 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 31035 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 31035 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.173 ms 0 /classes/Cart.php:1430
1303 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4408) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.173 ms 1 Yes Yes /classes/Product.php:4524
1315 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (14272) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.173 ms 1 Yes Yes /classes/Product.php:4524
1285 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4482) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.172 ms 1 Yes Yes /classes/Product.php:4524
1305 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5013) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.172 ms 1 Yes Yes /classes/Product.php:4524
1312 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (647713) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.172 ms 1 Yes Yes /classes/Product.php:4524
1314 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (647717) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.171 ms 1 Yes Yes /classes/Product.php:4524
679 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5965 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5965 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.170 ms 0 /classes/Cart.php:1430
1308 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4827) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.169 ms 1 Yes Yes /classes/Product.php:4524
1097 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6318
ORDER BY `position`
 0.169 ms 6 Yes /classes/Product.php:3545
1310 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4333) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.169 ms 1 Yes Yes /classes/Product.php:4524
18 
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `een_module` m
LEFT JOIN `een_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
 0.168 ms 104 /classes/module/Module.php:346
405 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 541226
ORDER BY f.position ASC
 0.168 ms 8 Yes /classes/Product.php:6021
1335 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (608048) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.168 ms 1 Yes Yes /classes/Product.php:4524
183 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4525
ORDER BY f.position ASC
 0.167 ms 9 Yes /classes/Product.php:6021
1319 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (31013) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.167 ms 1 Yes Yes /classes/Product.php:4524
932 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 30633 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 30633 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.166 ms 0 /classes/Cart.php:1430
953 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 35913 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 35913 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.166 ms 0 /classes/Cart.php:1430
1099 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5018) AND (b.`id_shop` = 1) LIMIT 1
 0.166 ms 1 /src/Adapter/EntityMapper.php:71
1196 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5052) AND (b.`id_shop` = 1) LIMIT 1
 0.166 ms 1 /src/Adapter/EntityMapper.php:71
1298 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4516) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.165 ms 1 Yes Yes /classes/Product.php:4524
1299 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4322) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.165 ms 1 Yes Yes /classes/Product.php:4524
1327 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5050) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.165 ms 1 Yes Yes /classes/Product.php:4524
252 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 647719
ORDER BY f.position ASC
 0.164 ms 8 Yes /classes/Product.php:6021
689 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5962 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5962 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.164 ms 0 /classes/Cart.php:1430
699 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4827 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4827 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.164 ms 0 /classes/Cart.php:1430
1320 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (647913) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.164 ms 1 Yes Yes /classes/Product.php:4524
1093 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4447) AND (b.`id_shop` = 1) LIMIT 1
 0.163 ms 1 /src/Adapter/EntityMapper.php:71
850 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 40048
ORDER BY f.position ASC
 0.163 ms 2 Yes /classes/Product.php:6021
1264 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (647724) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.163 ms 1 Yes Yes /classes/Product.php:4524
900 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5050 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5050 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.162 ms 0 /classes/Cart.php:1430
1324 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5977) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.162 ms 1 Yes Yes /classes/Product.php:4524
138 
SELECT SQL_NO_CACHE type, id_value, filter_show_limit, filter_type FROM een_layered_category
WHERE controller = 'prices-drop'
AND id_category = 0
AND id_shop = 1
GROUP BY `type`, id_value ORDER BY position ASC
 0.161 ms 40 Yes Yes /modules/ps_facetedsearch/src/Filters/Provider.php:61
690 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5962
ORDER BY f.position ASC
 0.161 ms 9 Yes /classes/Product.php:6021
1316 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (30772) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.161 ms 1 Yes Yes /classes/Product.php:4524
168 
SELECT SQL_NO_CACHE DISTINCT `id_product` FROM `een_specific_price` WHERE `id_product` != 0
 0.160 ms 523 /classes/SpecificPrice.php:310
680 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5965
ORDER BY f.position ASC
 0.160 ms 8 Yes /classes/Product.php:6021
1100 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5018
ORDER BY `position`
 0.159 ms 5 Yes /classes/Product.php:3545
182 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4525 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4525 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.158 ms 0 /classes/Cart.php:1430
1141 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5013) AND (b.`id_shop` = 1) LIMIT 1
 0.158 ms 1 /src/Adapter/EntityMapper.php:71
891 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 31035
ORDER BY f.position ASC
 0.157 ms 3 Yes /classes/Product.php:6021
24 
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `een_module` m
LEFT JOIN `een_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
 0.157 ms 104 /classes/module/Module.php:346
1322 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (40048) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.156 ms 1 Yes Yes /classes/Product.php:4524
1261 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4412) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.156 ms 1 Yes Yes /classes/Product.php:4524
1289 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4447) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.156 ms 1 Yes Yes /classes/Product.php:4524
1228 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 13237) AND (b.`id_shop` = 1) LIMIT 1
 0.154 ms 1 /src/Adapter/EntityMapper.php:71
1271 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (10086) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.154 ms 1 Yes Yes /classes/Product.php:4524
901 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5050
ORDER BY f.position ASC
 0.153 ms 12 Yes /classes/Product.php:6021
1262 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (647720) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.153 ms 1 Yes Yes /classes/Product.php:4524
1334 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (647701) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.153 ms 1 Yes Yes /classes/Product.php:4524
218 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 647720
ORDER BY f.position ASC
 0.152 ms 8 Yes /classes/Product.php:6021
1321 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (647902) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.151 ms 1 Yes Yes /classes/Product.php:4524
228 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 647723 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 647723 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.151 ms 0 /classes/Cart.php:1430
709 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4337 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4337 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.150 ms 0 /classes/Cart.php:1430
974 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 647701 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 647701 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.150 ms 0 /classes/Cart.php:1430
1309 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4337) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.150 ms 1 Yes Yes /classes/Product.php:4524
1278 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4100) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.149 ms 1 Yes Yes /classes/Product.php:4524
149 
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `een_feature_value` v LEFT JOIN `een_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `een_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 20 ORDER BY vl.`value` ASC
 0.148 ms 9 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
1277 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (36882) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.148 ms 1 Yes Yes /classes/Product.php:4524
1286 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4493) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.148 ms 1 Yes Yes /classes/Product.php:4524
807 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 11959
ORDER BY f.position ASC
 0.148 ms 11 Yes /classes/Product.php:6021
217 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 647720 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 647720 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.147 ms 0 /classes/Cart.php:1430
262 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 36884 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 36884 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.147 ms 0 /classes/Cart.php:1430
984 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 608048 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 608048 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.147 ms 0 /classes/Cart.php:1430
1090 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5009) AND (b.`id_shop` = 1) LIMIT 1
 0.147 ms 1 /src/Adapter/EntityMapper.php:71
1265 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (647719) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.147 ms 1 Yes Yes /classes/Product.php:4524
1263 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (647723) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.147 ms 1 Yes Yes /classes/Product.php:4524
1276 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4471) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.147 ms 1 Yes Yes /classes/Product.php:4524
720 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4333
ORDER BY f.position ASC
 0.146 ms 6 Yes /classes/Product.php:6021
588 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4508 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4508 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.146 ms 0 /classes/Cart.php:1430
630 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4324
ORDER BY f.position ASC
 0.146 ms 9 Yes /classes/Product.php:6021
710 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4337
ORDER BY f.position ASC
 0.145 ms 6 Yes /classes/Product.php:6021
1067 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 549338
ORDER BY `position`
 0.145 ms 8 Yes /classes/Product.php:3545
1274 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (40049) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.145 ms 1 Yes Yes /classes/Product.php:4524
206 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4412
ORDER BY f.position ASC
 0.144 ms 9 Yes /classes/Product.php:6021
308 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4997
ORDER BY f.position ASC
 0.144 ms 11 Yes /classes/Product.php:6021
579 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6362
ORDER BY f.position ASC
 0.144 ms 5 Yes /classes/Product.php:6021
629 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4324 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4324 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.144 ms 0 /classes/Cart.php:1430
1235 
SELECT SQL_NO_CACHE * FROM `een_cart_rule` cr
LEFT JOIN `een_cart_rule_lang` crl 
ON (cr.`id_cart_rule` = crl.`id_cart_rule` AND crl.`id_lang` = 1) WHERE (cr.`id_customer` = 0) AND NOW() BETWEEN cr.date_from AND cr.date_to
AND cr.`active` = 1
AND free_shipping = 1 AND carrier_restriction = 1
 0.144 ms 1 /classes/CartRule.php:423
1275 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (30894) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.144 ms 1 Yes Yes /classes/Product.php:4524
446 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4489 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4489 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.143 ms 0 /classes/Cart.php:1430
1208 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 31007) AND (b.`id_shop` = 1) LIMIT 1
 0.143 ms 1 /src/Adapter/EntityMapper.php:71
1268 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (10087) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.143 ms 1 Yes Yes /classes/Product.php:4524
1269 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (40017) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.143 ms 1 Yes Yes /classes/Product.php:4524
985 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 608048
ORDER BY f.position ASC
 0.143 ms 7 Yes /classes/Product.php:6021
341 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5964
ORDER BY f.position ASC
 0.142 ms 7 Yes /classes/Product.php:6021
425 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 36837 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 36837 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.142 ms 0 /classes/Cart.php:1430
456 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4440 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4440 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.142 ms 0 /classes/Cart.php:1430
537 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 11341 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 11341 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.142 ms 0 /classes/Cart.php:1430
719 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4333 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4333 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.142 ms 0 /classes/Cart.php:1430
743 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 647713
ORDER BY f.position ASC
 0.142 ms 7 Yes /classes/Product.php:6021
1180 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 31013) AND (b.`id_shop` = 1) LIMIT 1
 0.142 ms 1 /src/Adapter/EntityMapper.php:71
1270 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4997) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.142 ms 1 Yes Yes /classes/Product.php:4524
1272 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (40036) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.142 ms 1 Yes Yes /classes/Product.php:4524
610 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4322
ORDER BY f.position ASC
 0.142 ms 9 Yes /classes/Product.php:6021
753 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 647718 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 647718 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.142 ms 0 /classes/Cart.php:1430
921 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 31007 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 31007 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.142 ms 0 /classes/Cart.php:1430
1260 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (25043) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.142 ms 1 Yes Yes /classes/Product.php:4524
1273 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5964) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.142 ms 1 Yes Yes /classes/Product.php:4524
943 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 40046 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 40046 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.141 ms 0 /classes/Cart.php:1430
229 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 647723
ORDER BY f.position ASC
 0.141 ms 8 Yes /classes/Product.php:6021
373 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4471
ORDER BY f.position ASC
 0.141 ms 10 Yes /classes/Product.php:6021
414 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 549338 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 549338 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.141 ms 0 /classes/Cart.php:1430
1066 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 549338) AND (b.`id_shop` = 1) LIMIT 1
 0.141 ms 1 /src/Adapter/EntityMapper.php:71
1307 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5962) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.141 ms 1 Yes Yes /classes/Product.php:4524
372 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4471 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4471 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.140 ms 0 /classes/Cart.php:1430
754 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 647718
ORDER BY f.position ASC
 0.140 ms 9 Yes /classes/Product.php:6021
829 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 647913
ORDER BY f.position ASC
 0.140 ms 7 Yes /classes/Product.php:6021
1325 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5052) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.140 ms 1 Yes Yes /classes/Product.php:4524
193 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 25043 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 25043 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.140 ms 0 /classes/Cart.php:1430
286 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 10087
ORDER BY f.position ASC
 0.140 ms 8 Yes /classes/Product.php:6021
383 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 36882 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 36882 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.140 ms 0 /classes/Cart.php:1430
466 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4482 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4482 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.140 ms 0 /classes/Cart.php:1430
599 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4516 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4516 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.140 ms 0 /classes/Cart.php:1430
640 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4318
ORDER BY f.position ASC
 0.140 ms 10 Yes /classes/Product.php:6021
765 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 647717
ORDER BY f.position ASC
 0.140 ms 7 Yes /classes/Product.php:6021
839 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 647902 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 647902 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.140 ms 0 /classes/Cart.php:1430
1231 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 647862) AND (b.`id_shop` = 1) LIMIT 1
 0.140 ms 1 /src/Adapter/EntityMapper.php:71
1301 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4324) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.140 ms 1 Yes Yes /classes/Product.php:4524
1323 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (10088) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.140 ms 1 Yes Yes /classes/Product.php:4524
205 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4412 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4412 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.139 ms 0 /classes/Cart.php:1430
240 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 647724 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 647724 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.139 ms 0 /classes/Cart.php:1430
247 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 647719)
 0.139 ms 1 /classes/Product.php:3860
274 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 647808 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 647808 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.139 ms 0 /classes/Cart.php:1430
393 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4100 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4100 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.139 ms 0 /classes/Cart.php:1430
538 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 11341
ORDER BY f.position ASC
 0.139 ms 7 Yes /classes/Product.php:6021
730 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 25042 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 25042 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.139 ms 0 /classes/Cart.php:1430
1156 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4333) AND (b.`id_shop` = 1) LIMIT 1
 0.139 ms 1 /src/Adapter/EntityMapper.php:71
1205 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 31006) AND (b.`id_shop` = 1) LIMIT 1
 0.139 ms 1 /src/Adapter/EntityMapper.php:71
241 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 647724
ORDER BY f.position ASC
 0.138 ms 8 Yes /classes/Product.php:6021
476 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4493 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4493 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.138 ms 0 /classes/Cart.php:1430
609 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4322 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4322 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.138 ms 0 /classes/Cart.php:1430
742 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 647713 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 647713 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.138 ms 0 /classes/Cart.php:1430
963 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 40047 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 40047 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.138 ms 0 /classes/Cart.php:1430
361 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 30894 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 30894 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.138 ms 0 /classes/Cart.php:1430
557 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6696 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6696 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.138 ms 0 /classes/Cart.php:1430
1226 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 608048
ORDER BY `position`
 0.138 ms 6 Yes /classes/Product.php:3545
285 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 10087 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 10087 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.137 ms 0 /classes/Cart.php:1430
296 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 40017 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 40017 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.137 ms 0 /classes/Cart.php:1430
436 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 36524 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 36524 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.137 ms 0 /classes/Cart.php:1430
620 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4320
ORDER BY f.position ASC
 0.137 ms 9 Yes /classes/Product.php:6021
639 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4318 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4318 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.137 ms 0 /classes/Cart.php:1430
1290 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6318) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.137 ms 1 Yes Yes /classes/Product.php:4524
415 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 549338
ORDER BY f.position ASC
 0.137 ms 6 Yes /classes/Product.php:6021
619 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4320 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4320 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.137 ms 0 /classes/Cart.php:1430
764 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 647717 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 647717 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.137 ms 0 /classes/Cart.php:1430
1288 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5009) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.137 ms 1 Yes Yes /classes/Product.php:4524
319 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 10086
ORDER BY f.position ASC
 0.136 ms 8 Yes /classes/Product.php:6021
329 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 40036 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 40036 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.136 ms 0 /classes/Cart.php:1430
669 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5013 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5013 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.136 ms 0 /classes/Cart.php:1430
1171 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 30772) AND (b.`id_shop` = 1) LIMIT 1
 0.136 ms 1 /src/Adapter/EntityMapper.php:71
318 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 10086 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 10086 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.136 ms 0 /classes/Cart.php:1430
486 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4458 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4458 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.136 ms 0 /classes/Cart.php:1430
568 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6531 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6531 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.136 ms 0 /classes/Cart.php:1430
649 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4408 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4408 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.136 ms 0 /classes/Cart.php:1430
774 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 14272 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 14272 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.136 ms 0 /classes/Cart.php:1430
912 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 31006
ORDER BY f.position ASC
 0.136 ms 3 Yes /classes/Product.php:6021
954 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 35913
ORDER BY f.position ASC
 0.136 ms 1 Yes /classes/Product.php:6021
994 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 13237 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 13237 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.136 ms 0 /classes/Cart.php:1430
1280 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (549338) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.136 ms 1 Yes Yes /classes/Product.php:4524
394 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4100
ORDER BY f.position ASC
 0.135 ms 9 Yes /classes/Product.php:6021
508 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4447
ORDER BY f.position ASC
 0.135 ms 9 Yes /classes/Product.php:6021
650 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4408
ORDER BY f.position ASC
 0.135 ms 9 Yes /classes/Product.php:6021
796 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 354868 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 354868 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.135 ms 0 /classes/Cart.php:1430
806 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 11959 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 11959 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.135 ms 0 /classes/Cart.php:1430
828 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 647913 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 647913 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.135 ms 0 /classes/Cart.php:1430
1217 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 35913) AND (b.`id_shop` = 1) LIMIT 1
 0.135 ms 1 /src/Adapter/EntityMapper.php:71
307 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4997 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4997 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.135 ms 0 /classes/Cart.php:1430
447 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4489
ORDER BY f.position ASC
 0.135 ms 6 Yes /classes/Product.php:6021
457 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4440
ORDER BY f.position ASC
 0.135 ms 7 Yes /classes/Product.php:6021
497 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5009 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5009 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.135 ms 0 /classes/Cart.php:1430
659 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4355 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4355 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.135 ms 0 /classes/Cart.php:1430
785 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 30772 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 30772 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.135 ms 0 /classes/Cart.php:1430
1005 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 647862 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 647862 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.135 ms 0 /classes/Cart.php:1430
1144 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5965) AND (b.`id_shop` = 1) LIMIT 1
 0.135 ms 1 /src/Adapter/EntityMapper.php:71
1237 
SELECT SQL_NO_CACHE * FROM `een_cart_rule` cr
LEFT JOIN `een_cart_rule_lang` crl 
ON (cr.`id_cart_rule` = crl.`id_cart_rule` AND crl.`id_lang` = 0) WHERE (cr.`id_customer` = 0) AND NOW() BETWEEN cr.date_from AND cr.date_to
AND cr.`active` = 1
AND cr.`quantity` > 0 AND highlight = 1 AND code NOT LIKE "BO_ORDER_%"
 0.135 ms 1 /classes/CartRule.php:423
1291 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (5018) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.135 ms 1 Yes Yes /classes/Product.php:4524
340 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5964 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5964 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.134 ms 0 /classes/Cart.php:1430
351 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 40049 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 40049 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.134 ms 0 /classes/Cart.php:1430
498 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5009
ORDER BY f.position ASC
 0.134 ms 7 Yes /classes/Product.php:6021
507 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4447 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4447 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.134 ms 0 /classes/Cart.php:1430
517 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6318 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6318 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.134 ms 0 /classes/Cart.php:1430
527 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 5018 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 5018 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.134 ms 0 /classes/Cart.php:1430
547 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4448 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4448 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.134 ms 0 /classes/Cart.php:1430
600 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4516
ORDER BY f.position ASC
 0.134 ms 6 Yes /classes/Product.php:6021
1287 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4458) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.134 ms 1 Yes Yes /classes/Product.php:4524
1294 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6696) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.134 ms 1 Yes Yes /classes/Product.php:4524
1300 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4320) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.134 ms 1 Yes Yes /classes/Product.php:4524
1328 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (31006) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.134 ms 1 Yes Yes /classes/Product.php:4524
