Promotions

Product added to wishlist
Product added to compare.

Ce site utilise des cookies provenant de Google afin de fournir ses services et d'analyser le trafic. Les informations relatives à votre utilisation du site sont partagées avec Google. En cliquant sur "Accepter", vous acceptez l'utilisation des cookies.

Load Time 495.884 ms
Querying Time 192 ms
Queries 525
Memory Peak Usage 22.5 Mb
Included Files 981 files - 13.08 Mb
PrestaShop Cache - Mb
Global vars 0.69 Mb
PrestaShop Version 8.2.0
PHP Version 8.1.34
MySQL Version 11.4.10-MariaDB
Memory Limit 4048M
Max Execution Time 600s
Smarty Cache enabled
Smarty Compilation auto
  Time Cumulated Time Memory Usage Memory Peak Usage
config 0.893 ms 0.893 ms 5.49 Mb 6.9 Mb
__construct 0.008 ms 0.901 ms - Mb 6.9 Mb
init 5.487 ms 6.388 ms 0.96 Mb 6.9 Mb
checkAccess 0.001 ms 6.389 ms - Mb 6.9 Mb
setMedia 0.931 ms 7.320 ms 0.21 Mb 6.9 Mb
postProcess 0.001 ms 7.321 ms - Mb 6.9 Mb
initHeader 0.001 ms 7.322 ms - Mb 6.9 Mb
initContent 215.523 ms 222.845 ms 9.40 Mb 16.2 Mb
initFooter 0.002 ms 222.847 ms - Mb 16.2 Mb
display 273.037 ms 495.884 ms 5.76 Mb 22.5 Mb
Hook Time Memory Usage
displayProductListFunctionalButtons 3.000 ms 0.04 Mb
displayBeforeBodyClosingTag 2.187 ms 0.76 Mb
DisplayFooter 2.051 ms 0.85 Mb
DisplayHeader 1.626 ms 0.14 Mb
DisplayBeforeBodyClosingTag 1.283 ms 0.18 Mb
displayCountDown 1.201 ms 0.09 Mb
displayNav2 0.644 ms 0.18 Mb
displayNav1 0.452 ms 0.09 Mb
displayMainMenu 0.354 ms 0.17 Mb
displayCustomerLoginFormAfter 0.272 ms 0.07 Mb
renderWidget 0.235 ms 0.09 Mb
displayFooter 0.230 ms 0.09 Mb
displayAfterBreadcrumb 0.150 ms 0.04 Mb
ProductSearchProvider 0.143 ms - Mb
ActionFrontControllerSetMedia 0.064 ms - Mb
OverrideLayoutTemplate 0.013 ms - Mb
DisplayTop 0.007 ms - Mb
ModuleRoutes 0.005 ms - Mb
ActionDispatcher 0.004 ms - Mb
ActionProductSearchAfter 0.003 ms - Mb
Header 0.002 ms - Mb
21 hook(s) 13.927 ms 2.80 Mb
Module Time Memory Usage
ph_simpleblog 3.432 ms 1.98 Mb
iqitthemeeditor 0.424 ms 0.15 Mb
ps_emailalerts 0.100 ms 0.10 Mb
facebookconversiontrackingplus 2.760 ms 0.95 Mb
revsliderprestashop 0.506 ms 0.08 Mb
ps_shoppingcart 0.067 ms 0.02 Mb
ps_googleanalytics 1.531 ms 0.23 Mb
iqitcompare 1.677 ms 0.17 Mb
iqitcontactpage 0.062 ms 0.02 Mb
iqitcookielaw 0.412 ms 0.07 Mb
iqitcountdown 1.297 ms 0.04 Mb
iqitelementor 0.236 ms 0.13 Mb
iqitfreedeliverycount 0.061 ms 0.02 Mb
iqitmegamenu 0.493 ms 0.23 Mb
iqitsizecharts 0.084 ms 0.10 Mb
iqitwishlist 3.809 ms 0.74 Mb
iqitextendedproduct 0.099 ms 0.05 Mb
iqitsociallogin 0.345 ms 0.09 Mb
gmerchantcenterpro 7.505 ms 1.12 Mb
stripe_official 0.349 ms 0.15 Mb
abandonedcart 0.336 ms 0.09 Mb
vivawalletsmartcheckout 0.191 ms - Mb
ps_facetedsearch 0.559 ms 0.19 Mb
iqitlinksmanager 0.700 ms 0.17 Mb
ps_languageselector 0.189 ms 0.06 Mb
ps_currencyselector 