1333 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (40047) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.134 ms 1 Yes Yes /classes/Product.php:4524
518 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6318
ORDER BY f.position ASC
 0.133 ms 6 Yes /classes/Product.php:6021
528 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5018
ORDER BY f.position ASC
 0.133 ms 7 Yes /classes/Product.php:6021
589 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4508
ORDER BY f.position ASC
 0.133 ms 5 Yes /classes/Product.php:6021
817 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 31013
ORDER BY f.position ASC
 0.133 ms 7 Yes /classes/Product.php:6021
975 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 647701
ORDER BY f.position ASC
 0.133 ms 3 Yes /classes/Product.php:6021
1094 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4447
ORDER BY `position`
 0.133 ms 6 Yes /classes/Product.php:3545
1214 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 40046) AND (b.`id_shop` = 1) LIMIT 1
 0.133 ms 1 /src/Adapter/EntityMapper.php:71
1292 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (11341) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.133 ms 1 Yes Yes /classes/Product.php:4524
1293 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4448) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.133 ms 1 Yes Yes /classes/Product.php:4524
275 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 647808
ORDER BY f.position ASC
 0.133 ms 5 Yes /classes/Product.php:6021
816 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 31013 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 31013 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.133 ms 0 /classes/Cart.php:1430
840 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 647902
ORDER BY f.position ASC
 0.133 ms 6 Yes /classes/Product.php:6021
1296 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6362) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.133 ms 1 Yes Yes /classes/Product.php:4524
487 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4458
ORDER BY f.position ASC
 0.132 ms 7 Yes /classes/Product.php:6021
558 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6696
ORDER BY f.position ASC
 0.132 ms 5 Yes /classes/Product.php:6021
995 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 13237
ORDER BY f.position ASC
 0.132 ms 7 Yes /classes/Product.php:6021
1091 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5009
ORDER BY `position`
 0.132 ms 6 Yes /classes/Product.php:3545
352 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 40049
ORDER BY f.position ASC
 0.131 ms 2 Yes /classes/Product.php:6021
467 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4482
ORDER BY f.position ASC
 0.131 ms 6 Yes /classes/Product.php:6021
775 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 14272
ORDER BY f.position ASC
 0.131 ms 6 Yes /classes/Product.php:6021
1078 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4440) AND (b.`id_shop` = 1) LIMIT 1
 0.131 ms 1 /src/Adapter/EntityMapper.php:71
1202 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5050) AND (b.`id_shop` = 1) LIMIT 1
 0.131 ms 1 /src/Adapter/EntityMapper.php:71
1211 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 30633) AND (b.`id_shop` = 1) LIMIT 1
 0.131 ms 1 /src/Adapter/EntityMapper.php:71
477 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4493
ORDER BY f.position ASC
 0.131 ms 7 Yes /classes/Product.php:6021
1220 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 40047) AND (b.`id_shop` = 1) LIMIT 1
 0.131 ms 1 /src/Adapter/EntityMapper.php:71
660 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4355
ORDER BY f.position ASC
 0.130 ms 6 Yes /classes/Product.php:6021
670 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 5013
ORDER BY f.position ASC
 0.130 ms 6 Yes /classes/Product.php:6021
1234 
SELECT SQL_NO_CACHE 1 FROM `een_cart_rule` WHERE ((date_to >= "2026-04-28 00:00:00" AND date_to <= "2026-04-28 23:59:59") OR (date_from >= "2026-04-28 00:00:00" AND date_from <= "2026-04-28 23:59:59") OR (date_from < "2026-04-28 00:00:00" AND date_to > "2026-04-28 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
 0.130 ms 2 /classes/CartRule.php:357
548 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4448
ORDER BY f.position ASC
 0.130 ms 6 Yes /classes/Product.php:6021
1267 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (647808) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.130 ms 1 Yes Yes /classes/Product.php:4524
43 
SELECT SQL_NO_CACHE *
FROM een_meta m
LEFT JOIN een_meta_lang ml ON m.id_meta = ml.id_meta
WHERE (
m.page = "prices-drop"
OR m.page = "pricesdrop"
)
AND ml.id_lang = 1
AND ml.id_shop = 1 LIMIT 1
 0.129 ms 2 /classes/Meta.php:193
153 
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `een_feature_value` v LEFT JOIN `een_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `een_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 34 ORDER BY vl.`value` ASC
 0.129 ms 8 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
194 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 25043
ORDER BY f.position ASC
 0.129 ms 3 Yes /classes/Product.php:6021
569 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6531
ORDER BY f.position ASC
 0.129 ms 5 Yes /classes/Product.php:6021
933 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 30633
ORDER BY f.position ASC
 0.129 ms 1 Yes /classes/Product.php:6021
1081 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4482) AND (b.`id_shop` = 1) LIMIT 1
 0.129 ms 1 /src/Adapter/EntityMapper.php:71
1295 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6531) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.129 ms 1 Yes Yes /classes/Product.php:4524
426 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 36837
ORDER BY f.position ASC
 0.128 ms 2 Yes /classes/Product.php:6021
922 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 31007
ORDER BY f.position ASC
 0.128 ms 3 Yes /classes/Product.php:6021
1329 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (31007) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.128 ms 1 Yes Yes /classes/Product.php:4524
1282 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (36524) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.127 ms 1 Yes Yes /classes/Product.php:4524
1190 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10088) AND (b.`id_shop` = 1) LIMIT 1
 0.126 ms 1 /src/Adapter/EntityMapper.php:71
1142 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5013
ORDER BY `position`
 0.125 ms 4 Yes /classes/Product.php:3545
1330 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (30633) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.125 ms 1 Yes Yes /classes/Product.php:4524
1063 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 541226) AND (b.`id_shop` = 1) LIMIT 1
 0.125 ms 1 /src/Adapter/EntityMapper.php:71
1174 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 354868) AND (b.`id_shop` = 1) LIMIT 1
 0.125 ms 1 /src/Adapter/EntityMapper.php:71
1229 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 13237
ORDER BY `position`
 0.125 ms 5 Yes /classes/Product.php:3545
1266 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (36884) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.125 ms 1 Yes Yes /classes/Product.php:4524
944 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 40046
ORDER BY f.position ASC
 0.124 ms 2 Yes /classes/Product.php:6021
297 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 40017
ORDER BY f.position ASC
 0.123 ms 2 Yes /classes/Product.php:6021
437 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 36524
ORDER BY f.position ASC
 0.123 ms 1 Yes /classes/Product.php:6021
1159 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 25042) AND (b.`id_shop` = 1) LIMIT 1
 0.123 ms 1 /src/Adapter/EntityMapper.php:71
1193 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5977) AND (b.`id_shop` = 1) LIMIT 1
 0.123 ms 1 /src/Adapter/EntityMapper.php:71
1281 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (36837) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.123 ms 1 Yes Yes /classes/Product.php:4524
2 
SELECT SQL_NO_CACHE gs.*, s.*, gs.name AS group_name, s.name AS shop_name, s.active, su.domain, su.domain_ssl, su.physical_uri, su.virtual_uri
FROM een_shop_group gs
LEFT JOIN een_shop s
ON s.id_shop_group = gs.id_shop_group
LEFT JOIN een_shop_url su
ON s.id_shop = su.id_shop AND su.main = 1
WHERE s.deleted = 0
AND gs.deleted = 0
ORDER BY gs.name, s.name
 0.122 ms 1 Yes /classes/shop/Shop.php:715
1028 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 647808
ORDER BY `position`
 0.122 ms 11 Yes /classes/Product.php:3545
1177 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 11959) AND (b.`id_shop` = 1) LIMIT 1
 0.122 ms 1 /src/Adapter/EntityMapper.php:71
1199 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 31035) AND (b.`id_shop` = 1) LIMIT 1
 0.122 ms 1 /src/Adapter/EntityMapper.php:71
1331 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (40046) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.122 ms 1 Yes Yes /classes/Product.php:4524
1332 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (35913) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.121 ms 1 Yes Yes /classes/Product.php:4524
797 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 354868
ORDER BY f.position ASC
 0.121 ms 2 Yes /classes/Product.php:6021
1084 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4493) AND (b.`id_shop` = 1) LIMIT 1
 0.121 ms 1 /src/Adapter/EntityMapper.php:71
1168 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 14272) AND (b.`id_shop` = 1) LIMIT 1
 0.121 ms 1 /src/Adapter/EntityMapper.php:71
1181 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 31013
ORDER BY `position`
 0.120 ms 6 Yes /classes/Product.php:3545
1279 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (541226) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.120 ms 1 Yes Yes /classes/Product.php:4524
263 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 36884
ORDER BY f.position ASC
 0.120 ms 1 Yes /classes/Product.php:6021
964 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 40047
ORDER BY f.position ASC
 0.120 ms 2 Yes /classes/Product.php:6021
1007 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4525) AND (b.`id_shop` = 1) LIMIT 1
 0.120 ms 1 /src/Adapter/EntityMapper.php:71
1072 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 36524) AND (b.`id_shop` = 1) LIMIT 1
 0.119 ms 1 /src/Adapter/EntityMapper.php:71
330 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 40036
ORDER BY f.position ASC
 0.119 ms 2 Yes /classes/Product.php:6021
362 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 30894
ORDER BY f.position ASC
 0.119 ms 2 Yes /classes/Product.php:6021
786 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 30772
ORDER BY f.position ASC
 0.119 ms 2 Yes /classes/Product.php:6021
1138 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4355) AND (b.`id_shop` = 1) LIMIT 1
 0.119 ms 1 /src/Adapter/EntityMapper.php:71
1183 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 647913
ORDER BY `position`
 0.119 ms 7 Yes /classes/Product.php:3545
595 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4516)
 0.118 ms 1 /classes/Product.php:3860
1153 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4337) AND (b.`id_shop` = 1) LIMIT 1
 0.118 ms 1 /src/Adapter/EntityMapper.php:71
1006 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 647862
ORDER BY f.position ASC
 0.117 ms 1 Yes /classes/Product.php:6021
731 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 25042
ORDER BY f.position ASC
 0.117 ms 1 Yes /classes/Product.php:6021
1126 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4320) AND (b.`id_shop` = 1) LIMIT 1
 0.117 ms 1 /src/Adapter/EntityMapper.php:71
1187 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 40048) AND (b.`id_shop` = 1) LIMIT 1
 0.117 ms 1 /src/Adapter/EntityMapper.php:71
1185 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 647902
ORDER BY `position`
 0.116 ms 8 Yes /classes/Product.php:3545
1223 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 647701
ORDER BY `position`
 0.116 ms 7 Yes /classes/Product.php:3545
1105 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4448) AND (b.`id_shop` = 1) LIMIT 1
 0.116 ms 1 /src/Adapter/EntityMapper.php:71
384 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 36882
ORDER BY f.position ASC
 0.115 ms 1 Yes /classes/Product.php:6021
1232 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 647862
ORDER BY `position`
 0.115 ms 5 Yes /classes/Product.php:3545
1117 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4508) AND (b.`id_shop` = 1) LIMIT 1
 0.114 ms 1 /src/Adapter/EntityMapper.php:71
1079 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4440
ORDER BY `position`
 0.114 ms 6 Yes /classes/Product.php:3545
177 
SELECT SQL_NO_CACHE tr.*
FROM `een_tax_rule` tr
JOIN `een_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 21
AND tr.`id_tax_rules_group` = 1
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
 0.113 ms 1 /classes/tax/TaxRulesTaxManager.php:109
1102 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 11341) AND (b.`id_shop` = 1) LIMIT 1
 0.113 ms 1 /src/Adapter/EntityMapper.php:71
1162 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 647713
ORDER BY `position`
 0.113 ms 11 Yes /classes/Product.php:3545
1209 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 31007
ORDER BY `position`
 0.113 ms 5 Yes /classes/Product.php:3545
1030 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10087) AND (b.`id_shop` = 1) LIMIT 1
 0.113 ms 1 /src/Adapter/EntityMapper.php:71
1011 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 25043) AND (b.`id_shop` = 1) LIMIT 1
 0.112 ms 1 /src/Adapter/EntityMapper.php:71
1075 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4489) AND (b.`id_shop` = 1) LIMIT 1
 0.112 ms 1 /src/Adapter/EntityMapper.php:71
1129 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4324) AND (b.`id_shop` = 1) LIMIT 1
 0.112 ms 1 /src/Adapter/EntityMapper.php:71
1060 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4100) AND (b.`id_shop` = 1) LIMIT 1
 0.112 ms 1 /src/Adapter/EntityMapper.php:71
1221 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 40047
ORDER BY `position`
 0.112 ms 5 Yes /classes/Product.php:3545
902 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 31006
AND image_shop.`cover` = 1 LIMIT 1
 0.111 ms 5 /classes/Product.php:3570
1014 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4412) AND (b.`id_shop` = 1) LIMIT 1
 0.111 ms 1 /src/Adapter/EntityMapper.php:71
1057 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 36882) AND (b.`id_shop` = 1) LIMIT 1
 0.111 ms 1 /src/Adapter/EntityMapper.php:71
1069 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 36837) AND (b.`id_shop` = 1) LIMIT 1
 0.111 ms 1 /src/Adapter/EntityMapper.php:71
1033 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 40017) AND (b.`id_shop` = 1) LIMIT 1
 0.111 ms 1 /src/Adapter/EntityMapper.php:71
1164 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 647718
ORDER BY `position`
 0.111 ms 10 Yes /classes/Product.php:3545
1025 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 36884) AND (b.`id_shop` = 1) LIMIT 1
 0.110 ms 1 /src/Adapter/EntityMapper.php:71
1108 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6696) AND (b.`id_shop` = 1) LIMIT 1
 0.110 ms 1 /src/Adapter/EntityMapper.php:71
1114 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6362) AND (b.`id_shop` = 1) LIMIT 1
 0.110 ms 1 /src/Adapter/EntityMapper.php:71
1051 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 30894) AND (b.`id_shop` = 1) LIMIT 1
 0.110 ms 1 /src/Adapter/EntityMapper.php:71
1215 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 40046
ORDER BY `position`
 0.110 ms 5 Yes /classes/Product.php:3545
855 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 10088)
 0.109 ms 1 /classes/Product.php:3860
1197 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5052
ORDER BY `position`
 0.109 ms 5 Yes /classes/Product.php:3545
1082 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4482
ORDER BY `position`
 0.109 ms 6 Yes /classes/Product.php:3545
1150 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4827) AND (b.`id_shop` = 1) LIMIT 1
 0.109 ms 1 /src/Adapter/EntityMapper.php:71
1236 
SELECT SQL_NO_CACHE 1 FROM `een_cart_rule` WHERE ((date_to >= "2026-04-28 00:00:00" AND date_to <= "2026-04-28 23:59:59") OR (date_from >= "2026-04-28 00:00:00" AND date_from <= "2026-04-28 23:59:59") OR (date_from < "2026-04-28 00:00:00" AND date_to > "2026-04-28 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
 0.109 ms 2 /classes/CartRule.php:357
1042 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 40036) AND (b.`id_shop` = 1) LIMIT 1
 0.108 ms 1 /src/Adapter/EntityMapper.php:71
1048 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 40049) AND (b.`id_shop` = 1) LIMIT 1
 0.108 ms 1 /src/Adapter/EntityMapper.php:71
1123 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4322) AND (b.`id_shop` = 1) LIMIT 1
 0.108 ms 1 /src/Adapter/EntityMapper.php:71
1157 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4333
ORDER BY `position`
 0.108 ms 6 Yes /classes/Product.php:3545
1172 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 30772
ORDER BY `position`
 0.108 ms 6 Yes /classes/Product.php:3545
1206 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 31006
ORDER BY `position`
 0.108 ms 5 Yes /classes/Product.php:3545
1139 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4355
ORDER BY `position`
 0.108 ms 6 Yes /classes/Product.php:3545
735 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 647713) AND (b.`id_shop` = 1) LIMIT 1
 0.107 ms 1 /src/Adapter/EntityMapper.php:71
821 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 647913) AND (b.`id_shop` = 1) LIMIT 1
 0.107 ms 1 /src/Adapter/EntityMapper.php:71
1036 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4997) AND (b.`id_shop` = 1) LIMIT 1
 0.107 ms 1 /src/Adapter/EntityMapper.php:71
1132 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4318) AND (b.`id_shop` = 1) LIMIT 1
 0.107 ms 1 /src/Adapter/EntityMapper.php:71
1147 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5962) AND (b.`id_shop` = 1) LIMIT 1
 0.107 ms 1 /src/Adapter/EntityMapper.php:71
1169 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 14272
ORDER BY `position`
 0.107 ms 7 Yes /classes/Product.php:3545
1212 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 30633
ORDER BY `position`
 0.107 ms 5 Yes /classes/Product.php:3545
574 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6362)
 0.107 ms 1 /classes/Product.php:3860
675 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5965)
 0.107 ms 1 /classes/Product.php:3860
1218 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 35913
ORDER BY `position`
 0.107 ms 5 Yes /classes/Product.php:3545
1023 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 647719
ORDER BY `position`
 0.106 ms 10 Yes /classes/Product.php:3545
1039 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10086) AND (b.`id_shop` = 1) LIMIT 1
 0.106 ms 1 /src/Adapter/EntityMapper.php:71
1087 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4458) AND (b.`id_shop` = 1) LIMIT 1
 0.106 ms 1 /src/Adapter/EntityMapper.php:71
1111 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6531) AND (b.`id_shop` = 1) LIMIT 1
 0.106 ms 1 /src/Adapter/EntityMapper.php:71
1160 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 25042
ORDER BY `position`
 0.106 ms 6 Yes /classes/Product.php:3545
1017 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 647720
ORDER BY `position`
 0.106 ms 11 Yes /classes/Product.php:3545
1203 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5050
ORDER BY `position`
 0.106 ms 4 Yes /classes/Product.php:3545
210 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 647720) AND (b.`id_shop` = 1) LIMIT 1
 0.105 ms 1 /src/Adapter/EntityMapper.php:71
939 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 40046)
 0.105 ms 1 /classes/Product.php:3860
1145 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5965
ORDER BY `position`
 0.105 ms 5 Yes /classes/Product.php:3545
12 
SELECT SQL_NO_CACHE COUNT(DISTINCT l.id_lang) FROM `een_lang` l
JOIN een_lang_shop lang_shop ON (lang_shop.id_lang = l.id_lang AND lang_shop.id_shop = 1)
WHERE l.`active` = 1 LIMIT 1
 0.105 ms 1 /classes/Language.php:1216
267 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 647808) AND (b.`id_shop` = 1) LIMIT 1
 0.105 ms 1 /src/Adapter/EntityMapper.php:71
1019 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 647723
ORDER BY `position`
 0.105 ms 11 Yes /classes/Product.php:3545
1021 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 647724
ORDER BY `position`
 0.105 ms 11 Yes /classes/Product.php:3545
1054 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4471) AND (b.`id_shop` = 1) LIMIT 1
 0.105 ms 1 /src/Adapter/EntityMapper.php:71
1120 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4516) AND (b.`id_shop` = 1) LIMIT 1
 0.105 ms 1 /src/Adapter/EntityMapper.php:71
221 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 647723) AND (b.`id_shop` = 1) LIMIT 1
 0.104 ms 1 /src/Adapter/EntityMapper.php:71
967 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 647701) AND (b.`id_shop` = 1) LIMIT 1
 0.104 ms 1 /src/Adapter/EntityMapper.php:71
746 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 647718) AND (b.`id_shop` = 1) LIMIT 1
 0.104 ms 1 /src/Adapter/EntityMapper.php:71
1135 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4408) AND (b.`id_shop` = 1) LIMIT 1
 0.104 ms 1 /src/Adapter/EntityMapper.php:71
886 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 31035)
 0.103 ms 1 /classes/Product.php:3860
757 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 647717) AND (b.`id_shop` = 1) LIMIT 1
 0.103 ms 1 /src/Adapter/EntityMapper.php:71
876 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5052)
 0.103 ms 1 /classes/Product.php:3860
896 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5050)
 0.103 ms 1 /classes/Product.php:3860
1026 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 36884
ORDER BY `position`
 0.103 ms 7 Yes /classes/Product.php:3545
1045 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 5964) AND (b.`id_shop` = 1) LIMIT 1
 0.103 ms 1 /src/Adapter/EntityMapper.php:71
1064 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 541226
ORDER BY `position`
 0.103 ms 8 Yes /classes/Product.php:3545
1166 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 647717
ORDER BY `position`
 0.103 ms 10 Yes /classes/Product.php:3545
1 
SELECT SQL_NO_CACHE s.id_shop, CONCAT(su.physical_uri, su.virtual_uri) AS uri, su.domain, su.main
FROM een_shop_url su
LEFT JOIN een_shop s ON (s.id_shop = su.id_shop)
WHERE (su.domain = 'decozzia.com' OR su.domain_ssl = 'decozzia.com')
AND s.active = 1
AND s.deleted = 0
ORDER BY LENGTH(CONCAT(su.physical_uri, su.virtual_uri)) DESC
 0.102 ms 1 Yes /classes/shop/Shop.php:1364
866 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5977)
 0.102 ms 1 /classes/Product.php:3860
1073 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 36524
ORDER BY `position`
 0.102 ms 6 Yes /classes/Product.php:3545
1085 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4493
ORDER BY `position`
 0.102 ms 6 Yes /classes/Product.php:3545
1136 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4408
ORDER BY `position`
 0.102 ms 6 Yes /classes/Product.php:3545
832 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 647902) AND (b.`id_shop` = 1) LIMIT 1
 0.102 ms 1 /src/Adapter/EntityMapper.php:71
233 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 647724) AND (b.`id_shop` = 1) LIMIT 1
 0.101 ms 1 /src/Adapter/EntityMapper.php:71
685 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5962)
 0.101 ms 1 /classes/Product.php:3860
695 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4827)
 0.101 ms 1 /classes/Product.php:3860
851 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 10088
AND image_shop.`cover` = 1 LIMIT 1
 0.101 ms 5 /classes/Product.php:3570
162 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4525
AND image_shop.`cover` = 1 LIMIT 1
 0.101 ms 6 /classes/Product.php:3570
244 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 647719) AND (b.`id_shop` = 1) LIMIT 1
 0.101 ms 1 /src/Adapter/EntityMapper.php:71
1200 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 31035
ORDER BY `position`
 0.100 ms 5 Yes /classes/Product.php:3545
1008 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4525
ORDER BY `position`
 0.100 ms 6 Yes /classes/Product.php:3545
1175 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 354868
ORDER BY `position`
 0.100 ms 6 Yes /classes/Product.php:3545
1034 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 40017
ORDER BY `position`
 0.099 ms 7 Yes /classes/Product.php:3545
1103 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 11341
ORDER BY `position`
 0.098 ms 6 Yes /classes/Product.php:3545
681 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5962
AND image_shop.`cover` = 1 LIMIT 1
 0.098 ms 5 /classes/Product.php:3570
861 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5977
AND image_shop.`cover` = 1 LIMIT 1
 0.098 ms 7 /classes/Product.php:3570
872 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5052
AND image_shop.`cover` = 1 LIMIT 1
 0.098 ms 5 /classes/Product.php:3570
1031 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 10087
ORDER BY `position`
 0.098 ms 5 Yes /classes/Product.php:3545
1106 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4448
ORDER BY `position`
 0.098 ms 6 Yes /classes/Product.php:3545
1194 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5977
ORDER BY `position`
 0.098 ms 7 Yes /classes/Product.php:3545
691 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4827
AND image_shop.`cover` = 1 LIMIT 1
 0.097 ms 7 /classes/Product.php:3570
1015 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4412
ORDER BY `position`
 0.097 ms 6 Yes /classes/Product.php:3545
1058 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 36882
ORDER BY `position`
 0.097 ms 7 Yes /classes/Product.php:3545
1109 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6696
ORDER BY `position`
 0.097 ms 5 Yes /classes/Product.php:3545
1191 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 10088
ORDER BY `position`
 0.097 ms 5 Yes /classes/Product.php:3545
1052 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 30894
ORDER BY `position`
 0.097 ms 8 Yes /classes/Product.php:3545
1118 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4508
ORDER BY `position`
 0.097 ms 6 Yes /classes/Product.php:3545
701 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4337
AND image_shop.`cover` = 1 LIMIT 1
 0.096 ms 6 /classes/Product.php:3570
1012 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 25043
ORDER BY `position`
 0.096 ms 5 Yes /classes/Product.php:3545
1178 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 11959
ORDER BY `position`
 0.096 ms 5 Yes /classes/Product.php:3545
421 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 36837)
 0.096 ms 1 /classes/Product.php:3860
1151 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4827
ORDER BY `position`
 0.096 ms 7 Yes /classes/Product.php:3545
1076 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4489
ORDER BY `position`
 0.095 ms 6 Yes /classes/Product.php:3545
1088 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4458
ORDER BY `position`
 0.095 ms 7 Yes /classes/Product.php:3545
1238 
SELECT SQL_NO_CACHE COUNT(*) FROM `een_orders` o
LEFT JOIN `een_order_cart_rule` ocr ON (ocr.`id_order` = o.`id_order`)
WHERE o.`id_customer` = 0
AND ocr.`deleted` = 0 AND ocr.`id_cart_rule` = 0 LIMIT 1
 0.095 ms 1 /classes/order/Order.php:881
236 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 647724)
 0.094 ms 1 /classes/Product.php:3860
882 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 31035
AND image_shop.`cover` = 1 LIMIT 1
 0.094 ms 5 /classes/Product.php:3570
945 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 35913
AND image_shop.`cover` = 1 LIMIT 1
 0.094 ms 5 /classes/Product.php:3570
1061 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4100
ORDER BY `position`
 0.094 ms 6 Yes /classes/Product.php:3545
1070 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 36837
ORDER BY `position`
 0.094 ms 5 Yes /classes/Product.php:3545
1127 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4320
ORDER BY `position`
 0.094 ms 6 Yes /classes/Product.php:3545
1154 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4337
ORDER BY `position`
 0.094 ms 6 Yes /classes/Product.php:3545
1188 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 40048
ORDER BY `position`
 0.094 ms 5 Yes /classes/Product.php:3545
258 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 36884)
 0.093 ms 1 /classes/Product.php:3860
1043 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 40036
ORDER BY `position`
 0.093 ms 6 Yes /classes/Product.php:3545
1049 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 40049
ORDER BY `position`
 0.093 ms 6 Yes /classes/Product.php:3545
1112 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6531
ORDER BY `position`
 0.093 ms 5 Yes /classes/Product.php:3545
1115 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6362
ORDER BY `position`
 0.093 ms 5 Yes /classes/Product.php:3545
1121 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4516
ORDER BY `position`
 0.093 ms 6 Yes /classes/Product.php:3545
1124 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4322
ORDER BY `position`
 0.093 ms 6 Yes /classes/Product.php:3545
892 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5050
AND image_shop.`cover` = 1 LIMIT 1
 0.092 ms 4 /classes/Product.php:3570
955 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 40047
AND image_shop.`cover` = 1 LIMIT 1
 0.092 ms 5 /classes/Product.php:3570
1055 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4471
ORDER BY `position`
 0.092 ms 6 Yes /classes/Product.php:3545
1148 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5962
ORDER BY `position`
 0.092 ms 5 Yes /classes/Product.php:3545
213 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 647720)
 0.091 ms 1 /classes/Product.php:3860
726 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 25042)
 0.091 ms 1 /classes/Product.php:3860
1037 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4997
ORDER BY `position`
 0.091 ms 5 Yes /classes/Product.php:3545
1040 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 10086
ORDER BY `position`
 0.091 ms 5 Yes /classes/Product.php:3545
28 
SELECT SQL_NO_CACHE *
FROM `een_currency` a
LEFT JOIN `een_currency_lang` `b` ON a.`id_currency` = b.`id_currency` AND b.`id_lang` = 1
LEFT JOIN `een_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
 0.091 ms 1 /src/Adapter/EntityMapper.php:71
1046 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 5964
ORDER BY `position`
 0.091 ms 5 Yes /classes/Product.php:3545
1133 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4318
ORDER BY `position`
 0.091 ms 6 Yes /classes/Product.php:3545
917 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 31007)
 0.090 ms 1 /classes/Product.php:3860
1130 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4324
ORDER BY `position`
 0.090 ms 5 Yes /classes/Product.php:3545
270 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 647808)
 0.089 ms 1 /classes/Product.php:3860
403 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 541226) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.089 ms 1 /classes/stock/StockAvailable.php:453
406 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 549338
AND image_shop.`cover` = 1 LIMIT 1
 0.089 ms 8 /classes/Product.php:3570
605 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4322)
 0.089 ms 1 /classes/Product.php:3860
635 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4318)
 0.089 ms 1 /classes/Product.php:3860
154 
SELECT SQL_NO_CACHE *
FROM `een_category` a
LEFT JOIN `een_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `een_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 2) AND (b.`id_shop` = 1) LIMIT 1
 0.088 ms 1 /src/Adapter/EntityMapper.php:71
331 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5964
AND image_shop.`cover` = 1 LIMIT 1
 0.088 ms 5 /classes/Product.php:3570
584 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4508)
 0.088 ms 1 /classes/Product.php:3860
7 
SELECT SQL_NO_CACHE *
FROM `een_country` a
LEFT JOIN `een_country_lang` `b` ON a.`id_country` = b.`id_country` AND b.`id_lang` = 1
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 8) LIMIT 1
 0.087 ms 1 /src/Adapter/EntityMapper.php:71
173 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4525)
 0.087 ms 1 /classes/Product.php:3860
184 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 25043
AND image_shop.`cover` = 1 LIMIT 1
 0.087 ms 5 /classes/Product.php:3570
207 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 647720
AND image_shop.`cover` = 1 LIMIT 1
 0.087 ms 11 /classes/Product.php:3570
325 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 40036)
 0.087 ms 1 /classes/Product.php:3860
410 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 549338)
 0.087 ms 1 /classes/Product.php:3860
533 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 11341)
 0.087 ms 1 /classes/Product.php:3860
705 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4337)
 0.087 ms 1 /classes/Product.php:3860
721 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 25042
AND image_shop.`cover` = 1 LIMIT 1
 0.087 ms 6 /classes/Product.php:3570
744 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 647718
AND image_shop.`cover` = 1 LIMIT 1
 0.087 ms 10 /classes/Product.php:3570
625 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4324)
 0.087 ms 1 /classes/Product.php:3860
189 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 25043)
 0.086 ms 1 /classes/Product.php:3860
219 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 647723
AND image_shop.`cover` = 1 LIMIT 1
 0.086 ms 11 /classes/Product.php:3570
224 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 647723)
 0.086 ms 1 /classes/Product.php:3860
292 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 40017)
 0.086 ms 1 /classes/Product.php:3860
539 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4448
AND image_shop.`cover` = 1 LIMIT 1
 0.086 ms 6 /classes/Product.php:3570
715 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4333)
 0.086 ms 1 /classes/Product.php:3860
949 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 35913)
 0.086 ms 1 /classes/Product.php:3860
631 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4318
AND image_shop.`cover` = 1 LIMIT 1
 0.086 ms 6 /classes/Product.php:3570
5 
SELECT SQL_NO_CACHE su.physical_uri, su.virtual_uri, su.domain, su.domain_ssl
FROM een_shop s
LEFT JOIN een_shop_url su ON (s.id_shop = su.id_shop)
WHERE s.id_shop = 1
AND s.active = 1 AND s.deleted = 0 AND su.main = 1 LIMIT 1
 0.085 ms 1 /classes/shop/Shop.php:218
200 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4412)
 0.085 ms 1 /classes/Product.php:3860
253 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 36884
AND image_shop.`cover` = 1 LIMIT 1
 0.085 ms 7 /classes/Product.php:3570
281 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 10087)
 0.085 ms 1 /classes/Product.php:3860
553 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6696)
 0.085 ms 1 /classes/Product.php:3860
770 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 14272)
 0.085 ms 1 /classes/Product.php:3860
781 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 30772)
 0.085 ms 1 /classes/Product.php:3860
830 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 647902
AND image_shop.`cover` = 1 LIMIT 1
 0.085 ms 8 /classes/Product.php:3570
907 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 31006)
 0.085 ms 1 /classes/Product.php:3860
615 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4320)
 0.085 ms 1 /classes/Product.php:3860
242 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 647719
AND image_shop.`cover` = 1 LIMIT 1
 0.084 ms 10 /classes/Product.php:3570
314 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 10086)
 0.084 ms 1 /classes/Product.php:3860
543 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4448)
 0.084 ms 1 /classes/Product.php:3860
738 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 647713)
 0.084 ms 1 /classes/Product.php:3860
6 
SELECT SQL_NO_CACHE l.*, ls.`id_shop`
FROM `een_lang` l
LEFT JOIN `een_lang_shop` ls ON (l.id_lang = ls.id_lang)
 0.084 ms 1 /classes/Language.php:1080
230 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 647724
AND image_shop.`cover` = 1 LIMIT 1
 0.084 ms 11 /classes/Product.php:3570
264 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 647808
AND image_shop.`cover` = 1 LIMIT 1
 0.084 ms 11 /classes/Product.php:3570
303 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4997)
 0.084 ms 1 /classes/Product.php:3860
336 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5964)
 0.084 ms 1 /classes/Product.php:3860
432 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 36524)
 0.084 ms 1 /classes/Product.php:3860
580 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4508
AND image_shop.`cover` = 1 LIMIT 1
 0.084 ms 6 /classes/Product.php:3570
732 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 647713
AND image_shop.`cover` = 1 LIMIT 1
 0.084 ms 11 /classes/Product.php:3570
760 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 647717)
 0.084 ms 1 /classes/Product.php:3860
792 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 354868)
 0.084 ms 1 /classes/Product.php:3860
835 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 647902)
 0.084 ms 1 /classes/Product.php:3860
928 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 30633)
 0.084 ms 1 /classes/Product.php:3860
959 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 40047)
 0.084 ms 1 /classes/Product.php:3860
965 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 647701
AND image_shop.`cover` = 1 LIMIT 1
 0.084 ms 7 /classes/Product.php:3570
980 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 608048)
 0.084 ms 1 /classes/Product.php:3860
1001 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 647862)
 0.084 ms 1 /classes/Product.php:3860
347 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 40049)
 0.083 ms 1 /classes/Product.php:3860
357 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 30894)
 0.083 ms 1 /classes/Product.php:3860
400 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 541226)
 0.083 ms 1 /classes/Product.php:3860
442 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4489)
 0.083 ms 1 /classes/Product.php:3860
472 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4493)
 0.083 ms 1 /classes/Product.php:3860
482 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4458)
 0.083 ms 1 /classes/Product.php:3860
564 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6531)
 0.083 ms 1 /classes/Product.php:3860
645 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4408)
 0.083 ms 1 /classes/Product.php:3860
749 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 647718)
 0.083 ms 1 /classes/Product.php:3860
802 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 11959)
 0.083 ms 1 /classes/Product.php:3860
824 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 647913)
 0.083 ms 1 /classes/Product.php:3860
990 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 13237)
 0.083 ms 1 /classes/Product.php:3860
320 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 40036
AND image_shop.`cover` = 1 LIMIT 1
 0.082 ms 6 /classes/Product.php:3570
368 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4471)
 0.082 ms 1 /classes/Product.php:3860
379 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 36882)
 0.082 ms 1 /classes/Product.php:3860
452 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4440)
 0.082 ms 1 /classes/Product.php:3860
462 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4482)
 0.082 ms 1 /classes/Product.php:3860
503 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4447)
 0.082 ms 1 /classes/Product.php:3860
655 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4355)
 0.082 ms 1 /classes/Product.php:3860
665 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5013)
 0.082 ms 1 /classes/Product.php:3860
755 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 647717
AND image_shop.`cover` = 1 LIMIT 1
 0.082 ms 10 /classes/Product.php:3570
812 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 31013)
 0.082 ms 1 /classes/Product.php:3860
818 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 647913
AND image_shop.`cover` = 1 LIMIT 1
 0.082 ms 7 /classes/Product.php:3570
845 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 40048)
 0.082 ms 1 /classes/Product.php:3860
970 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 647701)
 0.082 ms 1 /classes/Product.php:3860
523 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5018)
 0.082 ms 1 /classes/Product.php:3860
389 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4100)
 0.081 ms 1 /classes/Product.php:3860
427 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 36524
AND image_shop.`cover` = 1 LIMIT 1
 0.081 ms 6 /classes/Product.php:3570
478 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4458
AND image_shop.`cover` = 1 LIMIT 1
 0.081 ms 7 /classes/Product.php:3570
493 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 5009)
 0.081 ms 1 /classes/Product.php:3860
513 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6318)
 0.081 ms 1 /classes/Product.php:3860
711 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4333
AND image_shop.`cover` = 1 LIMIT 1
 0.081 ms 6 /classes/Product.php:3570
913 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 31007
AND image_shop.`cover` = 1 LIMIT 1
 0.081 ms 5 /classes/Product.php:3570
934 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 40046
AND image_shop.`cover` = 1 LIMIT 1
 0.081 ms 5 /classes/Product.php:3570
976 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 608048
AND image_shop.`cover` = 1 LIMIT 1
 0.081 ms 6 /classes/Product.php:3570
195 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4412
AND image_shop.`cover` = 1 LIMIT 1
 0.081 ms 6 /classes/Product.php:3570
353 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 30894
AND image_shop.`cover` = 1 LIMIT 1
 0.081 ms 8 /classes/Product.php:3570
342 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 40049
AND image_shop.`cover` = 1 LIMIT 1
 0.080 ms 6 /classes/Product.php:3570
438 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4489
AND image_shop.`cover` = 1 LIMIT 1
 0.080 ms 6 /classes/Product.php:3570
448 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4440
AND image_shop.`cover` = 1 LIMIT 1
 0.080 ms 6 /classes/Product.php:3570
787 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 354868
AND image_shop.`cover` = 1 LIMIT 1
 0.080 ms 6 /classes/Product.php:3570
287 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 40017
AND image_shop.`cover` = 1 LIMIT 1
 0.080 ms 7 /classes/Product.php:3570
298 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4997
AND image_shop.`cover` = 1 LIMIT 1
 0.080 ms 5 /classes/Product.php:3570
395 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 541226
AND image_shop.`cover` = 1 LIMIT 1
 0.080 ms 8 /classes/Product.php:3570
416 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 36837
AND image_shop.`cover` = 1 LIMIT 1
 0.080 ms 5 /classes/Product.php:3570
590 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4516
AND image_shop.`cover` = 1 LIMIT 1
 0.080 ms 6 /classes/Product.php:3570
798 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 11959
AND image_shop.`cover` = 1 LIMIT 1
 0.080 ms 5 /classes/Product.php:3570
17 
SELECT SQL_NO_CACHE value FROM `een_configuration` WHERE `name` = "PS_MULTISHOP_FEATURE_ACTIVE" LIMIT 1
 0.079 ms 1 /classes/shop/Shop.php:1183
363 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4471
AND image_shop.`cover` = 1 LIMIT 1
 0.079 ms 6 /classes/Product.php:3570
559 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6531
AND image_shop.`cover` = 1 LIMIT 1
 0.079 ms 5 /classes/Product.php:3570
570 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6362
AND image_shop.`cover` = 1 LIMIT 1
 0.079 ms 5 /classes/Product.php:3570
601 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4322
AND image_shop.`cover` = 1 LIMIT 1
 0.079 ms 6 /classes/Product.php:3570
766 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 14272
AND image_shop.`cover` = 1 LIMIT 1
 0.079 ms 7 /classes/Product.php:3570
776 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 30772
AND image_shop.`cover` = 1 LIMIT 1
 0.079 ms 6 /classes/Product.php:3570
841 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 40048
AND image_shop.`cover` = 1 LIMIT 1
 0.079 ms 5 /classes/Product.php:3570
276 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 10087
AND image_shop.`cover` = 1 LIMIT 1
 0.079 ms 5 /classes/Product.php:3570
374 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 36882
AND image_shop.`cover` = 1 LIMIT 1
 0.079 ms 7 /classes/Product.php:3570
621 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4324
AND image_shop.`cover` = 1 LIMIT 1
 0.079 ms 5 /classes/Product.php:3570
808 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 31013
AND image_shop.`cover` = 1 LIMIT 1
 0.079 ms 6 /classes/Product.php:3570
923 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 30633
AND image_shop.`cover` = 1 LIMIT 1
 0.079 ms 5 /classes/Product.php:3570
986 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 13237
AND image_shop.`cover` = 1 LIMIT 1
 0.079 ms 5 /classes/Product.php:3570
996 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 647862
AND image_shop.`cover` = 1 LIMIT 1
 0.079 ms 5 /classes/Product.php:3570
611 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4320
AND image_shop.`cover` = 1 LIMIT 1
 0.078 ms 6 /classes/Product.php:3570
661 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5013
AND image_shop.`cover` = 1 LIMIT 1
 0.078 ms 4 /classes/Product.php:3570
488 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5009
AND image_shop.`cover` = 1 LIMIT 1
 0.078 ms 6 /classes/Product.php:3570
509 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6318
AND image_shop.`cover` = 1 LIMIT 1
 0.078 ms 6 /classes/Product.php:3570
529 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 11341
AND image_shop.`cover` = 1 LIMIT 1
 0.078 ms 6 /classes/Product.php:3570
549 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6696
AND image_shop.`cover` = 1 LIMIT 1
 0.078 ms 5 /classes/Product.php:3570
641 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4408
AND image_shop.`cover` = 1 LIMIT 1
 0.078 ms 6 /classes/Product.php:3570
651 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4355
AND image_shop.`cover` = 1 LIMIT 1
 0.078 ms 6 /classes/Product.php:3570
15 
SELECT SQL_NO_CACHE `name`, `alias` FROM `een_hook_alias`
 0.077 ms 87 /classes/Hook.php:287
137 
SELECT SQL_NO_CACHE `name`
FROM `een_hook`
WHERE `id_hook` = 1013 LIMIT 1
 0.077 ms 1 /classes/Hook.php:244
309 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 10086
AND image_shop.`cover` = 1 LIMIT 1
 0.077 ms 5 /classes/Product.php:3570
458 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4482
AND image_shop.`cover` = 1 LIMIT 1
 0.077 ms 6 /classes/Product.php:3570
468 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4493
AND image_shop.`cover` = 1 LIMIT 1
 0.077 ms 6 /classes/Product.php:3570
499 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4447
AND image_shop.`cover` = 1 LIMIT 1
 0.077 ms 6 /classes/Product.php:3570
519 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5018
AND image_shop.`cover` = 1 LIMIT 1
 0.077 ms 5 /classes/Product.php:3570
671 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 5965
AND image_shop.`cover` = 1 LIMIT 1
 0.077 ms 5 /classes/Product.php:3570
672 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 366 LIMIT 1
 0.077 ms 1 /classes/Product.php:5659
19 
SELECT SQL_NO_CACHE name, alias FROM `een_hook_alias`
 0.076 ms 87 /classes/Hook.php:339
385 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4100
AND image_shop.`cover` = 1 LIMIT 1
 0.076 ms 6 /classes/Product.php:3570
46 
SELECT SQL_NO_CACHE * FROM `een_image_type` WHERE 1 AND `products` = 1  ORDER BY `width` DESC, `height` DESC, `name`ASC
 0.076 ms 8 Yes /classes/ImageType.php:109
4 
SELECT SQL_NO_CACHE *
FROM `een_shop` a
WHERE (a.`id_shop` = 1) LIMIT 1
 0.075 ms 1 /src/Adapter/EntityMapper.php:71
9 
SELECT SQL_NO_CACHE *
FROM `een_lang` a
LEFT JOIN `een_lang_shop` `c` ON a.`id_lang` = c.`id_lang` AND c.`id_shop` = 1
WHERE (a.`id_lang` = 1) LIMIT 1
 0.075 ms 1 /src/Adapter/EntityMapper.php:71
25 
SELECT SQL_NO_CACHE * FROM `een_currency` c ORDER BY `iso_code` ASC
 0.075 ms 1 Yes /classes/Currency.php:709
41 
CREATE TABLE IF NOT EXISTS `een_revolut_payment_orders` (
`id` INT NOT NULL AUTO_INCREMENT,
`id_order` INT NULL ,
`id_cart` INT NULL ,
`id_revolut_order` VARCHAR(250) NOT NULL ,
`public_id` VARCHAR(250) NOT NULL ,
`save_card` TINYINT NOT NULL DEFAULT "0" ,
PRIMARY KEY (`id`),
UNIQUE (`id_revolut_order`),
UNIQUE (`id_order`)
) ENGINE = InnoDB;
 0.074 ms 1 /modules/revolutpayment/revolutpayment.php:320
1257 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "iqitcountdown" LIMIT 1
 0.073 ms 1 /classes/module/Module.php:2659
11 
SELECT SQL_NO_CACHE domain, domain_ssl
FROM een_shop_url
WHERE main = 1
AND id_shop = 1 LIMIT 1
 0.072 ms 1 /classes/shop/ShopUrl.php:182
1098 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 6318
 0.072 ms 1 /classes/Product.php:2902
31 
SELECT SQL_NO_CACHE *
FROM `een_country` a
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 21) LIMIT 1
 0.070 ms 1 /src/Adapter/EntityMapper.php:71
248 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 647719 AND id_shop=1 LIMIT 1
 0.070 ms 1 /classes/Product.php:6876
107 
SELECT SQL_NO_CACHE c.id_currency
FROM `een_currency` c
WHERE (deleted = 0) AND (iso_code = 'EUR') LIMIT 1
 0.069 ms 1 /classes/Currency.php:893
36 
SELECT SQL_NO_CACHE *
FROM `een_group` a
LEFT JOIN `een_group_shop` `c` ON a.`id_group` = c.`id_group` AND c.`id_shop` = 1
WHERE (a.`id_group` = 1) LIMIT 1
 0.069 ms 1 /src/Adapter/EntityMapper.php:71
49 
SELECT SQL_NO_CACHE *
FROM `een_country` a
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 17) LIMIT 1
 0.069 ms 1 /src/Adapter/EntityMapper.php:71
1241 
SELECT SQL_NO_CACHE COUNT(DISTINCT c.id_currency) FROM `een_currency` c
LEFT JOIN een_currency_shop cs ON (cs.id_currency = c.id_currency AND cs.id_shop = 1)
WHERE c.`active` = 1 AND c.`deleted` = 0 LIMIT 1
 0.068 ms 1 /classes/Currency.php:1136
202 
SELECT SQL_NO_CACHE tr.*
FROM `een_tax_rule` tr
JOIN `een_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 21
AND tr.`id_tax_rules_group` = 8
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
 0.067 ms 0 /classes/tax/TaxRulesTaxManager.php:109
33 
SELECT SQL_NO_CACHE *
FROM `een_currency` a
LEFT JOIN `een_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
 0.066 ms 1 /src/Adapter/EntityMapper.php:71
59 
CREATE TABLE IF NOT EXISTS `een_gmcp_reporting` (`id_reporting` int(11) NOT NULL AUTO_INCREMENT,`iso_feed` LONGTEXT NOT NULL,    `reporting_content` LONGTEXT NOT NULL,`id_shop` int(11) NOT NULL,`date_add` datetime NOT NULL,`date_upd` datetime NOT NULL,PRIMARY KEY (`id_reporting`)) ENGINE=' . _MYSQL_ENGINE_ . ' DEFAULT CHARSET=utf8;
 0.066 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
250 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 647719) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.066 ms 1 /classes/stock/StockAvailable.php:453
931 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 30633) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.066 ms 1 /classes/stock/StockAvailable.php:453
899 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 5050) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.066 ms 1 /classes/stock/StockAvailable.php:453
1101 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 5018
 0.066 ms 1 /classes/Product.php:2902
105 
SELECT SQL_NO_CACHE *
FROM `een_country` a
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 8) LIMIT 1
 0.065 ms 1 /src/Adapter/EntityMapper.php:71
1140 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 4355
 0.065 ms 1 /classes/Product.php:2902
1239 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "iqitlinksmanager" LIMIT 1
 0.065 ms 1 /classes/module/Module.php:2659
698 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 4827) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.064 ms 1 /classes/stock/StockAvailable.php:453
1366 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "iqitcookielaw" LIMIT 1
 0.064 ms 1 /classes/module/Module.php:2659
23 
SELECT SQL_NO_CACHE * FROM `een_hook_module_exceptions`
WHERE `id_shop` IN (1)
 0.064 ms 1 /classes/module/Module.php:2041
678 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 5965) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.064 ms 1 /classes/stock/StockAvailable.php:453
1184 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 647913
 0.063 ms 1 /classes/Product.php:2902
180 
SELECT SQL_NO_CACHE tr.*
FROM `een_tax_rule` tr
JOIN `een_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 21
AND tr.`id_tax_rules_group` = 0
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
 0.063 ms 0 /classes/tax/TaxRulesTaxManager.php:109
688 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 5962) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.063 ms 1 /classes/stock/StockAvailable.php:453
1186 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 647902
 0.063 ms 1 /classes/Product.php:2902
1338 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "supercheckout" LIMIT 1
 0.063 ms 0 /classes/module/Module.php:2659
30 
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'US' LIMIT 1
 0.062 ms 1 /classes/Country.php:194
211 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 647720
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.062 ms 0 /classes/SpecificPrice.php:259
1092 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 5009
 0.062 ms 1 /classes/Product.php:2902
122 
SELECT SQL_NO_CACHE *
FROM `een_country` a
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 19) LIMIT 1
 0.061 ms 1 /src/Adapter/EntityMapper.php:71
676 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 5965 AND id_shop=1 LIMIT 1
 0.061 ms 1 /classes/Product.php:6876
1230 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 13237
 0.061 ms 1 /classes/Product.php:2902
1233 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 647862
 0.061 ms 1 /classes/Product.php:2902
1250 
SELECT SQL_NO_CACHE SUM(`quantity`)
FROM `een_cart_product`
WHERE `id_cart` = 0 LIMIT 1
 0.061 ms 1 /classes/Cart.php:1303
100 
SELECT SQL_NO_CACHE id_feed
FROM `een_gmcp_feeds` ff
WHERE (ff.id_shop=1) LIMIT 1
 0.061 ms 370 /modules/gmerchantcenterpro/models/Feeds.php:53
34 
SELECT SQL_NO_CACHE *
FROM `een_currency_lang`
WHERE `id_currency` = 1
 0.060 ms 1 /src/Adapter/EntityMapper.php:79
572 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 6362
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.060 ms 0 /classes/SpecificPrice.php:259
686 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 5962 AND id_shop=1 LIMIT 1
 0.060 ms 1 /classes/Product.php:6876
103 
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'FR' LIMIT 1
 0.060 ms 1 /classes/Country.php:194
115 
SELECT SQL_NO_CACHE c.id_currency
FROM `een_currency` c
WHERE (deleted = 0) AND (iso_code = 'XOF') LIMIT 1
 0.060 ms 1 /classes/Currency.php:893
134 
SELECT SQL_NO_CACHE *
FROM `een_country` a
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 186) LIMIT 1
 0.060 ms 1 /src/Adapter/EntityMapper.php:71
1095 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 4447
 0.060 ms 1 /classes/Product.php:2902
1227 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 608048
 0.060 ms 1 /classes/Product.php:2902
27 
SELECT SQL_NO_CACHE c.id_currency
FROM `een_currency` c
WHERE (iso_code = 'EUR') LIMIT 1
 0.059 ms 1 /classes/Currency.php:893
130 
SELECT SQL_NO_CACHE *
FROM `een_country` a
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 3) LIMIT 1
 0.059 ms 1 /src/Adapter/EntityMapper.php:71
1213 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 30633
 0.059 ms 1 /classes/Product.php:2902
26 
SELECT SQL_NO_CACHE `id_lang` FROM `een_lang`
WHERE `locale` = 'fr-fr'
OR `language_code` = 'fr-fr' LIMIT 1
 0.059 ms 1 /classes/Language.php:883
44 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "ps_legalcompliance" LIMIT 1
 0.059 ms 0 /classes/module/Module.php:2659
596 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 4516 AND id_shop=1 LIMIT 1
 0.059 ms 1 /classes/Product.php:6876
113 
SELECT SQL_NO_CACHE c.id_currency
FROM `een_currency` c
WHERE (deleted = 0) AND (iso_code = 'XAF') LIMIT 1
 0.058 ms 1 /classes/Currency.php:893
53 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "pm_advancedpack" LIMIT 1
 0.058 ms 0 /classes/module/Module.php:2659
126 
SELECT SQL_NO_CACHE *
FROM `een_country` a
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 4) LIMIT 1
 0.058 ms 1 /src/Adapter/EntityMapper.php:71
1143 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 5013
 0.058 ms 1 /classes/Product.php:2902
682 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 366 LIMIT 1
 0.057 ms 1 /classes/Product.php:5659
50 
SELECT SQL_NO_CACHE *
FROM `een_country_lang`
WHERE `id_country` = 17
 0.057 ms 1 /src/Adapter/EntityMapper.php:79
109 
SELECT SQL_NO_CACHE c.id_currency
FROM `een_currency` c
WHERE (deleted = 0) AND (iso_code = 'TND') LIMIT 1
 0.057 ms 1 /classes/Currency.php:893
170 
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE `to` BETWEEN '2026-04-28 00:00:00' AND '2026-04-28 23:59:59' LIMIT 1
 0.057 ms 1 /classes/SpecificPrice.php:381
692 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 253 LIMIT 1
 0.057 ms 1 /classes/Product.php:5659
696 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 4827 AND id_shop=1 LIMIT 1
 0.057 ms 1 /classes/Product.php:6876
1080 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 4440
 0.057 ms 1 /classes/Product.php:2902
1242 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "ps_languageselector" LIMIT 1
 0.057 ms 1 /classes/module/Module.php:2659
29 
SELECT SQL_NO_CACHE `id_lang` FROM `een_lang`
WHERE `locale` = 'fr-fr'
OR `language_code` = 'fr-fr' LIMIT 1
 0.056 ms 1 /classes/Language.php:883
39 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "facebookproductsfeed" LIMIT 1
 0.056 ms 0 /classes/module/Module.php:2659
47 
SELECT SQL_NO_CACHE format
FROM `een_address_format`
WHERE `id_country` = 17 LIMIT 1
 0.056 ms 1 /classes/AddressFormat.php:656
111 
SELECT SQL_NO_CACHE c.id_currency
FROM `een_currency` c
WHERE (deleted = 0) AND (iso_code = 'DZD') LIMIT 1
 0.056 ms 1 /classes/Currency.php:893
117 
SELECT SQL_NO_CACHE c.id_currency
FROM `een_currency` c
WHERE (deleted = 0) AND (iso_code = 'MGA') LIMIT 1
 0.056 ms 1 /classes/Currency.php:893
119 
SELECT SQL_NO_CACHE c.id_currency
FROM `een_currency` c
WHERE (deleted = 0) AND (iso_code = 'MAD') LIMIT 1
 0.056 ms 1 /classes/Currency.php:893
673 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 5965
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.056 ms 0 /classes/SpecificPrice.php:259
862 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 1015 LIMIT 1
 0.056 ms 1 /classes/Category.php:1378
1161 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 25042
 0.056 ms 1 /classes/Product.php:2902
136 
SELECT SQL_NO_CACHE id_order
FROM `een_orders` o
WHERE (o.id_cart=0) LIMIT 1
 0.056 ms 1 /modules/gmerchantcenterpro/lib/dao/moduleDao.php:450
21 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "ets_superspeed" LIMIT 1
 0.055 ms 0 /classes/module/Module.php:2659
910 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 31006) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.055 ms 1 /classes/stock/StockAvailable.php:453
1207 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 31006
 0.055 ms 1 /classes/Product.php:2902
1222 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 40047
 0.055 ms 1 /classes/Product.php:2902
1224 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 647701
 0.055 ms 1 /classes/Product.php:2902
8 
SELECT SQL_NO_CACHE *
FROM `een_shop_group` a
WHERE (a.`id_shop_group` = 1) LIMIT 1
 0.055 ms 1 /src/Adapter/EntityMapper.php:71
37 
SELECT SQL_NO_CACHE *
FROM `een_group_lang`
WHERE `id_group` = 1
 0.055 ms 1 /src/Adapter/EntityMapper.php:79
181 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 4525) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.055 ms 1 /classes/stock/StockAvailable.php:453
249 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 647719 AND `id_group` = 1 LIMIT 1
 0.055 ms 0 /classes/GroupReduction.php:156
577 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 6362) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.055 ms 1 /classes/stock/StockAvailable.php:453
852 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1013 LIMIT 1
 0.055 ms 1 /classes/Product.php:5659
1182 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 31013
 0.055 ms 1 /classes/Product.php:2902
1210 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 31007
 0.055 ms 1 /classes/Product.php:2902
108 
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'FR' LIMIT 1
 0.054 ms 1 /classes/Country.php:194
894 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 5050
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.054 ms 0 /classes/SpecificPrice.php:259
1029 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 647808
 0.054 ms 1 /classes/Product.php:2902
1038 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 4997
 0.054 ms 1 /classes/Product.php:2902
32 
SELECT SQL_NO_CACHE *
FROM `een_country_lang`
WHERE `id_country` = 21
 0.054 ms 1 /src/Adapter/EntityMapper.php:79
118 
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'FR' LIMIT 1
 0.054 ms 1 /classes/Country.php:194
571 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1043 LIMIT 1
 0.054 ms 1 /classes/Product.php:5659
1083 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 4482
 0.054 ms 1 /classes/Product.php:2902
1204 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 5050
 0.054 ms 1 /classes/Product.php:2902
1216 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 40046
 0.054 ms 1 /classes/Product.php:2902
132 
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'SA' LIMIT 1
 0.053 ms 1 /classes/Country.php:194
575 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 6362 AND id_shop=1 LIMIT 1
 0.053 ms 1 /classes/Product.php:6876
858 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 10088) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.053 ms 1 /classes/stock/StockAvailable.php:453
1137 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 4408
 0.053 ms 1 /classes/Product.php:2902
1192 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 10088
 0.053 ms 1 /classes/Product.php:2902
1219 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 35913
 0.053 ms 1 /classes/Product.php:2902
52 
SELECT SQL_NO_CACHE * FROM een_revslider_sliders
 0.052 ms 1 /modules/revsliderprestashop/includes/revslider_db.class.php:214
106 
SELECT SQL_NO_CACHE *
FROM `een_country_lang`
WHERE `id_country` = 8
 0.052 ms 1 /src/Adapter/EntityMapper.php:79
227 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 647723) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.052 ms 1 /classes/stock/StockAvailable.php:453
869 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 5977) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.052 ms 1 /classes/stock/StockAvailable.php:453
879 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 5052) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.052 ms 1 /classes/stock/StockAvailable.php:453
1068 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 549338
 0.052 ms 1 /classes/Product.php:2902
1173 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 30772
 0.052 ms 1 /classes/Product.php:2902
1176 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 354868
 0.052 ms 1 /classes/Product.php:2902
1198 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 5052
 0.052 ms 1 /classes/Product.php:2902
51 
SELECT SQL_NO_CACHE id_required_field, object_name, field_name
FROM een_required_field
 0.051 ms 1 /classes/ObjectModel.php:1592
56 
SELECT SQL_NO_CACHE * FROM `een_image_type`
 0.051 ms 8 /classes/ImageType.php:161
104 
SELECT SQL_NO_CACHE `name`
FROM `een_country_lang`
WHERE `id_lang` = 1
AND `id_country` = 8 LIMIT 1
 0.051 ms 1 /classes/Country.php:252
112 
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'FR' LIMIT 1
 0.051 ms 1 /classes/Country.php:194
534 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 11341 AND id_shop=1 LIMIT 1
 0.051 ms 1 /classes/Product.php:6876
683 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 5962
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.051 ms 0 /classes/SpecificPrice.php:259
940 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 40046 AND id_shop=1 LIMIT 1
 0.051 ms 1 /classes/Product.php:6876
1125 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 4322
 0.051 ms 1 /classes/Product.php:2902
1163 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 647713
 0.051 ms 1 /classes/Product.php:2902
1170 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 14272
 0.051 ms 1 /classes/Product.php:2902
1251 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "iqitmegamenu" LIMIT 1
 0.051 ms 1 /classes/module/Module.php:2659
1364 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "iqitsociallogin" LIMIT 1
 0.051 ms 1 /classes/module/Module.php:2659
677 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 5965 AND `id_group` = 1 LIMIT 1
 0.051 ms 0 /classes/GroupReduction.php:156
693 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 4827
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.051 ms 0 /classes/SpecificPrice.php:259
114 
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'FR' LIMIT 1
 0.050 ms 1 /classes/Country.php:194
116 
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'FR' LIMIT 1
 0.050 ms 1 /classes/Country.php:194
124 
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'CA' LIMIT 1
 0.050 ms 1 /classes/Country.php:194
128 
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'BE' LIMIT 1
 0.050 ms 1 /classes/Country.php:194
166 
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 0 LIMIT 1
 0.050 ms 1 /classes/SpecificPrice.php:426
167 
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE `id_product` != 0 LIMIT 1
 0.050 ms 523 /classes/SpecificPrice.php:297
873 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1015 LIMIT 1
 0.050 ms 1 /classes/Product.php:5659
889 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 31035) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.050 ms 1 /classes/stock/StockAvailable.php:453
920 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 31007) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.050 ms 1 /classes/stock/StockAvailable.php:453
1119 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 4508
 0.050 ms 1 /classes/Product.php:2902
0 
SELECT SQL_NO_CACHE * FROM een_memcached_servers
 0.050 ms 1 /classes/cache/CacheMemcached.php:263
10 
SELECT SQL_NO_CACHE id_shop
FROM `een_lang_shop`
WHERE `id_lang` = 1
AND id_shop = 1 LIMIT 1
 0.050 ms 1 /classes/ObjectModel.php:1729
110 
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'FR' LIMIT 1
 0.050 ms 1 /classes/Country.php:194
856 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 10088 AND id_shop=1 LIMIT 1
 0.050 ms 1 /classes/Product.php:6876
1165 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 647718
 0.050 ms 1 /classes/Product.php:2902
120 
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'CH' LIMIT 1
 0.049 ms 1 /classes/Country.php:194
169 
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE `from` BETWEEN '2026-04-28 00:00:00' AND '2026-04-28 23:59:59' LIMIT 1
 0.049 ms 1 /classes/SpecificPrice.php:377
722 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 415 LIMIT 1
 0.049 ms 1 /classes/Category.php:1378
883 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1015 LIMIT 1
 0.049 ms 1 /classes/Product.php:5659
887 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 31035 AND id_shop=1 LIMIT 1
 0.049 ms 1 /classes/Product.php:6876
897 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 5050 AND id_shop=1 LIMIT 1
 0.049 ms 1 /classes/Product.php:6876
903 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 2788 LIMIT 1
 0.049 ms 1 /classes/Category.php:1378
905 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 31006
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.049 ms 0 /classes/SpecificPrice.php:259
1009 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 4525
 0.049 ms 1 /classes/Product.php:2902
1027 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 36884
 0.049 ms 1 /classes/Product.php:2902
1074 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 36524
 0.049 ms 1 /classes/Product.php:2902
1158 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 4333
 0.049 ms 1 /classes/Product.php:2902
1167 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 647717
 0.049 ms 1 /classes/Product.php:2902
35 
SELECT SQL_NO_CACHE id_shop
FROM `een_currency_shop`
WHERE `id_currency` = 1
AND id_shop = 1 LIMIT 1
 0.049 ms 1 /classes/ObjectModel.php:1729
123 
SELECT SQL_NO_CACHE *
FROM `een_country_lang`
WHERE `id_country` = 19
 0.049 ms 1 /src/Adapter/EntityMapper.php:79
536 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 11341) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.049 ms 1 /classes/stock/StockAvailable.php:453
857 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 10088 AND `id_group` = 1 LIMIT 1
 0.049 ms 0 /classes/GroupReduction.php:156
893 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1015 LIMIT 1
 0.049 ms 1 /classes/Product.php:5659
1065 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 541226
 0.049 ms 1 /classes/Product.php:2902
687 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 5962 AND `id_group` = 1 LIMIT 1
 0.048 ms 0 /classes/GroupReduction.php:156
867 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 5977 AND id_shop=1 LIMIT 1
 0.048 ms 1 /classes/Product.php:6876
877 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 5052 AND id_shop=1 LIMIT 1
 0.048 ms 1 /classes/Product.php:6876
946 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1011 LIMIT 1
 0.048 ms 1 /classes/Product.php:5659
1013 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 25043
 0.048 ms 1 /classes/Product.php:2902
1077 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 4489
 0.048 ms 1 /classes/Product.php:2902
1201 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 31035
 0.048 ms 1 /classes/Product.php:2902
1368 
SELECT SQL_NO_CACHE data
FROM `een_ganalytics_data`
WHERE id_cart = 0
AND id_shop = 1 LIMIT 1
 0.048 ms 0 /modules/ps_googleanalytics/classes/Repository/GanalyticsDataRepository.php:43
127 
SELECT SQL_NO_CACHE *
FROM `een_country_lang`
WHERE `id_country` = 4
 0.048 ms 1 /src/Adapter/EntityMapper.php:79
163 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 2 LIMIT 1
 0.048 ms 1 /classes/Category.php:1378
178 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 4525 AND `id_group` = 1 LIMIT 1
 0.048 ms 0 /classes/GroupReduction.php:156
718 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 4333) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.048 ms 1 /classes/stock/StockAvailable.php:453
1104 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 11341
 0.048 ms 1 /classes/Product.php:2902
1107 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 4448
 0.048 ms 1 /classes/Product.php:2902
1131 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 4324
 0.048 ms 1 /classes/Product.php:2902
1152 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 4827
 0.048 ms 1 /classes/Product.php:2902
1258 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 74 AND `id_shop` = 1 LIMIT 1
 0.048 ms 1 /classes/module/Module.php:2132
1367 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 72 AND `id_shop` = 1 LIMIT 1
 0.048 ms 1 /classes/module/Module.php:2132
1032 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 10087
 0.047 ms 1 /classes/Product.php:2902
1086 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 4493
 0.047 ms 1 /classes/Product.php:2902
131 
SELECT SQL_NO_CACHE *
FROM `een_country_lang`
WHERE `id_country` = 3
 0.047 ms 1 /src/Adapter/EntityMapper.php:79
135 
SELECT SQL_NO_CACHE *
FROM `een_country_lang`
WHERE `id_country` = 186
 0.047 ms 1 /src/Adapter/EntityMapper.php:79
201 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 4412 AND id_shop=1 LIMIT 1
 0.047 ms 1 /classes/Product.php:6876
485 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 4458) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.047 ms 1 /classes/stock/StockAvailable.php:453
587 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 4508) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.047 ms 1 /classes/stock/StockAvailable.php:453
662 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1042 LIMIT 1
 0.047 ms 1 /classes/Product.php:5659
697 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 4827 AND `id_group` = 1 LIMIT 1
 0.047 ms 0 /classes/GroupReduction.php:156
918 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 31007 AND id_shop=1 LIMIT 1
 0.047 ms 1 /classes/Product.php:6876
1016 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 4412
 0.047 ms 1 /classes/Product.php:2902
1018 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 647720
 0.047 ms 1 /classes/Product.php:2902
1020 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 647723
 0.047 ms 1 /classes/Product.php:2902
1022 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 647724
 0.047 ms 1 /classes/Product.php:2902
1035 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 40017
 0.047 ms 1 /classes/Product.php:2902
1050 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 40049
 0.047 ms 1 /classes/Product.php:2902
1059 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 36882
 0.047 ms 1 /classes/Product.php:2902
1062 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 4100
 0.047 ms 1 /classes/Product.php:2902
1110 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 6696
 0.047 ms 1 /classes/Product.php:2902
1116 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 6362
 0.047 ms 1 /classes/Product.php:2902
1128 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 4320
 0.047 ms 1 /classes/Product.php:2902
1149 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 5962
 0.047 ms 1 /classes/Product.php:2902
1155 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 4337
 0.047 ms 1 /classes/Product.php:2902
1179 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 11959
 0.047 ms 1 /classes/Product.php:2902
1189 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 40048
 0.047 ms 1 /classes/Product.php:2902
1195 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 5977
 0.047 ms 1 /classes/Product.php:2902
174 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 4525 AND id_shop=1 LIMIT 1
 0.046 ms 1 /classes/Product.php:6876
216 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 647720) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.046 ms 1 /classes/stock/StockAvailable.php:453
401 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 541226 AND id_shop=1 LIMIT 1
 0.046 ms 1 /classes/Product.php:6876
413 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 549338) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.046 ms 1 /classes/stock/StockAvailable.php:453
540 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1040 LIMIT 1
 0.046 ms 1 /classes/Product.php:5659
702 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1042 LIMIT 1
 0.046 ms 1 /classes/Product.php:5659
929 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 30633 AND id_shop=1 LIMIT 1
 0.046 ms 1 /classes/Product.php:6876
942 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 40046) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.046 ms 1 /classes/stock/StockAvailable.php:453
956 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1011 LIMIT 1
 0.046 ms 1 /classes/Product.php:5659
1044 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 40036
 0.046 ms 1 /classes/Product.php:2902
1047 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 5964
 0.046 ms 1 /classes/Product.php:2902
1053 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 30894
 0.046 ms 1 /classes/Product.php:2902
1056 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 4471
 0.046 ms 1 /classes/Product.php:2902
1089 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 4458
 0.046 ms 1 /classes/Product.php:2902
1113 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 6531
 0.046 ms 1 /classes/Product.php:2902
1122 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 4516
 0.046 ms 1 /classes/Product.php:2902
1134 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 4318
 0.046 ms 1 /classes/Product.php:2902
1146 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 5965
 0.046 ms 1 /classes/Product.php:2902
1244 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "ps_currencyselector" LIMIT 1
 0.046 ms 1 /classes/module/Module.php:2659
1024 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 647719
 0.046 ms 1 /classes/Product.php:2902
1041 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 10086
 0.046 ms 1 /classes/Product.php:2902
1071 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 36837
 0.046 ms 1 /classes/Product.php:2902
133 
SELECT SQL_NO_CACHE `name`
FROM `een_country_lang`
WHERE `id_lang` = 1
AND `id_country` = 186 LIMIT 1
 0.045 ms 1 /classes/Country.php:252
185 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 5729 LIMIT 1
 0.045 ms 1 /classes/Category.php:1378
208 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 5828 LIMIT 1
 0.045 ms 1 /classes/Category.php:1378
321 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 369 LIMIT 1
 0.045 ms 1 /classes/Category.php:1378
419 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 36837
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.045 ms 0 /classes/SpecificPrice.php:259
524 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 5018 AND id_shop=1 LIMIT 1
 0.045 ms 1 /classes/Product.php:6876
727 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 25042 AND id_shop=1 LIMIT 1
 0.045 ms 1 /classes/Product.php:6876
788 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 2750 LIMIT 1
 0.045 ms 1 /classes/Category.php:1378
878 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 5052 AND `id_group` = 1 LIMIT 1
 0.045 ms 0 /classes/GroupReduction.php:156
993 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 13237) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.045 ms 1 /classes/stock/StockAvailable.php:453
1010 
SELECT SQL_NO_CACHE state FROM een_feature_flag WHERE name = 'multiple_image_format' LIMIT 1
 0.045 ms 1 /classes/FeatureFlag.php:105
1240 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 78 AND `id_shop` = 1 LIMIT 1
 0.045 ms 1 /classes/module/Module.php:2132
581 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1043 LIMIT 1
 0.045 ms 1 /classes/Product.php:5659
935 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 1011 LIMIT 1
 0.045 ms 1 /classes/Category.php:1378
38 
SELECT SQL_NO_CACHE id_shop
FROM `een_group_shop`
WHERE `id_group` = 1
AND id_shop = 1 LIMIT 1
 0.044 ms 1 /classes/ObjectModel.php:1729
125 
SELECT SQL_NO_CACHE `name`
FROM `een_country_lang`
WHERE `id_lang` = 1
AND `id_country` = 4 LIMIT 1
 0.044 ms 1 /classes/Country.php:252
129 
SELECT SQL_NO_CACHE `name`
FROM `een_country_lang`
WHERE `id_lang` = 1
AND `id_country` = 3 LIMIT 1
 0.044 ms 1 /classes/Country.php:252
192 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 25043) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.044 ms 1 /classes/stock/StockAvailable.php:453
237 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 647724 AND id_shop=1 LIMIT 1
 0.044 ms 1 /classes/Product.php:6876
254 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 2754 LIMIT 1
 0.044 ms 1 /classes/Category.php:1378
273 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 647808) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.044 ms 1 /classes/stock/StockAvailable.php:453
407 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 418 LIMIT 1
 0.044 ms 1 /classes/Product.php:5659
560 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 1043 LIMIT 1
 0.044 ms 1 /classes/Category.php:1378
585 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 4508 AND id_shop=1 LIMIT 1
 0.044 ms 1 /classes/Product.php:6876
626 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 4324 AND id_shop=1 LIMIT 1
 0.044 ms 1 /classes/Product.php:6876
628 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 4324) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.044 ms 1 /classes/stock/StockAvailable.php:453
632 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1042 LIMIT 1
 0.044 ms 1 /classes/Product.php:5659
729 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 25042) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.044 ms 1 /classes/stock/StockAvailable.php:453
761 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 647717 AND id_shop=1 LIMIT 1
 0.044 ms 1 /classes/Product.php:6876
763 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 647717) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.044 ms 1 /classes/stock/StockAvailable.php:453
997 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 767 LIMIT 1
 0.044 ms 1 /classes/Category.php:1378
1004 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 647862) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.044 ms 1 /classes/stock/StockAvailable.php:453
1253 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "iqitproductsnav" LIMIT 1
 0.044 ms 1 /classes/module/Module.php:2659
22 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.044 ms 0 /classes/module/Module.php:2132
45 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.044 ms 0 /classes/module/Module.php:2132
214 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 647720 AND id_shop=1 LIMIT 1
 0.044 ms 1 /classes/Product.php:6876
231 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 5830 LIMIT 1
 0.044 ms 1 /classes/Category.php:1378
265 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 253 LIMIT 1
 0.044 ms 1 /classes/Category.php:1378
310 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 367 LIMIT 1
 0.044 ms 1 /classes/Category.php:1378
332 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 366 LIMIT 1
 0.044 ms 1 /classes/Category.php:1378
375 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 1013 LIMIT 1
 0.044 ms 1 /classes/Category.php:1378
396 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 418 LIMIT 1
 0.044 ms 1 /classes/Category.php:1378
417 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 1020 LIMIT 1
 0.044 ms 1 /classes/Category.php:1378
424 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 36837) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.044 ms 1 /classes/stock/StockAvailable.php:453
428 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 1039 LIMIT 1
 0.044 ms 1 /classes/Category.php:1378
733 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 413 LIMIT 1
 0.044 ms 1 /classes/Category.php:1378
736 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 647713
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.044 ms 0 /classes/SpecificPrice.php:259
904 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 2788 LIMIT 1
 0.044 ms 1 /classes/Product.php:5659
924 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 2368 LIMIT 1
 0.044 ms 1 /classes/Category.php:1378
261 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 36884) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.043 ms 1 /classes/stock/StockAvailable.php:453
271 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 647808 AND id_shop=1 LIMIT 1
 0.043 ms 1 /classes/Product.php:6876
277 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 742 LIMIT 1
 0.043 ms 1 /classes/Category.php:1378
299 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 253 LIMIT 1
 0.043 ms 1 /classes/Product.php:5659
343 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 1014 LIMIT 1
 0.043 ms 1 /classes/Category.php:1378
506 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 4447) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.043 ms 1 /classes/stock/StockAvailable.php:453
530 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1039 LIMIT 1
 0.043 ms 1 /classes/Product.php:5659
591 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 5318 LIMIT 1
 0.043 ms 0 /classes/Category.php:1378
636 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 4318 AND id_shop=1 LIMIT 1
 0.043 ms 1 /classes/Product.php:6876
712 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1042 LIMIT 1
 0.043 ms 1 /classes/Product.php:5659
752 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 647718) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.043 ms 1 /classes/stock/StockAvailable.php:453
777 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 352 LIMIT 1
 0.043 ms 1 /classes/Category.php:1378
1243 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 6 AND `id_shop` = 1 LIMIT 1
 0.043 ms 1 /classes/module/Module.php:2132
40 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.043 ms 0 /classes/module/Module.php:2132
66 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_last_product_not_ordered` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `last_product_ordered` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
 0.043 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
121 
SELECT SQL_NO_CACHE `name`
FROM `een_country_lang`
WHERE `id_lang` = 1
AND `id_country` = 19 LIMIT 1
 0.043 ms 1 /classes/Country.php:252
196 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 1042 LIMIT 1
 0.043 ms 1 /classes/Category.php:1378
204 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 4412) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.043 ms 1 /classes/stock/StockAvailable.php:453
220 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 5828 LIMIT 1
 0.043 ms 1 /classes/Product.php:5659
225 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 647723 AND id_shop=1 LIMIT 1
 0.043 ms 1 /classes/Product.php:6876
243 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 5830 LIMIT 1
 0.043 ms 1 /classes/Product.php:5659
288 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 1022 LIMIT 1
 0.043 ms 1 /classes/Category.php:1378
411 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 549338 AND id_shop=1 LIMIT 1
 0.043 ms 1 /classes/Product.php:6876
422 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 36837 AND id_shop=1 LIMIT 1
 0.043 ms 1 /classes/Product.php:6876
439 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1039 LIMIT 1
 0.043 ms 1 /classes/Product.php:5659
475 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 4493) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.043 ms 1 /classes/stock/StockAvailable.php:453
479 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1038 LIMIT 1
 0.043 ms 1 /classes/Product.php:5659
489 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 1040 LIMIT 1
 0.043 ms 1 /classes/Category.php:1378
496 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 5009) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.043 ms 1 /classes/stock/StockAvailable.php:453
514 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 6318 AND id_shop=1 LIMIT 1
 0.043 ms 1 /classes/Product.php:6876
616 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 4320 AND id_shop=1 LIMIT 1
 0.043 ms 1 /classes/Product.php:6876
642 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1042 LIMIT 1
 0.043 ms 1 /classes/Product.php:5659
706 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 4337 AND id_shop=1 LIMIT 1
 0.043 ms 1 /classes/Product.php:6876
708 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 4337) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.043 ms 1 /classes/stock/StockAvailable.php:453
739 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 647713 AND id_shop=1 LIMIT 1
 0.043 ms 1 /classes/Product.php:6876
741 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 647713) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.043 ms 1 /classes/stock/StockAvailable.php:453
745 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 413 LIMIT 1
 0.043 ms 1 /classes/Product.php:5659
771 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 14272 AND id_shop=1 LIMIT 1
 0.043 ms 1 /classes/Product.php:6876
773 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 14272) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.043 ms 1 /classes/stock/StockAvailable.php:453
793 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 354868 AND id_shop=1 LIMIT 1
 0.043 ms 1 /classes/Product.php:6876
795 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 354868) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.043 ms 1 /classes/stock/StockAvailable.php:453
809 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 2750 LIMIT 1
 0.043 ms 1 /classes/Product.php:5659
819 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 1029 LIMIT 1
 0.043 ms 1 /classes/Category.php:1378
842 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1013 LIMIT 1
 0.043 ms 1 /classes/Product.php:5659
853 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 10088
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.043 ms 0 /classes/SpecificPrice.php:259
864 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 5977
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.043 ms 0 /classes/SpecificPrice.php:259
908 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 31006 AND id_shop=1 LIMIT 1
 0.043 ms 1 /classes/Product.php:6876
914 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 2788 LIMIT 1
 0.043 ms 1 /classes/Product.php:5659
950 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 35913 AND id_shop=1 LIMIT 1
 0.043 ms 1 /classes/Product.php:6876
952 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 35913) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.043 ms 1 /classes/stock/StockAvailable.php:453
966 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 2750 LIMIT 1
 0.043 ms 1 /classes/Product.php:5659
983 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 608048) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.043 ms 1 /classes/stock/StockAvailable.php:453
284 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 10087) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.042 ms 1 /classes/stock/StockAvailable.php:453
516 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 6318) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.042 ms 1 /classes/stock/StockAvailable.php:453
598 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 4516) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.042 ms 1 /classes/stock/StockAvailable.php:453
608 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 4322) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.042 ms 1 /classes/stock/StockAvailable.php:453
656 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 4355 AND id_shop=1 LIMIT 1
 0.042 ms 1 /classes/Product.php:6876
658 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 4355) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.042 ms 1 /classes/stock/StockAvailable.php:453
827 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 647913) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.042 ms 1 /classes/stock/StockAvailable.php:453
863 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1015 LIMIT 1
 0.042 ms 1 /classes/Product.php:5659
977 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 2750 LIMIT 1
 0.042 ms 1 /classes/Product.php:5659
1365 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 93 AND `id_shop` = 1 LIMIT 1
 0.042 ms 1 /classes/module/Module.php:2132
48 
SELECT SQL_NO_CACHE `need_identification_number`
FROM `een_country`
WHERE `id_country` = 17 LIMIT 1
 0.042 ms 1 /classes/Country.php:405
55 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "gremarketing" LIMIT 1
 0.042 ms 0 /classes/module/Module.php:2659
190 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 25043 AND id_shop=1 LIMIT 1
 0.042 ms 1 /classes/Product.php:6876
239 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 647724) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.042 ms 1 /classes/stock/StockAvailable.php:453
282 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 10087 AND id_shop=1 LIMIT 1
 0.042 ms 1 /classes/Product.php:6876
304 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 4997 AND id_shop=1 LIMIT 1
 0.042 ms 1 /classes/Product.php:6876
306 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 4997) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.042 ms 1 /classes/stock/StockAvailable.php:453
315 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 10086 AND id_shop=1 LIMIT 1
 0.042 ms 1 /classes/Product.php:6876
326 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 40036 AND id_shop=1 LIMIT 1
 0.042 ms 1 /classes/Product.php:6876
337 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 5964 AND id_shop=1 LIMIT 1
 0.042 ms 1 /classes/Product.php:6876
354 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1014 LIMIT 1
 0.042 ms 1 /classes/Product.php:5659
358 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 30894 AND id_shop=1 LIMIT 1
 0.042 ms 1 /classes/Product.php:6876
364 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 1038 LIMIT 1
 0.042 ms 1 /classes/Category.php:1378
386 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 253 LIMIT 1
 0.042 ms 1 /classes/Product.php:5659
435 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 36524) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.042 ms 1 /classes/stock/StockAvailable.php:453
443 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 4489 AND id_shop=1 LIMIT 1
 0.042 ms 1 /classes/Product.php:6876
445 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 4489) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.042 ms 1 /classes/stock/StockAvailable.php:453
449 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1039 LIMIT 1
 0.042 ms 1 /classes/Product.php:5659
459 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1039 LIMIT 1
 0.042 ms 1 /classes/Product.php:5659
469 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1039 LIMIT 1
 0.042 ms 1 /classes/Product.php:5659
494 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 5009 AND id_shop=1 LIMIT 1
 0.042 ms 1 /classes/Product.php:6876
510 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1038 LIMIT 1
 0.042 ms 1 /classes/Product.php:5659
520 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1040 LIMIT 1
 0.042 ms 1 /classes/Product.php:5659
526 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 5018) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.042 ms 1 /classes/stock/StockAvailable.php:453
544 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 4448 AND id_shop=1 LIMIT 1
 0.042 ms 1 /classes/Product.php:6876
550 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1040 LIMIT 1
 0.042 ms 1 /classes/Product.php:5659
554 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 6696 AND id_shop=1 LIMIT 1
 0.042 ms 1 /classes/Product.php:6876
565 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 6531 AND id_shop=1 LIMIT 1
 0.042 ms 1 /classes/Product.php:6876
576 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 6362 AND `id_group` = 1 LIMIT 1
 0.042 ms 0 /classes/GroupReduction.php:156
602 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1042 LIMIT 1
 0.042 ms 1 /classes/Product.php:5659
606 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 4322 AND id_shop=1 LIMIT 1
 0.042 ms 1 /classes/Product.php:6876
612 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1042 LIMIT 1
 0.042 ms 1 /classes/Product.php:5659
622 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1042 LIMIT 1
 0.042 ms 1 /classes/Product.php:5659
638 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 4318) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.042 ms 1 /classes/stock/StockAvailable.php:453
716 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 4333 AND id_shop=1 LIMIT 1
 0.042 ms 1 /classes/Product.php:6876
750 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 647718 AND id_shop=1 LIMIT 1
 0.042 ms 1 /classes/Product.php:6876
756 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 413 LIMIT 1
 0.042 ms 1 /classes/Product.php:5659
767 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1042 LIMIT 1
 0.042 ms 1 /classes/Product.php:5659
782 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 30772 AND id_shop=1 LIMIT 1
 0.042 ms 1 /classes/Product.php:6876
799 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 2750 LIMIT 1
 0.042 ms 1 /classes/Product.php:5659
803 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 11959 AND id_shop=1 LIMIT 1
 0.042 ms 1 /classes/Product.php:6876
805 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 11959) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.042 ms 1 /classes/stock/StockAvailable.php:453
825 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 647913 AND id_shop=1 LIMIT 1
 0.042 ms 1 /classes/Product.php:6876
831 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1029 LIMIT 1
 0.042 ms 1 /classes/Product.php:5659
836 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 647902 AND id_shop=1 LIMIT 1
 0.042 ms 1 /classes/Product.php:6876
846 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 40048 AND id_shop=1 LIMIT 1
 0.042 ms 1 /classes/Product.php:6876
848 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 40048) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.042 ms 1 /classes/stock/StockAvailable.php:453
960 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 40047 AND id_shop=1 LIMIT 1
 0.042 ms 1 /classes/Product.php:6876
971 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 647701 AND id_shop=1 LIMIT 1
 0.042 ms 1 /classes/Product.php:6876
973 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 647701) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.042 ms 1 /classes/stock/StockAvailable.php:453
981 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 608048 AND id_shop=1 LIMIT 1
 0.042 ms 1 /classes/Product.php:6876
987 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 2750 LIMIT 1
 0.042 ms 1 /classes/Product.php:5659
1002 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 647862 AND id_shop=1 LIMIT 1
 0.042 ms 1 /classes/Product.php:6876
54 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "gsnippetsreviews" LIMIT 1
 0.041 ms 0 /classes/module/Module.php:2659
222 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 647723
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.041 ms 0 /classes/SpecificPrice.php:259
234 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 647724
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.041 ms 0 /classes/SpecificPrice.php:259
259 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 36884 AND id_shop=1 LIMIT 1
 0.041 ms 1 /classes/Product.php:6876
293 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 40017 AND id_shop=1 LIMIT 1
 0.041 ms 1 /classes/Product.php:6876
295 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 40017) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.041 ms 1 /classes/stock/StockAvailable.php:453
317 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 10086) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.041 ms 1 /classes/stock/StockAvailable.php:453
328 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 40036) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.041 ms 1 /classes/stock/StockAvailable.php:453
339 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 5964) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.041 ms 1 /classes/stock/StockAvailable.php:453
348 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 40049 AND id_shop=1 LIMIT 1
 0.041 ms 1 /classes/Product.php:6876
360 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 30894) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.041 ms 1 /classes/stock/StockAvailable.php:453
371 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 4471) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.041 ms 1 /classes/stock/StockAvailable.php:453
380 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 36882 AND id_shop=1 LIMIT 1
 0.041 ms 1 /classes/Product.php:6876
382 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 36882) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.041 ms 1 /classes/stock/StockAvailable.php:453
390 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 4100 AND id_shop=1 LIMIT 1
 0.041 ms 1 /classes/Product.php:6876
392 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 4100) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.041 ms 1 /classes/stock/StockAvailable.php:453
433 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 36524 AND id_shop=1 LIMIT 1
 0.041 ms 1 /classes/Product.php:6876
453 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 4440 AND id_shop=1 LIMIT 1
 0.041 ms 1 /classes/Product.php:6876
463 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 4482 AND id_shop=1 LIMIT 1
 0.041 ms 1 /classes/Product.php:6876
465 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 4482) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.041 ms 1 /classes/stock/StockAvailable.php:453
473 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 4493 AND id_shop=1 LIMIT 1
 0.041 ms 1 /classes/Product.php:6876
483 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 4458 AND id_shop=1 LIMIT 1
 0.041 ms 1 /classes/Product.php:6876
504 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 4447 AND id_shop=1 LIMIT 1
 0.041 ms 1 /classes/Product.php:6876
546 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 4448) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.041 ms 1 /classes/stock/StockAvailable.php:453
556 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 6696) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.041 ms 1 /classes/stock/StockAvailable.php:453
567 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 6531) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.041 ms 1 /classes/stock/StockAvailable.php:453
618 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 4320) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.041 ms 1 /classes/stock/StockAvailable.php:453
646 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 4408 AND id_shop=1 LIMIT 1
 0.041 ms 1 /classes/Product.php:6876
648 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 4408) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.041 ms 1 /classes/stock/StockAvailable.php:453
652 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1042 LIMIT 1
 0.041 ms 1 /classes/Product.php:5659
666 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 5013 AND id_shop=1 LIMIT 1
 0.041 ms 1 /classes/Product.php:6876
668 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 5013) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.041 ms 1 /classes/stock/StockAvailable.php:453
784 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 30772) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.041 ms 1 /classes/stock/StockAvailable.php:453
815 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 31013) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.041 ms 1 /classes/stock/StockAvailable.php:453
822 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 647913
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.041 ms 0 /classes/SpecificPrice.php:259
838 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 647902) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.041 ms 1 /classes/stock/StockAvailable.php:453
874 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 5052
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.041 ms 0 /classes/SpecificPrice.php:259
898 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 5050 AND `id_group` = 1 LIMIT 1
 0.041 ms 0 /classes/GroupReduction.php:156
947 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 35913
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.041 ms 0 /classes/SpecificPrice.php:259
962 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 40047) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.041 ms 1 /classes/stock/StockAvailable.php:453
991 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 13237 AND id_shop=1 LIMIT 1
 0.041 ms 1 /classes/Product.php:6876
1339 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.041 ms 0 /classes/module/Module.php:2132
500 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1038 LIMIT 1
 0.041 ms 1 /classes/Product.php:5659
813 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 31013 AND id_shop=1 LIMIT 1
 0.041 ms 1 /classes/Product.php:6876
268 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 647808
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.040 ms 0 /classes/SpecificPrice.php:259
311 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 367 LIMIT 1
 0.040 ms 1 /classes/Product.php:5659
369 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 4471 AND id_shop=1 LIMIT 1
 0.040 ms 1 /classes/Product.php:6876
455 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 4440) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.040 ms 1 /classes/stock/StockAvailable.php:453
833 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 647902
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.040 ms 0 /classes/SpecificPrice.php:259
245 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 647719
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.040 ms 0 /classes/SpecificPrice.php:259
350 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 40049) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.040 ms 1 /classes/stock/StockAvailable.php:453
758 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 647717
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.040 ms 0 /classes/SpecificPrice.php:259
968 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 647701
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.040 ms 0 /classes/SpecificPrice.php:259
1362 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "ps_emailsubscription" LIMIT 1
 0.040 ms 1 /classes/module/Module.php:2659
171 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 4525
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.039 ms 0 /classes/SpecificPrice.php:259
643 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 4408
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.039 ms 0 /classes/SpecificPrice.php:259
747 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 647718
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.039 ms 0 /classes/SpecificPrice.php:259
884 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 31035
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.039 ms 0 /classes/SpecificPrice.php:259
1255 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "ps_facetedsearch" LIMIT 1
 0.039 ms 1 /classes/module/Module.php:2659
60 
CREATE TABLE IF NOT EXISTS `een_gmcp_feeds` (`id_feed` int(11) NOT NULL AUTO_INCREMENT,`iso_lang` LONGTEXT NOT NULL,`iso_country` LONGTEXT NOT NULL,`iso_currency` LONGTEXT NOT NULL, `taxonomy` LONGTEXT NOT NULL, `id_shop` int(11) NOT NULL,`date_add` datetime NOT NULL,`date_upd` datetime NOT NULL,PRIMARY KEY (`id_feed`)) ENGINE=' . _MYSQL_ENGINE_ . ' DEFAULT CHARSET=utf8;
 0.039 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
89 
CREATE TABLE IF NOT EXISTS `een_gmcp_feeds` (`id_feed` int(11) NOT NULL AUTO_INCREMENT,`iso_lang` LONGTEXT NOT NULL,`iso_country` LONGTEXT NOT NULL,`iso_currency` LONGTEXT NOT NULL, `taxonomy` LONGTEXT NOT NULL, `id_shop` int(11) NOT NULL,`date_add` datetime NOT NULL,`date_upd` datetime NOT NULL,PRIMARY KEY (`id_feed`)) ENGINE=' . _MYSQL_ENGINE_ . ' DEFAULT CHARSET=utf8;
 0.039 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
561 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1043 LIMIT 1
 0.038 ms 1 /classes/Product.php:5659
165 
SELECT SQL_NO_CACHE `name`
FROM `een_manufacturer`
WHERE `id_manufacturer` = 1635
AND `active` = 1 LIMIT 1
 0.038 ms 1 /classes/Manufacturer.php:316
535 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 11341 AND `id_group` = 1 LIMIT 1
 0.038 ms 0 /classes/GroupReduction.php:156
541 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 4448
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.038 ms 0 /classes/SpecificPrice.php:259
868 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 5977 AND `id_group` = 1 LIMIT 1
 0.038 ms 0 /classes/GroupReduction.php:156
930 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 30633 AND `id_group` = 1 LIMIT 1
 0.038 ms 0 /classes/GroupReduction.php:156
941 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 40046 AND `id_group` = 1 LIMIT 1
 0.038 ms 0 /classes/GroupReduction.php:156
957 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 40047
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.038 ms 0 /classes/SpecificPrice.php:259
633 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 4318
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.037 ms 0 /classes/SpecificPrice.php:259
703 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 4337
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.037 ms 0 /classes/SpecificPrice.php:259
724 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 25042
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.037 ms 0 /classes/SpecificPrice.php:259
919 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 31007 AND `id_group` = 1 LIMIT 1
 0.037 ms 0 /classes/GroupReduction.php:156
505 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 4447 AND `id_group` = 1 LIMIT 1
 0.037 ms 0 /classes/GroupReduction.php:156
653 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 4355
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.037 ms 0 /classes/SpecificPrice.php:259
723 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 415 LIMIT 1
 0.037 ms 1 /classes/Product.php:5659
888 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 31035 AND `id_group` = 1 LIMIT 1
 0.037 ms 0 /classes/GroupReduction.php:156
1252 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 79 AND `id_shop` = 1 LIMIT 1
 0.037 ms 1 /classes/module/Module.php:2132
164 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 2 LIMIT 1
 0.036 ms 1 /classes/Product.php:5659
402 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 541226 AND `id_group` = 1 LIMIT 1
 0.036 ms 0 /classes/GroupReduction.php:156
408 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 549338
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.036 ms 0 /classes/SpecificPrice.php:259
663 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 5013
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.036 ms 0 /classes/SpecificPrice.php:259
734 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 413 LIMIT 1
 0.036 ms 1 /classes/Product.php:5659
1248 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "iqitcompare" LIMIT 1
 0.036 ms 1 /classes/module/Module.php:2659
69 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags` (`id_tag` int(11) NOT NULL AUTO_INCREMENT, `id_shop` int(11) NOT NULL DEFAULT "1", `name` char(255) NOT NULL, `type` char(255) NOT NULL, `active` TINYINT NOT NULL, `position` INT NOT NULL, `end_date` DATE, PRIMARY KEY (`id_tag`)) ENGINE=MyISAM DEFAULT CHARSET=utf8 AUTO_INCREMENT=1 ;
 0.035 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
179 
SELECT SQL_NO_CACHE `reduction`
FROM `een_group`
WHERE `id_group` = 1 LIMIT 1
 0.035 ms 1 /classes/Group.php:154
300 
SELECT SQL_NO_CACHE `name`
FROM `een_manufacturer`
WHERE `id_manufacturer` = 11559
AND `active` = 1 LIMIT 1
 0.035 ms 1 /classes/Manufacturer.php:316
312 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 10086
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.035 ms 0 /classes/SpecificPrice.php:259
322 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 369 LIMIT 1
 0.035 ms 1 /classes/Product.php:5659
562 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 6531
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.035 ms 0 /classes/SpecificPrice.php:259
582 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 4508
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.035 ms 0 /classes/SpecificPrice.php:259
713 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 4333
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.035 ms 0 /classes/SpecificPrice.php:259
936 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1011 LIMIT 1
 0.035 ms 1 /classes/Product.php:5659
988 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 13237
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.035 ms 0 /classes/SpecificPrice.php:259
1340 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "onepagecheckout" LIMIT 1
 0.035 ms 0 /classes/module/Module.php:2659
68 
CREATE TABLE IF NOT EXISTS `een_gmcp_discount_association` (`id_association` int(11) NOT NULL AUTO_INCREMENT, `id_discount` int(11) NOT NULL, `id_product` int(11) NOT NULL, `channel` CHAR(120) NOT NULL DEFAULT "SHOPPING_ADS", PRIMARY KEY (`id_association`) ) ENGINE=MyISAM DEFAULT CHARSET=utf8;
 0.034 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
187 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 25043
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.034 ms 0 /classes/SpecificPrice.php:259
197 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1042 LIMIT 1
 0.034 ms 1 /classes/Product.php:5659
232 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 5830 LIMIT 1
 0.034 ms 1 /classes/Product.php:5659
256 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 36884
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.034 ms 0 /classes/SpecificPrice.php:259
266 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 253 LIMIT 1
 0.034 ms 1 /classes/Product.php:5659
289 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1022 LIMIT 1
 0.034 ms 1 /classes/Product.php:5659
344 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1014 LIMIT 1
 0.034 ms 1 /classes/Product.php:5659
387 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 4100
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.034 ms 0 /classes/SpecificPrice.php:259
460 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 4482
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.034 ms 0 /classes/SpecificPrice.php:259
490 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1040 LIMIT 1
 0.034 ms 1 /classes/Product.php:5659
762 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 647717 AND `id_group` = 1 LIMIT 1
 0.034 ms 0 /classes/GroupReduction.php:156
778 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 352 LIMIT 1
 0.034 ms 1 /classes/Product.php:5659
843 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 40048
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.034 ms 0 /classes/SpecificPrice.php:259
915 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 31007
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.034 ms 0 /classes/SpecificPrice.php:259
937 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 40046
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.034 ms 0 /classes/SpecificPrice.php:259
998 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 767 LIMIT 1
 0.034 ms 1 /classes/Product.php:5659
1254 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 81 AND `id_shop` = 1 LIMIT 1
 0.034 ms 1 /classes/module/Module.php:2132
1341 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.034 ms 0 /classes/module/Module.php:2132
61 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_price_range` (`id_tag` int(11) NOT NULL, `price_min` CHAR(255) NOT NULL, `price_max` CHAR(255), `id_product` CHAR(255), UNIQUE KEY `tag_price_range` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
 0.034 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
62 
CREATE TABLE IF NOT EXISTS `een_gmcp_tmp_rules`(`id` int(11) NOT NULL AUTO_INCREMENT, `id_shop` int(11) NOT NULL DEFAULT "1",`type` char(255) NOT NULL, `exclusion_values` longtext NOT NULL, PRIMARY KEY (`id`)) ENGINE=InnoDB DEFAULT CHARSET=utf8 AUTO_INCREMENT=1;
 0.034 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
90 
CREATE TABLE IF NOT EXISTS `een_gmcp_advanced_exclusion` (`id` int(11) NOT NULL AUTO_INCREMENT, `status` int(11) NOT NULL DEFAULT "1", `id_shop` int(11) NOT NULL DEFAULT "1", `name` char(255) NOT NULL, `type` char(255) NOT NULL, `exclusion_value` longtext NOT NULL, PRIMARY KEY (`id`)) ENGINE=InnoDB DEFAULT CHARSET=utf8 AUTO_INCREMENT=1;
 0.034 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
186 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 5729 LIMIT 1
 0.034 ms 1 /classes/Product.php:5659
255 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 2754 LIMIT 1
 0.034 ms 1 /classes/Product.php:5659
278 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 742 LIMIT 1
 0.034 ms 1 /classes/Product.php:5659
333 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 366 LIMIT 1
 0.034 ms 1 /classes/Product.php:5659
365 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1038 LIMIT 1
 0.034 ms 1 /classes/Product.php:5659
376 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1013 LIMIT 1
 0.034 ms 1 /classes/Product.php:5659
429 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1039 LIMIT 1
 0.034 ms 1 /classes/Product.php:5659
470 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 4493
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.034 ms 0 /classes/SpecificPrice.php:259
480 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 4458
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.034 ms 0 /classes/SpecificPrice.php:259
515 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 6318 AND `id_group` = 1 LIMIT 1
 0.034 ms 0 /classes/GroupReduction.php:156
551 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 6696
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.034 ms 0 /classes/SpecificPrice.php:259
613 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 4320
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.034 ms 0 /classes/SpecificPrice.php:259
800 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 11959
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.034 ms 0 /classes/SpecificPrice.php:259
810 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 31013
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.034 ms 0 /classes/SpecificPrice.php:259
925 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 2368 LIMIT 1
 0.034 ms 1 /classes/Product.php:5659
1360 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "blockwishlist" LIMIT 1
 0.034 ms 1 /classes/module/Module.php:2659
1363 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 19 AND `id_shop` = 1 LIMIT 1
 0.034 ms 0 /classes/module/Module.php:2132
67 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_last_product_not_ordered` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `last_product_ordered` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
 0.033 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
74 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags` (`id_tag` int(11) NOT NULL AUTO_INCREMENT, `id_shop` int(11) NOT NULL DEFAULT "1", `name` char(255) NOT NULL, `type` char(255) NOT NULL, `active` TINYINT NOT NULL, `position` INT NOT NULL, `end_date` DATE, PRIMARY KEY (`id_tag`)) ENGINE=MyISAM DEFAULT CHARSET=utf8 AUTO_INCREMENT=1 ;
 0.033 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
290 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 40017
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.033 ms 0 /classes/SpecificPrice.php:259
418 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1020 LIMIT 1
 0.033 ms 1 /classes/Product.php:5659
501 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 4447
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.033 ms 0 /classes/SpecificPrice.php:259
525 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 5018 AND `id_group` = 1 LIMIT 1
 0.033 ms 0 /classes/GroupReduction.php:156
597 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 4516 AND `id_group` = 1 LIMIT 1
 0.033 ms 0 /classes/GroupReduction.php:156
789 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 2750 LIMIT 1
 0.033 ms 1 /classes/Product.php:5659
790 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 354868
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.033 ms 0 /classes/SpecificPrice.php:259
1354 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "attributewizardpro" LIMIT 1
 0.033 ms 0 /classes/module/Module.php:2659
42 
CREATE TABLE IF NOT EXISTS `een_revolut_cards` (
`id` INT NOT NULL AUTO_INCREMENT,
`customer_id` INT NOT NULL ,
`card_number` VARCHAR(25) NOT NULL,
`expire_month` INT NOT NULL ,
`expire_year` INT NOT NULL ,
PRIMARY KEY (`id`)
) ENGINE=InnoDB;
 0.033 ms 1 /modules/revolutpayment/revolutpayment.php:331
70 
CREATE TABLE IF NOT EXISTS `een_gmcp_taxonomy` (`id_taxonomy` int(11) NOT NULL AUTO_INCREMENT, `value` text NOT NULL, `lang` varchar(5) NOT NULL, PRIMARY KEY (`id_taxonomy`), KEY `lang` (`lang`), FULLTEXT KEY `ft_index` (`value`)) ENGINE=MyISAM DEFAULT CHARSET=utf8 AUTO_INCREMENT=1;
 0.033 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
203 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 4412 AND `id_group` = 1 LIMIT 1
 0.033 ms 0 /classes/GroupReduction.php:156
209 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 5828 LIMIT 1
 0.033 ms 1 /classes/Product.php:5659
215 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 647720 AND `id_group` = 1 LIMIT 1
 0.033 ms 0 /classes/GroupReduction.php:156
355 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 30894
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.033 ms 0 /classes/SpecificPrice.php:259
397 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 418 LIMIT 1
 0.033 ms 1 /classes/Product.php:5659
440 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 4489
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.033 ms 0 /classes/SpecificPrice.php:259
450 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 4440
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.033 ms 0 /classes/SpecificPrice.php:259
511 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 6318
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.033 ms 0 /classes/SpecificPrice.php:259
521 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 5018
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.033 ms 0 /classes/SpecificPrice.php:259
531 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 11341
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.033 ms 0 /classes/SpecificPrice.php:259
586 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 4508 AND `id_group` = 1 LIMIT 1
 0.033 ms 0 /classes/GroupReduction.php:156
603 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 4322
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.033 ms 0 /classes/SpecificPrice.php:259
623 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 4324
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.033 ms 0 /classes/SpecificPrice.php:259
768 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 14272
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.033 ms 0 /classes/SpecificPrice.php:259
820 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1029 LIMIT 1
 0.033 ms 1 /classes/Product.php:5659
978 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 608048
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.033 ms 0 /classes/SpecificPrice.php:259
1245 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 7 AND `id_shop` = 1 LIMIT 1
 0.033 ms 1 /classes/module/Module.php:2132
63 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_last_product_ordered` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `last_product_ordered` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
 0.032 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
84 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_best_sale` (`id_tag` int(11) NOT NULL, `amount` CHAR(255) NOT NULL, `unit` CHAR(255) ,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255),  `id_shop` int(11) NOT NULL,  UNIQUE KEY `tag_best_sales` (`id_tag`, `id_product`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
 0.032 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
279 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 10087
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.032 ms 0 /classes/SpecificPrice.php:259
323 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 40036
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.032 ms 0 /classes/SpecificPrice.php:259
592 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 5318 LIMIT 1
 0.032 ms 0 /classes/Product.php:5659
593 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 4516
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.032 ms 0 /classes/SpecificPrice.php:259
607 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 4322 AND `id_group` = 1 LIMIT 1
 0.032 ms 0 /classes/GroupReduction.php:156
707 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 4337 AND `id_group` = 1 LIMIT 1
 0.032 ms 0 /classes/GroupReduction.php:156
728 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 25042 AND `id_group` = 1 LIMIT 1
 0.032 ms 0 /classes/GroupReduction.php:156
779 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 30772
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.032 ms 0 /classes/SpecificPrice.php:259
951 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 35913 AND `id_group` = 1 LIMIT 1
 0.032 ms 0 /classes/GroupReduction.php:156
88 
CREATE TABLE IF NOT EXISTS `een_gmcp_reporting` (`id_reporting` int(11) NOT NULL AUTO_INCREMENT,`iso_feed` LONGTEXT NOT NULL,    `reporting_content` LONGTEXT NOT NULL,`id_shop` int(11) NOT NULL,`date_add` datetime NOT NULL,`date_upd` datetime NOT NULL,PRIMARY KEY (`id_reporting`)) ENGINE=' . _MYSQL_ENGINE_ . ' DEFAULT CHARSET=utf8;
 0.032 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
198 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 4412
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.032 ms 0 /classes/SpecificPrice.php:259
226 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 647723 AND `id_group` = 1 LIMIT 1
 0.032 ms 0 /classes/GroupReduction.php:156
238 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 647724 AND `id_group` = 1 LIMIT 1
 0.032 ms 0 /classes/GroupReduction.php:156
260 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 36884 AND `id_group` = 1 LIMIT 1
 0.032 ms 0 /classes/GroupReduction.php:156
272 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 647808 AND `id_group` = 1 LIMIT 1
 0.032 ms 0 /classes/GroupReduction.php:156
301 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 4997
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.032 ms 0 /classes/SpecificPrice.php:259
345 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 40049
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.032 ms 0 /classes/SpecificPrice.php:259
366 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 4471
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.032 ms 0 /classes/SpecificPrice.php:259
377 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 36882
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.032 ms 0 /classes/SpecificPrice.php:259
412 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 549338 AND `id_group` = 1 LIMIT 1
 0.032 ms 0 /classes/GroupReduction.php:156
423 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 36837 AND `id_group` = 1 LIMIT 1
 0.032 ms 0 /classes/GroupReduction.php:156
430 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 36524
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.032 ms 0 /classes/SpecificPrice.php:259
444 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 4489 AND `id_group` = 1 LIMIT 1
 0.032 ms 0 /classes/GroupReduction.php:156
474 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 4493 AND `id_group` = 1 LIMIT 1
 0.032 ms 0 /classes/GroupReduction.php:156
491 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 5009
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.032 ms 0 /classes/SpecificPrice.php:259
495 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 5009 AND `id_group` = 1 LIMIT 1
 0.032 ms 0 /classes/GroupReduction.php:156
555 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 6696 AND `id_group` = 1 LIMIT 1
 0.032 ms 0 /classes/GroupReduction.php:156
627 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 4324 AND `id_group` = 1 LIMIT 1
 0.032 ms 0 /classes/GroupReduction.php:156
647 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 4408 AND `id_group` = 1 LIMIT 1
 0.032 ms 0 /classes/GroupReduction.php:156
717 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 4333 AND `id_group` = 1 LIMIT 1
 0.032 ms 0 /classes/GroupReduction.php:156
804 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 11959 AND `id_group` = 1 LIMIT 1
 0.032 ms 0 /classes/GroupReduction.php:156
909 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 31006 AND `id_group` = 1 LIMIT 1
 0.032 ms 0 /classes/GroupReduction.php:156
926 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 30633
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.032 ms 0 /classes/SpecificPrice.php:259
982 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 608048 AND `id_group` = 1 LIMIT 1
 0.032 ms 0 /classes/GroupReduction.php:156
999 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 647862
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.032 ms 0 /classes/SpecificPrice.php:259
1249 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 70 AND `id_shop` = 1 LIMIT 1
 0.032 ms 1 /classes/module/Module.php:2132
1256 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 24 AND `id_shop` = 1 LIMIT 1
 0.032 ms 1 /classes/module/Module.php:2132
1361 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 3 AND `id_shop` = 1 LIMIT 1
 0.032 ms 0 /classes/module/Module.php:2132
80 
CREATE TABLE IF NOT EXISTS `een_gmcp_discount_association` (`id_association` int(11) NOT NULL AUTO_INCREMENT, `id_discount` int(11) NOT NULL, `id_product` int(11) NOT NULL, `channel` CHAR(120) NOT NULL DEFAULT "SHOPPING_ADS", PRIMARY KEY (`id_association`) ) ENGINE=MyISAM DEFAULT CHARSET=utf8;
 0.031 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
64 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_promotion` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `promotion` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
 0.031 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
72 
CREATE TABLE IF NOT EXISTS `een_gmcp_taxonomy_categories` (`id_category` int(11) NOT NULL, `id_shop` int(3) NOT NULL DEFAULT "1", `txt_taxonomy` text NOT NULL, `lang` char(5) NOT NULL, KEY `id_category` (`id_category`,`lang`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
 0.031 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
77 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_products` (`id_tag` int(11) NOT NULL, `id_product` int(11) NOT NULL, product_name VARCHAR (255) NOT NULL, UNIQUE KEY `tag_product` (`id_tag`,`id_product`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
 0.031 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
191 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 25043 AND `id_group` = 1 LIMIT 1
 0.031 ms 0 /classes/GroupReduction.php:156
283 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 10087 AND `id_group` = 1 LIMIT 1
 0.031 ms 0 /classes/GroupReduction.php:156
294 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 40017 AND `id_group` = 1 LIMIT 1
 0.031 ms 0 /classes/GroupReduction.php:156
305 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 4997 AND `id_group` = 1 LIMIT 1
 0.031 ms 0 /classes/GroupReduction.php:156
316 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 10086 AND `id_group` = 1 LIMIT 1
 0.031 ms 0 /classes/GroupReduction.php:156
327 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 40036 AND `id_group` = 1 LIMIT 1
 0.031 ms 0 /classes/GroupReduction.php:156
334 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 5964
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.031 ms 0 /classes/SpecificPrice.php:259
391 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 4100 AND `id_group` = 1 LIMIT 1
 0.031 ms 0 /classes/GroupReduction.php:156
398 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 541226
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.031 ms 0 /classes/SpecificPrice.php:259
434 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 36524 AND `id_group` = 1 LIMIT 1
 0.031 ms 0 /classes/GroupReduction.php:156
454 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 4440 AND `id_group` = 1 LIMIT 1
 0.031 ms 0 /classes/GroupReduction.php:156
464 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 4482 AND `id_group` = 1 LIMIT 1
 0.031 ms 0 /classes/GroupReduction.php:156
484 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 4458 AND `id_group` = 1 LIMIT 1
 0.031 ms 0 /classes/GroupReduction.php:156
545 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 4448 AND `id_group` = 1 LIMIT 1
 0.031 ms 0 /classes/GroupReduction.php:156
566 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 6531 AND `id_group` = 1 LIMIT 1
 0.031 ms 0 /classes/GroupReduction.php:156
617 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 4320 AND `id_group` = 1 LIMIT 1
 0.031 ms 0 /classes/GroupReduction.php:156
637 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 4318 AND `id_group` = 1 LIMIT 1
 0.031 ms 0 /classes/GroupReduction.php:156
657 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 4355 AND `id_group` = 1 LIMIT 1
 0.031 ms 0 /classes/GroupReduction.php:156
667 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 5013 AND `id_group` = 1 LIMIT 1
 0.031 ms 0 /classes/GroupReduction.php:156
740 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 647713 AND `id_group` = 1 LIMIT 1
 0.031 ms 0 /classes/GroupReduction.php:156
751 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 647718 AND `id_group` = 1 LIMIT 1
 0.031 ms 0 /classes/GroupReduction.php:156
772 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 14272 AND `id_group` = 1 LIMIT 1
 0.031 ms 0 /classes/GroupReduction.php:156
783 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 30772 AND `id_group` = 1 LIMIT 1
 0.031 ms 0 /classes/GroupReduction.php:156
794 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 354868 AND `id_group` = 1 LIMIT 1
 0.031 ms 0 /classes/GroupReduction.php:156
826 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 647913 AND `id_group` = 1 LIMIT 1
 0.031 ms 0 /classes/GroupReduction.php:156
847 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 40048 AND `id_group` = 1 LIMIT 1
 0.031 ms 0 /classes/GroupReduction.php:156
961 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 40047 AND `id_group` = 1 LIMIT 1
 0.031 ms 0 /classes/GroupReduction.php:156
972 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 647701 AND `id_group` = 1 LIMIT 1
 0.031 ms 0 /classes/GroupReduction.php:156
992 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 13237 AND `id_group` = 1 LIMIT 1
 0.031 ms 0 /classes/GroupReduction.php:156
1003 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 647862 AND `id_group` = 1 LIMIT 1
 0.031 ms 0 /classes/GroupReduction.php:156
1246 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "iqitwishlist" LIMIT 1
 0.031 ms 1 /classes/module/Module.php:2659
71 
CREATE TABLE IF NOT EXISTS `een_gmcp_categories` (`id_category` int(11) NOT NULL, `id_shop` int(11) NOT NULL DEFAULT "1",  UNIQUE KEY `id_category` (`id_category`, `id_shop`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
 0.030 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
79 
CREATE TABLE IF NOT EXISTS `een_gmcp_features_by_cat` (`id_cat` int(11) NOT NULL DEFAULT '0', `id_shop` int(3) NOT NULL DEFAULT "1", `values` text NOT NULL, PRIMARY KEY (`id_cat`, `id_shop`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
 0.030 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
81 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_features` (`id_tag` int(11) NOT NULL, `id_feature` int(11) NOT NULL, `id_shop` int(11) NOT NULL,  UNIQUE KEY `tag_feature` (`id_tag`, `id_feature`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
 0.030 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
82 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_categories` (`id_tag` int(11) NOT NULL, `id_category` int(11) NOT NULL, `id_shop` int(11) NOT NULL,  UNIQUE KEY `tag_feature` (`id_tag`, `id_category`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
 0.030 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
85 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_last_product_ordered` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `last_product_ordered` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
 0.030 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
93 
CREATE TABLE IF NOT EXISTS `een_gmcp_tmp_rules`(`id` int(11) NOT NULL AUTO_INCREMENT, `id_shop` int(11) NOT NULL DEFAULT "1",`type` char(255) NOT NULL, `exclusion_values` longtext NOT NULL, PRIMARY KEY (`id`)) ENGINE=InnoDB DEFAULT CHARSET=utf8 AUTO_INCREMENT=1;
 0.030 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
338 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 5964 AND `id_group` = 1 LIMIT 1
 0.030 ms 0 /classes/GroupReduction.php:156
349 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 40049 AND `id_group` = 1 LIMIT 1
 0.030 ms 0 /classes/GroupReduction.php:156
359 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 30894 AND `id_group` = 1 LIMIT 1
 0.030 ms 0 /classes/GroupReduction.php:156
370 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 4471 AND `id_group` = 1 LIMIT 1
 0.030 ms 0 /classes/GroupReduction.php:156
381 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 36882 AND `id_group` = 1 LIMIT 1
 0.030 ms 0 /classes/GroupReduction.php:156
1247 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 87 AND `id_shop` = 1 LIMIT 1
 0.030 ms 1 /classes/module/Module.php:2132
1342 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "onepagecheckoutps" LIMIT 1
 0.030 ms 0 /classes/module/Module.php:2659
1343 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.030 ms 0 /classes/module/Module.php:2132
814 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 31013 AND `id_group` = 1 LIMIT 1
 0.030 ms 0 /classes/GroupReduction.php:156
837 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 647902 AND `id_group` = 1 LIMIT 1
 0.030 ms 0 /classes/GroupReduction.php:156
1344 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "steasycheckout" LIMIT 1
 0.030 ms 0 /classes/module/Module.php:2659
78 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_suppliers` (`id_tag` int(11) NOT NULL, `id_supplier` int(11) NOT NULL, UNIQUE KEY `tag_supplier` (`id_tag`,`id_supplier`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
 0.029 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
83 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_new_product` (`id_tag` int(11) NOT NULL,  `from_date` DATETIME, `id_product` int,  `id_shop` int(11) NOT NULL,  UNIQUE KEY `tag_new_product` (`id_tag`, `id_product`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
 0.029 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
87 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_promotion` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `promotion` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
 0.029 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
91 
CREATE TABLE IF NOT EXISTS `een_gmcp_product_excluded` (`id_rule` int(11) NOT NULL DEFAULT "0",`id_product` int(11) NOT NULL DEFAULT "0", `id_product_attribute` int(11)) ENGINE=InnoDB DEFAULT CHARSET=utf8 AUTO_INCREMENT=1;
 0.029 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
92 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_price_range` (`id_tag` int(11) NOT NULL, `price_min` CHAR(255) NOT NULL, `price_max` CHAR(255), `id_product` CHAR(255), UNIQUE KEY `tag_price_range` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
 0.029 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
1346 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "thecheckout" LIMIT 1
 0.029 ms 0 /classes/module/Module.php:2659
1349 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.029 ms 0 /classes/module/Module.php:2132
1357 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.029 ms 0 /classes/module/Module.php:2132
73 
CREATE TABLE IF NOT EXISTS `een_gmcp_brands` (`id_brands` int(11) NOT NULL, `id_shop` int(11) NOT NULL DEFAULT "1",  UNIQUE KEY `id_brands` (`id_brands`, `id_shop`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
 0.029 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
86 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_last_product_not_ordered` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `last_product_ordered` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
 0.029 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
1355 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.029 ms 0 /classes/module/Module.php:2132
75 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_brands` (`id_tag` int(11) NOT NULL, `id_brand` int(11) NOT NULL, UNIQUE KEY `tag_brand` (`id_tag`,`id_brand`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
 0.028 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
76 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_cats` (`id_tag` int(11) NOT NULL, `id_category` int(11) NOT NULL, UNIQUE KEY `tag_cat` (`id_tag`,`id_category`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
 0.028 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
1348 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "idxropc" LIMIT 1
 0.028 ms 0 /classes/module/Module.php:2659
1345 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.028 ms 0 /classes/module/Module.php:2132
1351 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.028 ms 0 /classes/module/Module.php:2132
1352 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "easycheckout" LIMIT 1
 0.028 ms 0 /classes/module/Module.php:2659
1356 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "cdesigner" LIMIT 1
 0.028 ms 0 /classes/module/Module.php:2659
1347 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.027 ms 0 /classes/module/Module.php:2132
1359 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.027 ms 0 /classes/module/Module.php:2132
1350 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "pwpaysoncheckout" LIMIT 1
 0.027 ms 0 /classes/module/Module.php:2659
1353 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.027 ms 0 /classes/module/Module.php:2132
1358 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "configurator" LIMIT 1
 0.027 ms 0 /classes/module/Module.php:2659
57 
BEGIN
 0.024 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:81
99 
COMMIT
 0.024 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:155
94 
COMMIT
 0.018 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:107
95 
BEGIN
 0.016 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:121

Doubles

79 queries 
SELECT image_shop.`id_image`
                    FROM `een_image` i
                     INNER JOIN een_image_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
                    WHERE i.`id_product` = XX
                    AND image_shop.`cover` = XX LIMIT XX
79 queries 
SELECT name FROM een_category_lang WHERE id_shop = XX AND id_lang = XX AND id_category = XX LIMIT XX
79 queries 
				SELECT `priority`, `id_specific_price_priority`
				FROM `een_specific_price_priority`
				WHERE `id_product` = XX
				ORDER BY `id_specific_price_priority` DESC LIMIT XX
79 queries 
			SELECT *, ( IF (`id_shop` = XX, XX, XX) +  IF (`id_country` = XX, XX, XX) +  IF (`id_currency` = XX, XX, XX) +  IF (`id_group` = XX, XX, XX) +  IF (`id_customer` = XX, XX, XX)) AS `score`
				FROM `een_specific_price`
				WHERE
                `id_shop` IN (XX, XX) AND
                `id_currency` IN (XX, XX) AND
                `id_country` IN (XX, XX) AND
                `id_group` IN (XX, XX) AND `id_product` IN (XX, XX) AND `id_customer` = XX AND `id_product_attribute` = XX AND `id_cart` = XX  AND (`from` = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' >= `from`) AND (`to` = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' <= `to`)
				AND IF(`from_quantity` > XX, `from_quantity`, XX) <= XX ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT XX
79 queries 
SELECT product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,XX) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = XX)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = XX)
WHERE (p.`id_product` = XX)
79 queries 
                            SELECT `id_tax_rules_group`
                            FROM `een_product_shop`
                            WHERE `id_product` = XX AND id_shop=XX LIMIT XX
79 queries 
			SELECT `reduction`
			FROM `een_product_group_reduction_cache`
			WHERE `id_product` = XX AND `id_group` = XX LIMIT XX
79 queries 
SELECT SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
79 queries 
SELECT
            COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), XX) as deep_quantity,
            COALESCE(SUM(first_level_quantity), XX) as quantity
          FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, XX as pack_quantity
          FROM `een_cart_product` cp
            WHERE cp.`id_product_attribute` = XX
            
            AND cp.`id_cart` = XX AND cp.`id_product` = XX UNION SELECT XX as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
          FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
            WHERE cp.`id_product_attribute` = XX
            
            AND cp.`id_cart` = XX AND p.`id_product_item` = XX AND (pr.`pack_stock_type` IN (XX,XX) OR (
            pr.`pack_stock_type` = XX
            AND XX = XX
        ))) as q LIMIT XX
79 queries 
                SELECT name, value, pf.id_feature, f.position, fvl.id_feature_value
                FROM een_feature_product pf
                LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = XX)
                LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = XX)
                LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = XX)
                 INNER JOIN een_feature_shop feature_shop
        ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = XX)
                WHERE pf.id_product = XX
                ORDER BY f.position ASC
79 queries 
SELECT *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = XX
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = XX
WHERE (a.`id_product` = XX) AND (b.`id_shop` = XX) LIMIT XX
79 queries 
            SELECT image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
            FROM `een_image` i
             INNER JOIN een_image_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
            LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = XX)
            WHERE i.`id_product` = XX
            ORDER BY `position`
79 queries 
SELECT `id_product_attribute`
            FROM `een_product_attribute`
            WHERE `id_product` = XX
79 queries 
SELECT pa.`id_product`, a.`color`, pac.`id_product_attribute`, XX qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
            FROM `een_product_attribute` pa
             INNER JOIN een_product_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX)
            JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
            JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
            JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = XX)
            JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
            WHERE pa.`id_product` IN (XX) AND ag.`is_color_group` = XX
            GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
            
            ORDER BY a.`position` ASC;
31 queries 
			SELECT cl.`link_rewrite`
			FROM `een_category_lang` cl
			WHERE `id_lang` = XX
			 AND cl.id_shop = XX 
			AND cl.`id_category` = XX LIMIT XX
27 queries 
SELECT `id_module` FROM `een_module_shop` WHERE `id_module` = XX AND `id_shop` = XX LIMIT XX
7 queries 
SELECT *
FROM `een_country` a
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = XX
WHERE (a.`id_country` = XX) LIMIT XX
7 queries 
SELECT *
							FROM `een_country_lang`
							WHERE `id_country` = XX
7 queries 
			SELECT `id_country`
			FROM `een_country`
			WHERE `iso_code` = 'FR' LIMIT XX
5 queries 
							SELECT `name`
							FROM `een_country_lang`
							WHERE `id_lang` = XX
							AND `id_country` = XX LIMIT XX
5 queries 
SELECT v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `een_feature_value` v LEFT JOIN `een_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = XX) LEFT JOIN `een_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = XX) WHERE v.`id_feature` = XX ORDER BY vl.`value` ASC
5 queries 
SELECT fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pl.name FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, XX) = sa.id_product_attribute AND sa.id_shop = XX  AND sa.id_shop_group = XX ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_product_lang pl ON (p.id_product = pl.id_product AND pl.id_shop = XX AND pl.id_lang = XX) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = XX AND ps.active = TRUE) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=XX) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_specific_price sp ON (
                    sp.id_product = p.id_product AND 
                    sp.id_shop IN (XX, XX) AND 
                    sp.id_currency IN (XX, XX) AND 
                    sp.id_country IN (XX, XX) AND 
                    sp.id_group IN (XX, XX) AND 
                    sp.from_quantity = XX AND
                    sp.reduction > XX AND
                    sp.id_customer = XX AND
                    sp.id_cart = XX AND 
                    (sp.from = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' >= sp.from) AND 
                    (sp.to = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' <= sp.to) 
                ) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (XX, XX, XX, XX, XX, XX, XX, XX))) AND ps.id_shop='XX' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='XX' AND sp.reduction>XX GROUP BY p.id_product) p INNER JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_XX ON (p.id_product = fp_XX.id_product) WHERE ((fp.id_feature=XX)) AND ((fp_XX.id_feature_value IN (XX, XX, XX, XX, XX, XX, XX, XX))) GROUP BY fp.id_feature_value
3 queries 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_last_product_not_ordered` (`id_tag` int(XX) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(XX), UNIQUE KEY `last_product_ordered` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utfXX;
3 queries 
				SELECT tr.*
				FROM `een_tax_rule` tr
				JOIN `een_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
				WHERE trg.`active` = XX
				AND tr.`id_country` = XX
				AND tr.`id_tax_rules_group` = XX
				AND tr.`id_state` IN (XX, XX)
				AND ('XX' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
					OR (tr.`zipcode_to` = XX AND tr.`zipcode_from` IN(XX, 'XX')))
				ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
2 queries 
                SELECT m.`id_module`, m.`name`, ms.`id_module`as `mshop`
                FROM `een_module` m
                LEFT JOIN `een_module_shop` ms
                ON m.`id_module` = ms.`id_module`
                AND ms.`id_shop` = XX
2 queries 
SELECT `id_lang` FROM `een_lang`
                    WHERE `locale` = 'fr-fr'
                    OR `language_code` = 'fr-fr' LIMIT XX
2 queries 
BEGIN
2 queries 
SHOW TABLES LIKE "een_gmcp_XX"
2 queries 
CREATE TABLE IF NOT EXISTS `een_gmcp_reporting` (`id_reporting` int(XX) NOT NULL AUTO_INCREMENT,`iso_feed` LONGTEXT NOT NULL,    `reporting_content` LONGTEXT NOT NULL,`id_shop` int(XX) NOT NULL,`date_add` datetime NOT NULL,`date_upd` datetime NOT NULL,PRIMARY KEY (`id_reporting`)) ENGINE=' . _MYSQL_ENGINE_ . ' DEFAULT CHARSET=utfXX;
2 queries 
CREATE TABLE IF NOT EXISTS `een_gmcp_feeds` (`id_feed` int(XX) NOT NULL AUTO_INCREMENT,`iso_lang` LONGTEXT NOT NULL,`iso_country` LONGTEXT NOT NULL,`iso_currency` LONGTEXT NOT NULL, `taxonomy` LONGTEXT NOT NULL, `id_shop` int(XX) NOT NULL,`date_add` datetime NOT NULL,`date_upd` datetime NOT NULL,PRIMARY KEY (`id_feed`)) ENGINE=' . _MYSQL_ENGINE_ . ' DEFAULT CHARSET=utfXX;
2 queries 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_price_range` (`id_tag` int(XX) NOT NULL, `price_min` CHAR(XX) NOT NULL, `price_max` CHAR(XX), `id_product` CHAR(XX), UNIQUE KEY `tag_price_range` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utfXX;
2 queries 
CREATE TABLE IF NOT EXISTS `een_gmcp_tmp_rules`(`id` int(XX) NOT NULL AUTO_INCREMENT, `id_shop` int(XX) NOT NULL DEFAULT "XX",`type` char(XX) NOT NULL, `exclusion_values` longtext NOT NULL, PRIMARY KEY (`id`)) ENGINE=InnoDB DEFAULT CHARSET=utfXX AUTO_INCREMENT=XX;
2 queries 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_last_product_ordered` (`id_tag` int(XX) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(XX), UNIQUE KEY `last_product_ordered` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utfXX;
2 queries 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_promotion` (`id_tag` int(XX) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(XX), UNIQUE KEY `promotion` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utfXX;
2 queries 
CREATE TABLE IF NOT EXISTS `een_gmcp_discount_association` (`id_association` int(XX) NOT NULL AUTO_INCREMENT, `id_discount` int(XX) NOT NULL, `id_product` int(XX) NOT NULL, `channel` CHAR(XX) NOT NULL DEFAULT "SHOPPING_ADS", PRIMARY KEY (`id_association`) ) ENGINE=MyISAM DEFAULT CHARSET=utfXX;
2 queries 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags` (`id_tag` int(XX) NOT NULL AUTO_INCREMENT, `id_shop` int(XX) NOT NULL DEFAULT "XX", `name` char(XX) NOT NULL, `type` char(XX) NOT NULL, `active` TINYINT NOT NULL, `position` INT NOT NULL, `end_date` DATE, PRIMARY KEY (`id_tag`)) ENGINE=MyISAM DEFAULT CHARSET=utfXX AUTO_INCREMENT=XX ;
2 queries 
COMMIT
2 queries 
				SELECT `name`
				FROM `een_manufacturer`
				WHERE `id_manufacturer` = XX
				AND `active` = XX LIMIT XX
2 queries 
SELECT XX FROM `een_cart_rule` WHERE ((date_to >= "XX-XX-XX XX:XX:XX" AND date_to <= "XX-XX-XX XX:XX:XX") OR (date_from >= "XX-XX-XX XX:XX:XX" AND date_from <= "XX-XX-XX XX:XX:XX") OR (date_from < "XX-XX-XX XX:XX:XX" AND date_to > "XX-XX-XX XX:XX:XX")) AND `id_customer` IN (XX,XX) LIMIT XX

Tables stress

252 product
252 product_shop
174 product_attribute
159 cart_product
158 image
158 image_shop
158 product_attribute_shop
113 category_lang
109 feature_product
98 specific_price
97 stock_available
95 product_attribute_combination
94 product_lang
84 feature_value_lang
80 feature
80 feature_shop
80 feature_lang
79 specific_price_priority
79 product_group_reduction_cache
79 pack
79 image_lang
79 attribute
79 attribute_lang
79 attribute_group
34 module
30 module_shop
21 country
18 category
16 category_product
15 category_group
13 country_lang
13 product_sale
12 currency
8 country_shop
7 hook
5 lang
5 feature_value
5 layered_indexable_feature_value_lang_value
4 shop_url
4 shop
4 lang_shop
4 currency_shop
4 gmcp_feeds
4 cart_rule
3 hook_alias
3 category_shop
3 tax_rule
3 tax_rules_group
2 shop_group
2 configuration
2 hook_module
2 meta
2 meta_lang
2 currency_lang
2 group
2 group_shop
2 image_type
2 orders
2 manufacturer
2 cart_rule_lang
1 memcached_servers
1 configuration_lang
1 module_group
1 hook_module_exceptions
1 group_lang
1 address_format
1 required_field
1 revslider_sliders
1 gmcp_discount_association
1 gmcp_tags
1 layered_category
1 layered_indexable_feature
1 layered_indexable_feature_lang_value
1 layered_price_index
1 feature_flag
1 order_cart_rule
1 ganalytics_data

ObjectModel instances

Name Instances Source
Product 101 /classes/Link.php:113 (__construct) [id: 647720]
/classes/Link.php:113 (__construct) [id: 647723]
/classes/Link.php:113 (__construct) [id: 647724]
/classes/Link.php:113 (__construct) [id: 647719]
/classes/Link.php:113 (__construct) [id: 647808]
/classes/Link.php:113 (__construct) [id: 647713]
/classes/Link.php:113 (__construct) [id: 647718]
/classes/Link.php:113 (__construct) [id: 647717]
/classes/Link.php:113 (__construct) [id: 647913]
/classes/Link.php:113 (__construct) [id: 647902]
/classes/Link.php:113 (__construct) [id: 647701]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4525]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 25043]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4412]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 647720]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 647723]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 647724]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 647719]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 36884]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 647808]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 10087]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 40017]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4997]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 10086]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 40036]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5964]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 40049]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 30894]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4471]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 36882]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4100]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 541226]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 549338]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 36837]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 36524]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4489]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4440]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4482]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4493]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4458]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5009]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4447]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6318]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5018]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 11341]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4448]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6696]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6531]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6362]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4508]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4516]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4322]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4320]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4324]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4318]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4408]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4355]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5013]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5965]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5962]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4827]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4337]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4333]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 25042]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 647713]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 647718]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 647717]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 14272]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 30772]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 354868]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 11959]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 31013]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 647913]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 647902]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 40048]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 10088]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5977]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5052]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 31035]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 5050]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 31006]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 31007]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 30633]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 40046]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 35913]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 40047]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 647701]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 608048]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 13237]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 647862]
/classes/Link.php:113 (__construct) [id: 647720]
/classes/Link.php:113 (__construct) [id: 647723]
/classes/Link.php:113 (__construct) [id: 647724]
/classes/Link.php:113 (__construct) [id: 647719]
/classes/Link.php:113 (__construct) [id: 647808]
/classes/Link.php:113 (__construct) [id: 647713]
/classes/Link.php:113 (__construct) [id: 647718]
/classes/Link.php:113 (__construct) [id: 647717]
/classes/Link.php:113 (__construct) [id: 647913]
/classes/Link.php:113 (__construct) [id: 647902]
/classes/Link.php:113 (__construct) [id: 647701]
Country 15 /config/config.inc.php:148 (__construct) [id: 8]
/classes/controller/FrontController.php:946 (__construct) [id: 21]
/classes/AddressFormat.php:404 (__construct) [id: 17]
/classes/controller/FrontController.php:1779 (__construct) [id: 17]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 8]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 8]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 8]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 8]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 8]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 8]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 8]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 19]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 4]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 3]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 186]
Language 13 /config/config.inc.php:213 (__construct) [id: 1]
/classes/Tools.php:560 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
Currency 9 /src/Adapter/Currency/CurrencyDataProvider.php:101 (__construct) [id: 1]
/classes/Tools.php:690 (getCurrencyInstance) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:213 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:213 (__construct) [id: 0]
/modules/gmerchantcenterpro/lib/moduleTools.php:213 (__construct) [id: 0]
/modules/gmerchantcenterpro/lib/moduleTools.php:213 (__construct) [id: 0]
/modules/gmerchantcenterpro/lib/moduleTools.php:213 (__construct) [id: 0]
/modules/gmerchantcenterpro/lib/moduleTools.php:213 (__construct) [id: 0]
/modules/gmerchantcenterpro/lib/moduleTools.php:213 (__construct) [id: 0]
Address 4 /classes/shop/Shop.php:486 (__construct) [id: ]
/classes/Product.php:3694 (initialize) [id: ]
/classes/Product.php:3804 (__construct) [id: ]
/classes/Product.php:5964 (__construct) [id: ]
Cart 2 /classes/controller/FrontController.php:467 (__construct) [id: ]
/classes/controller/FrontController.php:541 (__construct) [id: ]
Shop 1 /config/config.inc.php:119 (initialize) [id: 1]
ShopGroup 1 /classes/shop/Shop.php:561 (__construct) [id: 1]
Customer 1 /config/config.inc.php:266 (__construct) [id: ]
Group 1 /classes/Cart.php:249 (getCurrent) [id: 1]
Gender 1 /classes/controller/FrontController.php:1702 (__construct) [id: 0]
Risk 1 /classes/controller/FrontController.php:1705 (__construct) [id: ]
AddressFormat 1 /classes/controller/FrontController.php:1773 (generateAddress) [id: ]
State 1 /classes/controller/FrontController.php:1778 (__construct) [id: 0]
Category 1 /modules/ps_facetedsearch/src/Filters/Block.php:157 (__construct) [id: 2]

Included Files

# Filename
0 /index.php
1 /config/config.inc.php
2 /config/defines.inc.php
3 /config/autoload.php
4 /vendor/autoload.php
5 /vendor/composer/autoload_real.php
6 /vendor/composer/platform_check.php
7 /vendor/composer/ClassLoader.php
8 /vendor/composer/include_paths.php
9 /vendor/composer/autoload_static.php
10 /vendor/symfony/polyfill-php72/bootstrap.php
11 /vendor/symfony/polyfill-mbstring/bootstrap.php
12 /vendor/symfony/polyfill-mbstring/bootstrap80.php
13 /vendor/symfony/polyfill-intl-normalizer/bootstrap.php
14 /vendor/symfony/polyfill-intl-normalizer/bootstrap80.php
15 /vendor/symfony/polyfill-intl-idn/bootstrap.php
16 /vendor/symfony/deprecation-contracts/function.php
17 /vendor/ralouphie/getallheaders/src/getallheaders.php
18 /vendor/symfony/polyfill-ctype/bootstrap.php
19 /vendor/symfony/polyfill-ctype/bootstrap80.php
20 /vendor/symfony/polyfill-php80/bootstrap.php
21 /vendor/guzzlehttp/promises/src/functions_include.php
22 /vendor/guzzlehttp/promises/src/functions.php
23 /vendor/guzzlehttp/guzzle/src/functions_include.php
24 /vendor/guzzlehttp/guzzle/src/functions.php
25 /vendor/symfony/polyfill-iconv/bootstrap.php
26 /vendor/ezyang/htmlpurifier/library/HTMLPurifier.composer.php
27 /vendor/jakeasmith/http_build_url/src/http_build_url.php
28 /vendor/lcobucci/jwt/compat/class-aliases.php
29 /vendor/lcobucci/jwt/src/Token.php
30 /vendor/lcobucci/jwt/src/Signature.php
31 /vendor/lcobucci/jwt/compat/json-exception-polyfill.php
32 /vendor/lcobucci/jwt/compat/lcobucci-clock-polyfill.php
33 /vendor/swiftmailer/swiftmailer/lib/swift_required.php
34 /vendor/swiftmailer/swiftmailer/lib/classes/Swift.php
35 /vendor/symfony/polyfill-intl-icu/bootstrap.php
36 /vendor/symfony/polyfill-php73/bootstrap.php
37 /vendor/symfony/polyfill-php81/bootstrap.php
38 /vendor/api-platform/core/src/deprecation.php
39 /vendor/api-platform/core/src/Api/FilterInterface.php
40 /vendor/api-platform/core/src/Api/ResourceClassResolverInterface.php
41 /vendor/api-platform/core/src/deprecated_interfaces.php
42 /vendor/api-platform/core/src/Metadata/Property/Factory/PropertyNameCollectionFactoryInterface.php
43 /vendor/api-platform/core/src/Metadata/Resource/Factory/ResourceNameCollectionFactoryInterface.php
44 /vendor/api-platform/core/src/Metadata/Extractor/ResourceExtractorInterface.php
45 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/DateFilterInterface.php
46 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/ExistsFilterInterface.php
47 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/OrderFilterInterface.php
48 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/RangeFilterInterface.php
49 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/SearchFilterInterface.php
50 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationCollectionExtensionInterface.php
51 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationItemExtensionInterface.php
52 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultCollectionExtensionInterface.php
53 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultItemExtensionInterface.php
54 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Filter/FilterInterface.php
55 /vendor/api-platform/core/src/Doctrine/Orm/QueryAwareInterface.php
56 /vendor/api-platform/core/src/Doctrine/Orm/Util/QueryNameGeneratorInterface.php
57 /vendor/api-platform/core/src/Elasticsearch/Metadata/Document/Factory/DocumentMetadataFactoryInterface.php
58 /vendor/api-platform/core/src/Symfony/Validator/ValidationGroupsGeneratorInterface.php
59 /vendor/api-platform/core/src/Symfony/Validator/Exception/ConstraintViolationListAwareExceptionInterface.php
60 /vendor/api-platform/core/src/Exception/ExceptionInterface.php
61 /vendor/api-platform/core/src/Core/Bridge/Symfony/Validator/Metadata/Property/Restriction/PropertySchemaRestrictionMetadataInterface.php
62 /vendor/api-platform/core/src/State/Pagination/PaginatorInterface.php
63 /vendor/api-platform/core/src/State/Pagination/PartialPaginatorInterface.php
64 /vendor/api-platform/core/src/Documentation/DocumentationInterface.php
65 /vendor/api-platform/core/src/JsonLd/AnonymousContextBuilderInterface.php
66 /vendor/api-platform/core/src/JsonLd/ContextBuilderInterface.php
67 /vendor/api-platform/core/src/Core/JsonSchema/SchemaFactoryInterface.php
68 /vendor/api-platform/core/src/JsonSchema/TypeFactoryInterface.php
69 /vendor/api-platform/core/src/OpenApi/Factory/OpenApiFactoryInterface.php
70 /vendor/api-platform/core/src/PathResolver/OperationPathResolverInterface.php
71 /vendor/api-platform/core/src/Symfony/Security/ResourceAccessCheckerInterface.php
72 /vendor/api-platform/core/src/Serializer/Filter/FilterInterface.php
73 /vendor/api-platform/core/src/Serializer/SerializerContextBuilderInterface.php
74 /vendor/api-platform/core/src/Validator/ValidatorInterface.php
75 /vendor/api-platform/core/src/Api/UrlGeneratorInterface.php
76 /vendor/api-platform/core/src/GraphQl/ExecutorInterface.php
77 /vendor/api-platform/core/src/GraphQl/Error/ErrorHandlerInterface.php
78 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ValidateStageInterface.php
79 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ReadStageInterface.php
80 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityPostDenormalizeStageInterface.php
81 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityStageInterface.php
82 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/WriteStageInterface.php
83 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SerializeStageInterface.php
84 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/DeserializeStageInterface.php
85 /vendor/api-platform/core/src/GraphQl/Resolver/QueryItemResolverInterface.php
86 /vendor/api-platform/core/src/GraphQl/Resolver/QueryCollectionResolverInterface.php
87 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Factory/ResolverFactoryInterface.php
88 /vendor/api-platform/core/src/GraphQl/Resolver/MutationResolverInterface.php
89 /vendor/api-platform/core/src/Core/GraphQl/Subscription/MercureSubscriptionIriGeneratorInterface.php
90 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionIdentifierGeneratorInterface.php
91 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionManagerInterface.php
92 /vendor/api-platform/core/src/Core/GraphQl/Serializer/SerializerContextBuilderInterface.php
93 /vendor/api-platform/core/src/GraphQl/Type/TypesFactoryInterface.php
94 /vendor/api-platform/core/src/GraphQl/Type/Definition/TypeInterface.php
95 /vendor/api-platform/core/src/GraphQl/Type/TypesContainerInterface.php
96 /vendor/psr/container/src/ContainerInterface.php
97 /vendor/api-platform/core/src/Operation/PathSegmentNameGeneratorInterface.php
98 /vendor/ircmaxell/password-compat/lib/password.php
99 /vendor/martinlindhe/php-mb-helpers/src/mb_helpers.php
100 /vendor/prestashop/laminas-code-lts/polyfill/ReflectionEnumPolyfill.php
101 /src/Core/Version.php
102 /config/alias.php
103 /vendor/prestashop/autoload/src/PrestashopAutoload.php
104 /vendor/prestashop/autoload/src/LegacyClassLoader.php
105 /vendor/symfony/symfony/src/Symfony/Component/Filesystem/Filesystem.php
106 /vendor/prestashop/autoload/src/Autoloader.php
107 /config/bootstrap.php
108 /src/Core/ContainerBuilder.php
109 /src/Core/Foundation/IoC/Container.php
110 /src/Adapter/ServiceLocator.php
111 /var/cache/prod/appParameters.php
114 /var/cache/prod/class_index.php
115 /classes/controller/Controller.php
117 /classes/ObjectModel.php
118 /src/Core/Foundation/Database/EntityInterface.php
120 /classes/db/Db.php
122 /classes/Hook.php
124 /classes/module/Module.php
125 /src/Core/Module/Legacy/ModuleInterface.php
127 /classes/Tools.php
128 /classes/Context.php
129 /classes/shop/Shop.php
130 /src/Core/Security/PasswordGenerator.php
131 /classes/db/DbPDO.php
132 /classes/AddressFormat.php
133 /classes/cache/Cache.php
134 /classes/cache/CacheMemcached.php
135 /config/db_slave_server.inc.php
136 /src/Core/Security/Hashing.php
137 /classes/Configuration.php
138 /classes/Validate.php
139 /src/Adapter/EntityMapper.php
140 /classes/db/DbQuery.php
141 /src/Core/Addon/Theme/ThemeManagerBuilder.php
142 /vendor/psr/log/Psr/Log/NullLogger.php
143 /vendor/psr/log/Psr/Log/AbstractLogger.php
144 /vendor/psr/log/Psr/Log/LoggerInterface.php
145 /src/Adapter/Configuration.php
146 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ParameterBag.php
147 /src/Core/Domain/Configuration/ShopConfigurationInterface.php
148 /src/Core/ConfigurationInterface.php
149 /src/Core/Addon/Theme/ThemeRepository.php
150 /src/Core/Addon/AddonRepositoryInterface.php
151 /src/Core/Domain/Shop/ValueObject/ShopConstraint.php
152 /src/Core/Addon/Theme/Theme.php
153 /src/Core/Addon/AddonInterface.php
154 /src/Core/Util/ArrayFinder.php
155 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccess.php
156 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorBuilder.php
157 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessor.php
158 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorInterface.php
159 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPath.php
160 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPathInterface.php
161 /config/defines_uri.inc.php
162 /classes/Language.php
163 /src/Core/Language/LanguageInterface.php
164 /classes/Country.php
165 /classes/PrestaShopCollection.php
166 /classes/shop/ShopGroup.php
167 /classes/Cookie.php
168 /classes/PhpEncryption.php
169 /classes/PhpEncryptionEngine.php
170 /vendor/defuse/php-encryption/src/Key.php
171 /vendor/defuse/php-encryption/src/Encoding.php
172 /vendor/defuse/php-encryption/src/Core.php
173 /vendor/defuse/php-encryption/src/Crypto.php
174 /vendor/defuse/php-encryption/src/KeyOrPassword.php
175 /vendor/defuse/php-encryption/src/RuntimeTests.php
176 /vendor/defuse/php-encryption/src/DerivedKeys.php
177 /vendor/defuse/php-encryption/src/Exception/WrongKeyOrModifiedCiphertextException.php
178 /vendor/defuse/php-encryption/src/Exception/CryptoException.php
179 /src/Core/Session/SessionHandler.php
180 /src/Core/Session/SessionHandlerInterface.php
181 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Session.php
182 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBag.php
183 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBagInterface.php
184 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagInterface.php
185 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBag.php
186 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBagInterface.php
187 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagProxy.php
188 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionInterface.php
189 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/PhpBridgeSessionStorage.php
190 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/NativeSessionStorage.php
191 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/MetadataBag.php
192 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/StrictSessionHandler.php
193 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/AbstractSessionHandler.php
194 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/SessionHandlerProxy.php
195 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/AbstractProxy.php
196 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/SessionStorageInterface.php
197 /config/smarty.config.inc.php
198 /vendor/smarty/smarty/libs/Smarty.class.php
199 /vendor/smarty/smarty/libs/functions.php
200 /vendor/smarty/smarty/libs/Autoloader.php
201 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_data.php
202 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_extension_handler.php
203 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php
204 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php
205 /vendor/smarty/smarty/libs/sysplugins/smarty_resource.php
206 /vendor/smarty/smarty/libs/sysplugins/smarty_variable.php
207 /vendor/smarty/smarty/libs/sysplugins/smarty_template_source.php
208 /vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php
209 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_resource_file.php
210 /config/smartyfront.config.inc.php
211 /classes/Smarty/SmartyResourceModule.php
212 /vendor/smarty/smarty/libs/sysplugins/smarty_resource_custom.php
213 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerresource.php
214 /classes/Smarty/SmartyResourceParent.php
215 /classes/Smarty/SmartyLazyRegister.php
216 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerplugin.php
217 /vendor/smarty/smarty/libs/plugins/modifier.truncate.php
218 /classes/Customer.php
219 /classes/Group.php
220 /override/classes/Link.php
221 /classes/Link.php
222 /classes/shop/ShopUrl.php
223 /override/classes/Dispatcher.php
224 /classes/Dispatcher.php
225 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Request.php
226 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeader.php
227 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeaderItem.php
228 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/FileBag.php
229 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderBag.php
230 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderUtils.php
231 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ServerBag.php
232 /src/Adapter/SymfonyContainer.php
233 /vendor/mobiledetect/mobiledetectlib/Mobile_Detect.php
234 /modules/ph_simpleblog/ph_simpleblog.php
235 /modules/ph_simpleblog/assets/phpthumb/ThumbLib.inc.php
236 /modules/ph_simpleblog/assets/phpthumb/PhpThumb.inc.php
237 /modules/ph_simpleblog/assets/phpthumb/ThumbBase.inc.php
238 /modules/ph_simpleblog/assets/phpthumb/GdThumb.inc.php
239 /modules/ph_simpleblog/vendor/autoload.php
240 /modules/ph_simpleblog/vendor/composer/autoload_real.php
241 /modules/ph_simpleblog/vendor/composer/platform_check.php
242 /modules/ph_simpleblog/vendor/composer/autoload_static.php
243 /modules/ph_simpleblog/models/SimpleBlogCategory.php
244 /modules/ph_simpleblog/models/SimpleBlogPost.php
245 /modules/ph_simpleblog/models/SimpleBlogPostType.php
246 /modules/ph_simpleblog/models/SimpleBlogPostImage.php
247 /modules/ph_simpleblog/models/SimpleBlogTag.php
248 /modules/ph_simpleblog/models/SimpleBlogComment.php
249 /modules/ph_simpleblog/models/SimpleBlogPostAuthor.php
250 /modules/ph_simpleblog/classes/SimpleBlogHelper.php
251 /modules/ph_simpleblog/classes/BlogPostsFinder.php
252 /modules/ph_simpleblog/controllers/front/default_list.php
253 /classes/controller/ModuleFrontController.php
254 /override/classes/controller/FrontController.php
255 /classes/controller/FrontController.php
256 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_createdata.php
257 /vendor/smarty/smarty/libs/sysplugins/smarty_data.php
258 /classes/Translate.php
259 /modules/ph_simpleblog/translations/fr.php
260 /src/PrestaShopBundle/Translation/TranslatorComponent.php
261 /vendor/symfony/symfony/src/Symfony/Component/Translation/Translator.php
262 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorInterface.php
263 /vendor/symfony/contracts/Translation/LocaleAwareInterface.php
264 /vendor/symfony/contracts/Translation/TranslatorInterface.php
265 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorBagInterface.php
266 /src/PrestaShopBundle/Translation/PrestaShopTranslatorTrait.php
267 /src/PrestaShopBundle/Translation/TranslatorLanguageTrait.php
268 /src/PrestaShopBundle/Translation/TranslatorInterface.php
269 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatter.php
270 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatter.php
271 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatterInterface.php
272 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatterInterface.php
273 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/ChoiceMessageFormatterInterface.php
274 /vendor/symfony/symfony/src/Symfony/Component/Translation/IdentityTranslator.php
275 /vendor/symfony/contracts/Translation/TranslatorTrait.php
276 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactory.php
277 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactoryInterface.php
278 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCache.php
279 /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerConfigCache.php
280 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheInterface.php
281 /var/cache/prod/translations/catalogue.fr-FR.NXhscRe.php
282 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogue.php
283 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogueInterface.php
284 /vendor/symfony/symfony/src/Symfony/Component/Translation/MetadataAwareInterface.php
285 /controllers/front/listing/PricesDropController.php
286 /classes/controller/ProductListingFrontController.php
287 /classes/controller/ProductPresentingFrontController.php
288 /src/Adapter/Presenter/Object/ObjectPresenter.php
289 /src/Adapter/Presenter/PresenterInterface.php
290 /src/Adapter/Presenter/Cart/CartPresenter.php
291 /src/Adapter/Image/ImageRetriever.php
292 /classes/tax/TaxConfiguration.php
293 /classes/Smarty/TemplateFinder.php
294 /classes/assets/StylesheetManager.php
295 /classes/assets/AbstractAssetManager.php
296 /src/Adapter/Assets/AssetUrlGeneratorTrait.php
297 /classes/assets/JavascriptManager.php
298 /classes/assets/CccReducer.php
299 /modules/iqitthemeeditor/iqitthemeeditor.php
300 /modules/iqitthemeeditor/src/IqitSmartyModifiers.php
301 /modules/iqitthemeeditor/translations/fr.php
302 /src/Adapter/ContainerBuilder.php
303 /src/Adapter/Environment.php
304 /src/Core/EnvironmentInterface.php
305 /vendor/symfony/symfony/src/Symfony/Component/Cache/DoctrineProvider.php
306 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/CacheProvider.php
307 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Cache.php
308 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/FlushableCache.php
309 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/ClearableCache.php
310 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiOperationCache.php
311 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiGetCache.php
312 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiDeleteCache.php
313 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiPutCache.php
314 /vendor/symfony/symfony/src/Symfony/Component/Cache/PruneableInterface.php
315 /vendor/symfony/symfony/src/Symfony/Component/Cache/ResettableInterface.php
316 /vendor/symfony/contracts/Service/ResetInterface.php
317 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/ArrayAdapter.php
318 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ArrayTrait.php
319 /vendor/psr/log/Psr/Log/LoggerAwareTrait.php
320 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AdapterInterface.php
321 /vendor/symfony/symfony/src/Symfony/Component/Cache/CacheItem.php
322 /vendor/symfony/contracts/Cache/ItemInterface.php
323 /vendor/psr/cache/src/CacheItemInterface.php
324 /vendor/psr/cache/src/CacheItemPoolInterface.php
325 /vendor/symfony/contracts/Cache/CacheInterface.php
326 /vendor/psr/log/Psr/Log/LoggerAwareInterface.php
327 /vendor/doctrine/orm/lib/Doctrine/ORM/Tools/Setup.php
328 /vendor/doctrine/deprecations/lib/Doctrine/Deprecations/Deprecation.php
329 /vendor/doctrine/orm/lib/Doctrine/ORM/Configuration.php
330 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Configuration.php
331 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/CacheAdapter.php
332 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/DoctrineProvider.php
333 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationReader.php
334 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Reader.php
335 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationRegistry.php
336 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/DoctrineAnnotations.php
337 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Annotation.php
338 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Entity.php
339 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embeddable.php
340 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embedded.php
341 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/MappedSuperclass.php
342 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/InheritanceType.php
343 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorColumn.php
344 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorMap.php
345 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Id.php
346 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/GeneratedValue.php
347 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Version.php
348 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumn.php
349 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumns.php
350 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Column.php
351 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToOne.php
352 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToMany.php
353 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToOne.php
354 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToMany.php
355 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Table.php
356 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/UniqueConstraint.php
357 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Index.php
358 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinTable.php
359 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SequenceGenerator.php
360 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/CustomIdGenerator.php
361 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ChangeTrackingPolicy.php
362 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OrderBy.php
363 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQueries.php
364 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQuery.php
365 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/HasLifecycleCallbacks.php
366 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PrePersist.php
367 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostPersist.php
368 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreUpdate.php
369 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostUpdate.php
370 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreRemove.php
371 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostRemove.php
372 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostLoad.php
373 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreFlush.php
374 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/FieldResult.php
375 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ColumnResult.php
376 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityResult.php
377 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQuery.php
378 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQueries.php
379 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMapping.php
380 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMappings.php
381 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverride.php
382 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverrides.php
383 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverride.php
384 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverrides.php
385 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityListeners.php
386 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Cache.php
387 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/SimpleAnnotationReader.php
388 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocParser.php
389 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocLexer.php
390 /vendor/doctrine/lexer/lib/Doctrine/Common/Lexer/AbstractLexer.php
391 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Target.php
392 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/AnnotationDriver.php
393 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/CompatibilityAnnotationDriver.php
394 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/MappingDriver.php
395 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/ColocatedMappingDriver.php
396 /var/cache/prod/FrontContainer.php
397 /src/Adapter/Container/LegacyContainer.php
398 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Container.php
399 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/RewindableGenerator.php
400 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/ServiceLocator.php
401 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ServiceLocator.php
402 /vendor/symfony/contracts/Service/ServiceLocatorTrait.php
403 /vendor/psr/container/src/ContainerExceptionInterface.php
404 /vendor/psr/container/src/NotFoundExceptionInterface.php
405 /vendor/symfony/contracts/Service/ServiceProviderInterface.php
406 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ResettableContainerInterface.php
407 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ContainerInterface.php
408 /src/Adapter/Container/LegacyContainerInterface.php
409 /modules/ps_categorytree/vendor/autoload.php
410 /modules/ps_categorytree/vendor/composer/autoload_real.php
411 /modules/ps_categorytree/vendor/composer/platform_check.php
412 /modules/ps_categorytree/vendor/composer/autoload_static.php
413 /modules/ps_facetedsearch/vendor/autoload.php
414 /modules/ps_facetedsearch/vendor/composer/autoload_real.php
415 /modules/ps_facetedsearch/vendor/composer/platform_check.php
416 /modules/ps_facetedsearch/vendor/composer/autoload_static.php
417 /modules/contactform/vendor/autoload.php
418 /modules/contactform/vendor/composer/autoload_real.php
419 /modules/contactform/vendor/composer/platform_check.php
420 /modules/contactform/vendor/composer/autoload_static.php
421 /modules/ps_sharebuttons/vendor/autoload.php
422 /modules/ps_sharebuttons/vendor/composer/autoload_real.php
423 /modules/ps_sharebuttons/vendor/composer/platform_check.php
424 /modules/ps_sharebuttons/vendor/composer/autoload_static.php
425 /modules/gsitemap/vendor/autoload.php
426 /modules/gsitemap/vendor/composer/autoload_real.php
427 /modules/gsitemap/vendor/composer/platform_check.php
428 /modules/gsitemap/vendor/composer/autoload_static.php
429 /modules/ps_crossselling/vendor/autoload.php
430 /modules/ps_crossselling/vendor/composer/autoload_real.php
431 /modules/ps_crossselling/vendor/composer/platform_check.php
432 /modules/ps_crossselling/vendor/composer/autoload_static.php
433 /modules/ps_themecusto/vendor/autoload.php
434 /modules/ps_themecusto/vendor/composer/autoload_real.php
435 /modules/ps_themecusto/vendor/composer/platform_check.php
436 /modules/ps_themecusto/vendor/composer/autoload_static.php
437 /modules/ps_supplierlist/vendor/autoload.php
438 /modules/ps_supplierlist/vendor/composer/autoload_real.php
439 /modules/ps_supplierlist/vendor/composer/platform_check.php
440 /modules/ps_supplierlist/vendor/composer/autoload_static.php
441 /modules/ps_googleanalytics/vendor/autoload.php
442 /modules/ps_googleanalytics/vendor/composer/autoload_real.php
443 /modules/ps_googleanalytics/vendor/composer/platform_check.php
444 /modules/ps_googleanalytics/vendor/composer/autoload_static.php
445 /modules/statssearch/vendor/autoload.php
446 /modules/statssearch/vendor/composer/autoload_real.php
447 /modules/statssearch/vendor/composer/platform_check.php
448 /modules/statssearch/vendor/composer/autoload_static.php
449 /modules/ps_faviconnotificationbo/vendor/autoload.php
450 /modules/ps_faviconnotificationbo/vendor/composer/autoload_real.php
451 /modules/ps_faviconnotificationbo/vendor/composer/platform_check.php
452 /modules/ps_faviconnotificationbo/vendor/composer/autoload_static.php
453 /modules/ps_categoryproducts/vendor/autoload.php
454 /modules/ps_categoryproducts/vendor/composer/autoload_real.php
455 /modules/ps_categoryproducts/vendor/composer/platform_check.php
456 /modules/ps_categoryproducts/vendor/composer/autoload_static.php
457 /modules/ps_wirepayment/vendor/autoload.php
458 /modules/ps_wirepayment/vendor/composer/autoload_real.php
459 /modules/ps_wirepayment/vendor/composer/platform_check.php
460 /modules/ps_wirepayment/vendor/composer/autoload_static.php
461 /modules/statsregistrations/vendor/autoload.php
462 /modules/statsregistrations/vendor/composer/autoload_real.php
463 /modules/statsregistrations/vendor/composer/platform_check.php
464 /modules/statsregistrations/vendor/composer/autoload_static.php
465 /modules/ps_distributionapiclient/vendor/autoload.php
466 /modules/ps_distributionapiclient/vendor/composer/autoload_real.php
467 /modules/ps_distributionapiclient/vendor/composer/platform_check.php
468 /modules/ps_distributionapiclient/vendor/composer/autoload_static.php
469 /modules/ps_distributionapiclient/vendor/symfony/polyfill-intl-grapheme/bootstrap.php
470 /modules/ps_distributionapiclient/vendor/symfony/string/Resources/functions.php
471 /modules/ps_emailalerts/vendor/autoload.php
472 /modules/ps_emailalerts/vendor/composer/autoload_real.php
473 /modules/ps_emailalerts/vendor/composer/platform_check.php
474 /modules/ps_emailalerts/vendor/composer/autoload_static.php
475 /modules/ps_brandlist/vendor/autoload.php
476 /modules/ps_brandlist/vendor/composer/autoload_real.php
477 /modules/ps_brandlist/vendor/composer/platform_check.php
478 /modules/ps_brandlist/vendor/composer/autoload_static.php
479 /modules/ps_viewedproduct/vendor/autoload.php
480 /modules/ps_viewedproduct/vendor/composer/autoload_real.php
481 /modules/ps_viewedproduct/vendor/composer/platform_check.php
482 /modules/ps_viewedproduct/vendor/composer/autoload_static.php
483 /modules/iqitsociallogin/vendor/autoload.php
484 /modules/iqitsociallogin/vendor/composer/autoload_real.php
485 /modules/iqitsociallogin/vendor/composer/platform_check.php
486 /modules/iqitsociallogin/vendor/composer/autoload_static.php
487 /modules/gmerchantcenterpro/vendor/autoload.php
488 /modules/gmerchantcenterpro/vendor/composer/autoload_real.php
489 /modules/gmerchantcenterpro/vendor/composer/platform_check.php
490 /modules/gmerchantcenterpro/vendor/composer/autoload_static.php
491 /modules/wizardai/vendor/autoload.php
492 /modules/wizardai/vendor/composer/autoload_real.php
493 /modules/wizardai/vendor/composer/platform_check.php
494 /modules/wizardai/vendor/composer/autoload_static.php
495 /modules/wizardai/vendor/clue/stream-filter/src/functions_include.php
496 /modules/wizardai/vendor/clue/stream-filter/src/functions.php
497 /modules/wizardai/vendor/guzzlehttp/psr7/src/functions_include.php
498 /modules/wizardai/vendor/guzzlehttp/psr7/src/functions.php
499 /modules/wizardai/vendor/php-http/message/src/filters.php
500 /modules/wizardai/vendor/symfony/polyfill-apcu/bootstrap.php
501 /modules/stripe_official/vendor/autoload.php
502 /modules/stripe_official/vendor/composer/autoload_real.php
503 /modules/stripe_official/vendor/composer/platform_check.php
504 /modules/stripe_official/vendor/composer/autoload_static.php
505 /modules/vivawalletsmartcheckout/vendor/autoload.php
506 /modules/vivawalletsmartcheckout/vendor/composer/autoload_real.php
507 /modules/vivawalletsmartcheckout/vendor/composer/autoload_static.php
508 /modules/autoupgrade/vendor/autoload.php
509 /modules/autoupgrade/vendor/composer/autoload_real.php
510 /modules/autoupgrade/vendor/composer/autoload_static.php
511 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment.php
512 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Client.php
513 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer.php
514 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/QueueConsumer.php
515 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/File.php
516 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/ForkCurl.php
517 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/LibCurl.php
518 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/Socket.php
519 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Version.php
520 /src/Core/Localization/Locale/Repository.php
521 /src/Core/Localization/Locale/RepositoryInterface.php
522 /src/Core/Localization/CLDR/LocaleRepository.php
523 /src/Core/Localization/CLDR/LocaleDataSource.php
524 /src/Core/Localization/CLDR/DataLayer/LocaleCache.php
525 /src/Core/Data/Layer/AbstractDataLayer.php
526 /src/Core/Localization/CLDR/LocaleDataLayerInterface.php
527 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/FilesystemAdapter.php
528 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AbstractAdapter.php
529 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractAdapterTrait.php
530 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractTrait.php
531 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ContractsTrait.php
532 /vendor/symfony/contracts/Cache/CacheTrait.php
533 /vendor/psr/cache/src/InvalidArgumentException.php
534 /vendor/psr/cache/src/CacheException.php
535 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemTrait.php
536 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemCommonTrait.php
537 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/DefaultMarshaller.php
538 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/MarshallerInterface.php
539 /src/Core/Localization/CLDR/DataLayer/LocaleReference.php
540 /src/Core/Localization/CLDR/Reader.php
541 /src/Core/Localization/CLDR/ReaderInterface.php
542 /src/Core/Localization/Currency/Repository.php
543 /src/Core/Localization/Currency/RepositoryInterface.php
544 /src/Core/Localization/Currency/CurrencyDataSource.php
545 /src/Core/Localization/Currency/DataSourceInterface.php
546 /src/Core/Localization/Currency/DataLayer/CurrencyCache.php
547 /src/Core/Localization/Currency/CurrencyDataLayerInterface.php
548 /src/Core/Localization/Currency/DataLayer/CurrencyDatabase.php
549 /src/Adapter/Currency/CurrencyDataProvider.php
550 /src/Core/Currency/CurrencyDataProviderInterface.php
551 /src/Adapter/LegacyContext.php
552 /src/Adapter/Tools.php
553 /src/Core/Localization/Currency/DataLayer/CurrencyReference.php
554 /src/Core/Localization/Currency/DataLayer/CurrencyInstalled.php
555 /vendor/prestashop/decimal/src/Operation/Rounding.php
556 /src/Core/Localization/Locale.php
557 /src/Core/Localization/LocaleInterface.php
558 /src/Core/Localization/Specification/Price.php
559 /src/Core/Localization/Specification/Number.php
560 /src/Core/Localization/Specification/NumberInterface.php
561 /src/Core/Localization/Specification/Factory.php
562 /src/Core/Localization/CLDR/LocaleData.php
563 /src/Core/Localization/CLDR/NumberSymbolsData.php
564 /src/Core/Localization/CLDR/CurrencyData.php
565 /src/Core/Localization/CLDR/Locale.php
566 /src/Core/Localization/CLDR/LocaleInterface.php
567 /src/Core/Localization/Specification/NumberSymbolList.php
568 /classes/Currency.php
569 /src/Core/Localization/Currency/LocalizedCurrencyId.php
570 /classes/webservice/WebserviceRequest.php
571 /src/Core/Localization/Currency/CurrencyData.php
572 /src/Core/Localization/Currency/CurrencyCollection.php
573 /src/Core/Localization/Currency.php
574 /src/Core/Localization/CurrencyInterface.php
575 /src/Core/Localization/Specification/NumberCollection.php
576 /src/Core/Localization/Number/Formatter.php
577 /classes/Cart.php
578 /src/Adapter/AddressFactory.php
579 /override/classes/CartRule.php
580 /classes/CartRule.php
581 /classes/Product.php
582 /src/Core/Domain/Product/ValueObject/RedirectType.php
583 /src/Core/Util/DateTime/DateTime.php
584 /src/Core/Domain/Product/Stock/ValueObject/OutOfStockType.php
585 /src/Core/Domain/Product/Pack/ValueObject/PackStockType.php
586 /src/Core/Domain/Product/ValueObject/ProductType.php
587 /src/Core/Domain/Product/ValueObject/Reference.php
588 /src/Core/Domain/Product/ValueObject/Ean13.php
589 /src/Core/Domain/Product/ValueObject/Isbn.php
590 /src/Core/Domain/Product/ValueObject/Upc.php
591 /src/Core/Domain/Product/ProductSettings.php
592 /src/Core/Domain/Shop/ValueObject/ShopId.php
593 /src/Core/Domain/Shop/ValueObject/ShopIdInterface.php
594 /modules/ps_emailalerts/ps_emailalerts.php
595 /modules/ps_emailalerts/MailAlert.php
596 /src/PrestaShopBundle/Translation/DomainNormalizer.php
597 /modules/facebookconversiontrackingplus/facebookconversiontrackingplus.php
598 /modules/facebookconversiontrackingplus/classes/autoload.php
599 /modules/facebookconversiontrackingplus/translations/fr.php
600 /modules/facebookconversiontrackingplus/classes/ConversionApi.php
601 /modules/facebookconversiontrackingplus/classes/PixelTools.php
602 /modules/facebookconversiontrackingplus/classes/IpGeolocation.php
603 /src/Core/Security/OpenSsl/OpenSSL.php
604 /src/Core/Security/OpenSsl/OpenSSLInterface.php
605 /modules/facebookconversiontrackingplus/classes/SmartForm.php
606 /override/classes/Media.php
607 /classes/Media.php
608 /modules/revolutpayment/revolutpayment.php
609 /modules/revolutpayment/classes/RevolutApi.php
610 /modules/revolutpayment/classes/RevolutDatabaseHelper.php
611 /modules/revolutpayment/classes/RevolutPRBSettingsHelper.php
612 /modules/revolutpayment/classes/RevolutApplePayOnBoardingHelper.php
613 /modules/revolutpayment/classes/RevolutModuleHelper.php
614 /classes/PaymentModule.php
615 /modules/revolutpayment/translations/fr.php
616 /src/Adapter/Presenter/Cart/CartLazyArray.php
617 /src/Adapter/Presenter/AbstractLazyArray.php
618 /src/Adapter/Product/PriceFormatter.php
619 /src/Core/Util/Inflector.php
620 /vendor/doctrine/inflector/lib/Doctrine/Inflector/InflectorFactory.php
621 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Language.php
622 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/InflectorFactory.php
623 /vendor/doctrine/inflector/lib/Doctrine/Inflector/GenericLanguageInflectorFactory.php
624 /vendor/doctrine/inflector/lib/Doctrine/Inflector/LanguageInflectorFactory.php
625 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Rules.php
626 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Ruleset.php
627 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformations.php
628 /vendor/doctrine/inflector/lib/Doctrine/Inflector/WordInflector.php
629 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Inflectible.php
630 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformation.php
631 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Pattern.php
632 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Patterns.php
633 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Uninflected.php
634 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitutions.php
635 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitution.php
636 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Word.php
637 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Inflector.php
638 /vendor/doctrine/inflector/lib/Doctrine/Inflector/CachedWordInflector.php
639 /vendor/doctrine/inflector/lib/Doctrine/Inflector/RulesetInflector.php
640 /classes/Gender.php
641 /classes/Risk.php
642 /classes/Meta.php
643 /modules/revsliderprestashop/revsliderprestashop.php
644 /modules/revsliderprestashop/rev-loader.php
645 /modules/revsliderprestashop/includes/revslider_db.class.php
646 /modules/revsliderprestashop/includes/data.class.php
647 /modules/revsliderprestashop/includes/functions.class.php
648 /modules/revsliderprestashop/includes/em-integration.class.php
649 /modules/revsliderprestashop/includes/cssparser.class.php
650 /modules/revsliderprestashop/includes/woocommerce.class.php
651 /modules/revsliderprestashop/includes/wpml.class.php
652 /modules/revsliderprestashop/includes/colorpicker.class.php
653 /modules/revsliderprestashop/includes/navigation.class.php
654 /modules/revsliderprestashop/includes/object-library.class.php
655 /modules/revsliderprestashop/admin/includes/loadbalancer.class.php
656 /modules/revsliderprestashop/admin/includes/plugin-update.class.php
657 /modules/revsliderprestashop/includes/extension.class.php
658 /modules/revsliderprestashop/includes/favorite.class.php
659 /modules/revsliderprestashop/includes/aq-resizer.class.php
660 /modules/revsliderprestashop/includes/external-sources.class.php
661 /modules/revsliderprestashop/includes/page-template.class.php
662 /modules/revsliderprestashop/includes/slider.class.php
663 /modules/revsliderprestashop/includes/slide.class.php
664 /modules/revsliderprestashop/includes/output.class.php
665 /modules/revsliderprestashop/public/revslider-front.class.php
666 /modules/revsliderprestashop/includes/backwards.php
667 /modules/revsliderprestashop/admin/includes/class-pclzip.php
668 /modules/revsliderprestashop/admin/includes/license.class.php
669 /modules/revsliderprestashop/admin/includes/addons.class.php
670 /modules/revsliderprestashop/admin/includes/template.class.php
671 /modules/revsliderprestashop/admin/includes/functions-admin.class.php
672 /modules/revsliderprestashop/admin/includes/folder.class.php
673 /modules/revsliderprestashop/admin/includes/import.class.php
674 /modules/revsliderprestashop/admin/includes/export.class.php
675 /modules/revsliderprestashop/admin/includes/export-html.class.php
676 /modules/revsliderprestashop/admin/includes/newsletter.class.php
677 /modules/revsliderprestashop/admin/revslider-admin.class.php
678 /modules/revsliderprestashop/includes/update.class.php
679 /modules/revsliderprestashop/includes/resize-imag.php
680 /modules/revsliderprestashop/translations/fr.php
681 /classes/Address.php
682 /classes/ImageType.php
683 /classes/State.php
684 /src/Core/Security/PasswordPolicyConfiguration.php
685 /src/Core/Configuration/DataConfigurationInterface.php
686 /src/Core/Filter/FrontEndObject/MainFilter.php
687 /src/Core/Filter/FilterInterface.php
688 /src/Core/Filter/FrontEndObject/CartFilter.php
689 /src/Core/Filter/HashMapWhitelistFilter.php
690 /src/Core/Filter/CollectionFilter.php
691 /src/Core/Filter/FrontEndObject/ProductFilter.php
692 /src/Core/Filter/FrontEndObject/EmbeddedAttributesFilter.php
693 /src/Core/Filter/FrontEndObject/CustomerFilter.php
694 /src/Core/Filter/FrontEndObject/ShopFilter.php
695 /src/Core/Filter/FrontEndObject/ConfigurationFilter.php
696 /modules/ps_shoppingcart/ps_shoppingcart.php
697 /src/Core/Module/WidgetInterface.php
698 /modules/ps_googleanalytics/ps_googleanalytics.php
699 /modules/ps_googleanalytics/classes/Hook/HookDisplayHeader.php
700 /modules/ps_googleanalytics/classes/Hook/HookInterface.php
701 /vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php
702 /var/cache/prod/smarty/compile/warehouse/ee/78/8a/ee788a7ffa4b95e0a488ef6dc4b9f3c8b40ce111_2.file.ps_googleanalytics.tpl.php
703 /vendor/smarty/smarty/libs/plugins/modifier.escape.php
704 /modules/iqitcompare/iqitcompare.php
705 /modules/iqitcompare/translations/fr.php
706 /modules/iqitcontactpage/iqitcontactpage.php
707 /modules/iqitcontactpage/translations/fr.php
708 /modules/iqitcookielaw/iqitcookielaw.php
709 /modules/iqitcookielaw/translations/fr.php
710 /modules/iqitcountdown/iqitcountdown.php
711 /modules/iqitcountdown/translations/fr.php
712 /modules/iqitelementor/iqitelementor.php
713 /modules/iqitelementor/src/IqitElementorLanding.php
714 /modules/iqitelementor/src/IqitElementorTemplate.php
715 /modules/iqitelementor/src/IqitElementorProduct.php
716 /modules/iqitelementor/src/IqitElementorCategory.php
717 /modules/iqitelementor/src/IqitElementorContent.php
718 /modules/iqitelementor/src/iqitElementorWpHelper.php
719 /modules/iqitelementor/includes/plugin-elementor.php
720 /modules/iqitelementor/src/widgets/IqitElementorWidget_Brands.php
721 /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsList.php
722 /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsListTabs.php
723 /modules/iqitelementor/src/widgets/IqitElementorWidget_Modules.php
724 /modules/iqitelementor/src/widgets/IqitElementorWidget_CustomTpl.php
725 /modules/iqitelementor/src/widgets/IqitElementorWidget_Menu.php
726 /modules/iqitelementor/src/widgets/IqitElementorWidget_RevolutionSlider.php
727 /modules/iqitelementor/src/widgets/IqitElementorWidget_Newsletter.php
728 /modules/iqitelementor/src/widgets/IqitElementorWidget_Blog.php
729 /modules/iqitelementor/src/widgets/IqitElementorWidget_Search.php
730 /modules/iqitelementor/src/widgets/IqitElementorWidget_Links.php
731 /modules/iqitelementor/src/widgets/IqitElementorWidget_ContactForm.php
732 /modules/iqitelementor/translations/fr.php
733 /modules/iqitfreedeliverycount/iqitfreedeliverycount.php
734 /modules/iqitfreedeliverycount/translations/fr.php
735 /modules/iqitmegamenu/iqitmegamenu.php
736 /modules/iqitmegamenu/models/IqitMenuTab.php
737 /modules/iqitmegamenu/models/IqitMenuHtml.php
738 /modules/iqitmegamenu/models/IqitMenuLinks.php
739 /modules/iqitmegamenu/translations/fr.php
740 /modules/iqitsizecharts/iqitsizecharts.php
741 /modules/iqitsizecharts/src/IqitSizeCharts.php
742 /modules/iqitsizecharts/translations/fr.php
743 /modules/iqitwishlist/iqitwishlist.php
744 /modules/iqitwishlist/src/IqitWishlistProduct.php
745 /modules/iqitwishlist/translations/fr.php
746 /modules/iqitextendedproduct/iqitextendedproduct.php
747 /modules/iqitextendedproduct/src/IqitThreeSixty.php
748 /modules/iqitextendedproduct/src/IqitProductVideo.php
749 /modules/iqitextendedproduct/translations/fr.php
750 /classes/assets/PrestashopAssetsLibraries.php
751 /modules/iqitsociallogin/iqitsociallogin.php
752 /modules/iqitsociallogin/translations/fr.php
753 /modules/gmerchantcenterpro/gmerchantcenterpro.php
754 /modules/gmerchantcenterpro/translations/fr.php
755 /modules/gmerchantcenterpro/lib/moduleTools.php
756 /modules/gmerchantcenterpro/conf/moduleConfiguration.php
757 /modules/gmerchantcenterpro/lib/moduleUpdate.php
758 /modules/gmerchantcenterpro/lib/install/installController.php
759 /modules/gmerchantcenterpro/lib/install/installSql.php
760 /modules/gmerchantcenterpro/lib/install/installInterface.php
761 /modules/gmerchantcenterpro/models/Feeds.php
762 /modules/gmerchantcenterpro/lib/hook/hookController.php
763 /modules/gmerchantcenterpro/lib/hook/hookDisplay.php
764 /modules/gmerchantcenterpro/lib/hook/hookBase.php
765 /modules/gmerchantcenterpro/lib/dao/moduleDao.php
766 /var/cache/prod/smarty/compile/warehouse/f7/5f/75/f75f75b788ebecd0995da205f357ac74693f8076_2.file.header.tpl.php
767 /modules/stripe_official/stripe_official.php
768 /modules/stripe_official/vendor/stripe/stripe-php/lib/Event.php
769 /modules/stripe_official/vendor/stripe/stripe-php/lib/ApiResource.php
770 /modules/stripe_official/vendor/stripe/stripe-php/lib/StripeObject.php
771 /modules/stripe_official/vendor/stripe/stripe-php/lib/ApiOperations/Request.php
772 /modules/stripe_official/classes/services/PrestashopTranslationService.php
773 /src/Adapter/Localization/LegacyTranslator.php
774 /modules/stripe_official/smarty/plugins/modifier.stripelreplace.php
775 /modules/stripe_official/vendor/stripe/stripe-php/lib/Stripe.php
776 /modules/stripe_official/vendor/stripe/stripe-php/lib/Util/ApiVersion.php
777 /modules/wizardai/vendor/prestashop/module-lib-service-container/src/DependencyInjection/ServiceContainer.php
778 /modules/stripe_official/classes/services/StripeDisplayHeaderService.php
779 /modules/abandonedcart/abandonedcart.php
780 /modules/abandonedcart/classes/abandonedcart_core.php
781 /modules/abandonedcart/translations/fr.php
782 /var/cache/prod/smarty/compile/warehouse/7f/09/a0/7f09a045a9b3f592faaac1a3835665419330db11_2.file.abandonedcart_front.tpl.php
783 /modules/vivawalletsmartcheckout/vivawalletsmartcheckout.php
784 /modules/vivawalletsmartcheckout/src/Helpers/Config.php
785 /modules/vivawalletsmartcheckout/config/app.php
786 /modules/vivawalletsmartcheckout/src/Helpers/General.php
787 /modules/vivawalletsmartcheckout/translations/fr.php
788 /modules/vivawalletsmartcheckout/vendor/vivawallet/vivawallet-php/lib/Application.php
789 /src/Core/Product/Search/ProductSearchContext.php
790 /src/Core/Product/Search/ProductSearchQuery.php
791 /src/Core/Product/Search/SortOrder.php
792 /modules/ps_facetedsearch/ps_facetedsearch.php
793 /modules/ps_facetedsearch/src/HookDispatcher.php
794 /modules/ps_facetedsearch/src/Hook/Attribute.php
795 /modules/ps_facetedsearch/src/Hook/AbstractHook.php
796 /modules/ps_facetedsearch/src/Hook/AttributeGroup.php
797 /modules/ps_facetedsearch/src/Hook/Category.php
798 /modules/ps_facetedsearch/src/Hook/Configuration.php
799 /modules/ps_facetedsearch/src/Hook/Design.php
800 /modules/ps_facetedsearch/src/Hook/Feature.php
801 /modules/ps_facetedsearch/src/Form/Feature/FormModifier.php
802 /modules/ps_facetedsearch/src/Form/Feature/FormDataProvider.php
803 /modules/ps_facetedsearch/src/Hook/FeatureValue.php
804 /modules/ps_facetedsearch/src/Form/FeatureValue/FormModifier.php
805 /modules/ps_facetedsearch/src/Form/FeatureValue/FormDataProvider.php
806 /modules/ps_facetedsearch/src/Hook/Product.php
807 /modules/ps_facetedsearch/src/Hook/ProductSearch.php
808 /modules/ps_facetedsearch/src/Hook/SpecificPrice.php
809 /modules/ps_facetedsearch/src/Filters/Provider.php
810 /modules/ps_facetedsearch/src/URLSerializer.php
811 /modules/ps_facetedsearch/src/Filters/DataAccessor.php
812 /modules/ps_facetedsearch/src/Product/SearchProvider.php
813 /src/Core/Product/Search/FacetsRendererInterface.php
814 /src/Core/Product/Search/ProductSearchProviderInterface.php
815 /modules/ps_facetedsearch/src/Filters/Converter.php
816 /modules/ps_facetedsearch/src/Product/SearchFactory.php
817 /src/Core/Product/Search/ProductSearchResult.php
818 /modules/ps_facetedsearch/src/Product/Search.php
819 /modules/ps_facetedsearch/src/Adapter/MySQL.php
820 /modules/ps_facetedsearch/src/Adapter/AbstractAdapter.php
821 /modules/ps_facetedsearch/src/Adapter/InterfaceAdapter.php
822 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ArrayCollection.php
823 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Collection.php
824 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ReadableCollection.php
825 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Selectable.php
826 /modules/ps_facetedsearch/src/Filters/Products.php
827 /classes/stock/StockAvailable.php
828 /modules/ps_facetedsearch/src/Filters/Block.php
829 /classes/Category.php
830 /modules/ps_facetedsearch/src/Definition/Availability.php
831 /src/Core/Product/Search/Facet.php
832 /src/Core/Product/Search/Filter.php
833 /vendor/prestashop/decimal/src/DecimalNumber.php
834 /vendor/prestashop/decimal/src/Builder.php
835 /src/Core/Product/Search/FacetCollection.php
836 /classes/ProductAssembler.php
837 /classes/Combination.php
838 /classes/tax/Tax.php
839 /classes/Manufacturer.php
840 /classes/SpecificPrice.php
841 /classes/tax/TaxManagerFactory.php
842 /classes/tax/TaxRulesTaxManager.php
843 /classes/tax/TaxManagerInterface.php
844 /classes/tax/TaxCalculator.php
845 /classes/GroupReduction.php
846 /src/Core/Localization/CLDR/ComputingPrecision.php
847 /src/Core/Localization/CLDR/ComputingPrecisionInterface.php
848 /classes/Pack.php
849 /override/classes/order/Order.php
850 /classes/order/Order.php
851 /classes/Feature.php
852 /classes/ProductPresenterFactory.php
853 /src/Adapter/Presenter/Product/ProductListingPresenter.php
854 /src/Adapter/Presenter/Product/ProductPresenter.php
855 /src/Adapter/Product/ProductColorsRetriever.php
856 /src/Adapter/HookManager.php
857 /src/Core/Product/ProductPresentationSettings.php
858 /src/Adapter/Presenter/Product/ProductListingLazyArray.php
859 /src/Adapter/Presenter/Product/ProductLazyArray.php
860 /classes/Image.php
861 /src/Core/Image/ImageFormatConfiguration.php
862 /src/Core/Image/ImageFormatConfigurationInterface.php
863 /classes/FeatureFlag.php
864 /src/Core/FeatureFlag/FeatureFlagSettings.php
865 /vendor/prestashop/decimal/src/Operation/Multiplication.php
866 /vendor/prestashop/decimal/src/Operation/Addition.php
867 /var/cache/prod/smarty/compile/warehouse/d4/1d/65/d41d65d76b9471b5d365fe06cf1737c89a53af9f_2.module.ps_facetedsearchviewstemplatesfrontcatalogfacets.tpl.php
868 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_block.php
869 /vendor/smarty/smarty/libs/plugins/modifier.count.php
870 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php
871 /var/cache/prod/smarty/compile/warehouse/fb/ea/98/fbea98a84e509d7477392fb3e2519b1e908ae1d0_2.module.ps_facetedsearchviewstemplatesfrontcatalogfacetsdropdown.tpl.php
872 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_foreach.php
873 /var/cache/prod/smarty/compile/warehouse/2e/80/73/2e807335546cfa2360c36327ac89dd2fcb054379_2.module.ps_facetedsearchviewstemplatesfrontcatalogactivefilters.tpl.php
874 /src/Core/Product/Search/Pagination.php
875 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/ed/b5/3f/edb53f222ce1fd2513bbdc5d9fc4357d962657b5_2.file.prices-drop.tpl.php
876 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/90/cf/46/90cf4679dc49439c314d4747bbab91e7cd883211_2.file.product-list.tpl.php
877 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/20/1d/59/201d594b12ddb0579e97d2d00a38f32349d7f8e2_2.file.layout-full-width.tpl.php
878 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/9f/c0/0d/9fc00de9dab18af4bad561c5978e37a5cf7ba8dc_2.file.layout-both-columns.tpl.php
879 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/cb/45/38/cb4538e80db186323bd2c849a93c3a874eb9fa44_2.file.helpers.tpl.php
880 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_tplfunction.php
881 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/a3/5d/99/a35d9996c0259409d557b9de6f17182667bd08c0_2.file.head.tpl.php
882 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/d8/66/63/d8666378896e3199131756b2a049789ce82f9145_2.file.head-jsonld.tpl.php
883 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/8e/7c/ff/8e7cff5cfb78f6670e25ee2a2964eb6ccbe1b9d5_2.file.product-list-jsonld.tpl.php
884 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/b5/08/e2/b508e285f88ade9f85c8711af34aa86844c85366_2.file.pagination-seo.tpl.php
885 /vendor/smarty/smarty/libs/plugins/modifier.replace.php
886 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/52/ed/5b/52ed5bf4088d07f918e31ad1872568dff1a15122_2.file.stylesheets.tpl.php
887 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/2a/77/40/2a7740ed942475bcc06c5e40d5346b6b574f1441_2.file.javascript.tpl.php
888 /classes/ProductDownload.php
889 /src/Core/Cart/Calculator.php
890 /src/Core/Cart/CartRowCollection.php
891 /src/Core/Cart/Fees.php
892 /src/Core/Cart/AmountImmutable.php
893 /src/Core/Cart/CartRuleCollection.php
894 /src/Core/Cart/CartRuleCalculator.php
895 /src/Adapter/Product/PriceCalculator.php
896 /src/Core/Cart/CartRow.php
897 /vendor/symfony/symfony/src/Symfony/Component/Translation/PluralizationRules.php
898 /src/Core/Util/String/StringModifier.php
899 /src/Core/Util/String/StringModifierInterface.php
900 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/05/ac/4e/05ac4e59da39afc94ba29fd4c5bed100b6b3da19_2.file.product-activation.tpl.php
901 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/05/4d/41/054d41abc5a541ea4fd30d63caa94ec106d2993b_2.file.header.tpl.php
902 /modules/iqitlinksmanager/iqitlinksmanager.php
903 /modules/iqitlinksmanager/src/IqitLinkBlockRepository.php
904 /modules/iqitlinksmanager/src/IqitLinkBlock.php
905 /modules/iqitlinksmanager/src/IqitLinkBlockPresenter.php
906 /modules/iqitlinksmanager/translations/fr.php
907 /vendor/smarty/smarty/libs/sysplugins/smarty_template_cached.php
908 /vendor/smarty/smarty/libs/sysplugins/smarty_cacheresource.php
909 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_cacheresource_file.php
910 /var/cache/prod/smarty/cache/iqitlinksmanager/1/1/1/21/displayNav1/warehouse/a9/f2/c1/a9f2c1869604c8c628073c46891a26fcf1453e27.iqitlinksmanagerviewstemplateshookiqitlinksmanager.tpl.php
911 /modules/ps_languageselector/ps_languageselector.php
912 /modules/ps_currencyselector/ps_currencyselector.php
913 /var/cache/prod/smarty/compile/warehouse/73/27/77/73277702161b17505d668b28b8368941cf42c568_2.module.iqitwishlistviewstemplateshookdisplaynav.tpl.php
914 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/03/c2/a5/03c2a55aa51a9b7d61e7f129a111606f12475287_2.file.header-3.tpl.php
915 /modules/iqitsearch/iqitsearch.php
916 /modules/iqitsearch/translations/fr.php
917 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_gettemplatevars.php
918 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/d9/9b/94/d99b947421dcff226f28b1d6cb674c91f17399db_2.module.iqitsearchviewstemplateshookiqitsearchbtn.tpl.php
919 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/46/29/db/4629dbb3c4efa13c090c633dc2e46e5f2b42bed3_2.module.iqitsearchviewstemplateshooksearchbar.tpl.php
920 /modules/ps_customersignin/ps_customersignin.php
921 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/72/be/19/72be192e406191c1cad554abe284e159adeb4234_2.module.ps_customersigninps_customersigninbtn.tpl.php
922 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/b4/a4/76/b4a476e0a8201677b298f7c0f8ca1ac698e1bac3_2.module.ps_shoppingcartps_shoppingcartbtn.tpl.php
923 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/35/65/5e/35655e6409b6198f29dd6e732ef9598dec599880_2.module.ps_shoppingcartps_shoppingcart.tpl.php
924 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/f6/e9/f2/f6e9f2b1680a466582d2199d038efe2cfa3a83f7_2.module.ps_shoppingcartps_shoppingcartcontent.tpl.php
925 /var/cache/prod/smarty/cache/iqitmegamenu/index/1/1/1/21/warehouse/70/ca/47/70ca47640f8f16a0dd1dc3b1fce177bbeed38257.iqitmegamenuviewstemplateshookhorizontal.tpl.php
926 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/ce/2d/19/ce2d19cd13f5f27943d104183b745be20e3618a6_2.file.mobile-header-1.tpl.php
927 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/7a/30/38/7a3038780284d52e9fcd7a66e51e5b86a166106b_2.module.iqitsearchviewstemplateshooksearchbarmobile.tpl.php
928 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/be/ee/e6/beeee6f3d87613010f8af1cabc4c4562f8cf600a_2.module.ps_customersigninps_customersigninmobile.tpl.php
929 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/d4/e1/57/d4e1571b6b210795247564db06deb17061778b51_2.module.ps_shoppingcartps_shoppingcartmqty.tpl.php
930 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/28/b8/a6/28b8a6fb36f22bef1e0b5c53910267c19ceae859_2.file.breadcrumb.tpl.php
931 /modules/iqitproductsnav/iqitproductsnav.php
932 /modules/iqitproductsnav/translations/fr.php
933 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/f1/e6/1e/f1e61e7ca59d67ddb45735d3ba11885aabdcd7c1_2.file.notifications.tpl.php
934 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/8f/2c/f2/8f2cf264e8ef24eff54cdc3881bd1071ff6abcc5_2.file.products-top.tpl.php
935 /vendor/smarty/smarty/libs/plugins/modifier.regex_replace.php
936 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/ca/43/26/ca432646d2c581a6631dbab0f8a0ded19562cc5d_2.file.sort-orders.tpl.php
937 /var/cache/prod/smarty/compile/warehouse/81/a1/04/81a1040ed0eeab6f58198f9907167c7fced628c5_2.module.ps_facetedsearchps_facetedsearch.tpl.php
938 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/52/57/07/52570740bcdee3193f952d35d0d11ce53ff537f4_2.file.products.tpl.php
939 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/45/91/09/4591095b1d399add495fc541674f2fceb9d0f0e3_2.file.product.tpl.php
940 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/cb/91/6c/cb916c508b6fcc743788f1d7f95631e94668cb9d_2.file.product-miniature-1.tpl.php
941 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/31/03/a9/3103a9a485af7d714612ac0c47dbcfbc05c4fd95_2.file.product-miniature-thumb.tpl.php
942 /var/cache/prod/smarty/compile/warehouse/e9/21/d5/e921d51c062189725606e51308456f33ad945843_2.module.iqitwishlistviewstemplateshookproductminiature.tpl.php
943 /var/cache/prod/smarty/compile/warehouse/90/53/a0/9053a0dd520a39bef75969a0e9efeeae750df91b_2.module.iqitcompareviewstemplateshookproductminiature.tpl.php
944 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_capture.php
945 /var/cache/prod/smarty/compile/warehouse/55/c7/a8/55c7a89f423f7f64b1b84881dcb668e4d788f013_2.module.iqitcountdownviewstemplateshookproduct.tpl.php
946 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/6c/98/2d/6c982d5090ff11db9654f1a7f6945865bc19603f_2.file.product-miniature-btn.tpl.php
947 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/8f/7a/83/8f7a832567456fbcc9b33e35ba7ca0da997b29d7_2.file.pagination.tpl.php
948 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/b1/d3/1b/b1d31b2d2e40bf3996d3350fd9793c705dd5bee6_2.file.products-bottom.tpl.php
949 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/99/9e/63/999e637a129f69005ecaa1ec5a360060ed703447_2.file.footer.tpl.php
950 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/7b/ea/10/7bea10cca96ef6b28b8f036ef026a7c11e3bde56_2.file.footer-1.tpl.php
951 /var/cache/prod/smarty/cache/iqitlinksmanager/1/1/1/21/displayFooter/warehouse/a9/f2/c1/a9f2c1869604c8c628073c46891a26fcf1453e27.iqitlinksmanagerviewstemplateshookiqitlinksmanager.tpl.php
952 /var/cache/prod/smarty/compile/warehouse/47/ac/57/47ac57039d904771d1de42366e1791900bdd2c2f_2.file.pixelheader.tpl.php
953 /vendor/smarty/smarty/libs/plugins/shared.mb_str_replace.php
954 /var/cache/prod/smarty/compile/warehouse/d5/a3/51/d5a351153329745771ab994e1aac2c50a2871ed1_2.file.pages_viewed.tpl.php
955 /var/cache/prod/smarty/compile/warehouse/e8/03/5a/e8035a8d1c12c085b510041163fece5592f47256_2.file.addtocart17.tpl.php
956 /var/cache/prod/smarty/compile/warehouse/77/34/89/773489e70d2bbbc33a3532f583f69463b9e8d34b_2.file.wishlist-iqitwishlist.tpl.php
957 /var/cache/prod/smarty/compile/warehouse/0b/1e/ae/0b1eae8b95d210de6545ab4d36ef1e0da4a2995c_2.file.newsletter.tpl.php
958 /var/cache/prod/smarty/compile/warehouse/bb/a9/2e/bba92e35e07193f35df4d88c25fef9c1ee267db4_2.file.page_time_event.tpl.php
959 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/2f/e6/59/2fe659ce5c8a3b849eecceed2fd2484c04ba6f2b_2.file.social-links.tpl.php
960 /modules/ps_emailsubscription/ps_emailsubscription.php
961 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/ca/11/75/ca1175f42cce659c415ef88a938d72e6064791dd_2.file.footer-copyrights-1.tpl.php
962 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/b2/b4/18/b2b418437d59a5c40ab3bf79b4a0534fdfc59e9d_2.file.password-policy-template.tpl.php
963 /classes/form/CustomerLoginForm.php
964 /classes/form/AbstractForm.php
965 /classes/form/FormInterface.php
966 /src/Core/Foundation/Templating/RenderableInterface.php
967 /classes/form/CustomerLoginFormatter.php
968 /classes/form/FormFormatterInterface.php
969 /classes/ValidateConstraintTranslator.php
970 /src/Core/Util/InternationalizedDomainNameConverter.php
971 /src/Core/Foundation/Templating/RenderableProxy.php
972 /var/cache/prod/smarty/compile/warehouse/52/f1/b8/52f1b8b385d74962f57df5c0ac1b0e91d62e4760_2.module.iqitwishlistviewstemplateshookdisplaymodal.tpl.php
973 /classes/form/FormField.php
974 /var/cache/prod/smarty/compile/warehouse/30/f5/ac/30f5acd1c8eb485e903c518c39df62f6dab88d7e_2.file.login-form.tpl.php
975 /var/cache/prod/smarty/compile/warehouse/21/f2/27/21f227e16d661dac3c649c0ff89b74dcf6812c75_2.file.form-errors.tpl.php
976 /var/cache/prod/smarty/compile/08/dc/b1/08dcb1adde6be40af6fcc0544d63eb4badcd22a6_2.file.form-fields.tpl.php
977 /var/cache/prod/smarty/compile/21/f2/27/21f227e16d661dac3c649c0ff89b74dcf6812c75_2.file.form-errors.tpl.php
978 /var/cache/prod/smarty/cache/iqitsociallogin/1/1/1/21/warehouse/7b/d5/c3/7bd5c305fe941e7514c4da4c50a911312eb62349.iqitsocialloginviewstemplateshookauthentication.tpl.php
979 /var/cache/prod/smarty/compile/warehouse/d4/a2/00/d4a200912ea9e133f46cf39b7eadc37ea7dd3d2f_2.module.iqitcompareviewstemplateshookdisplaymodal.tpl.php
980 /var/cache/prod/smarty/cache/iqitcookielaw/1/1/1/21/warehouse/6c/9a/c7/6c9ac7fc236180074d341c4bb3247222ad3545d0.iqitcookielawviewstemplateshookiqitcookielaw.tpl.php
981 /modules/ps_googleanalytics/classes/Hook/HookDisplayBeforeBodyClosingTag.php
982 /modules/ps_googleanalytics/classes/Handler/GanalyticsJsHandler.php
983 /modules/ps_googleanalytics/classes/Handler/GanalyticsDataHandler.php
984 /modules/ps_googleanalytics/classes/Repository/GanalyticsDataRepository.php
985 /modules/ps_googleanalytics/classes/Wrapper/ProductWrapper.php
986 /modules/ps_googleanalytics/classes/GoogleAnalyticsTools.php
987 /var/cache/prod/smarty/compile/warehouse/5c/93/46/5c93465cfee83ad9edb76aeff8896d92c35ee986_2.file.ga_tag.tpl.php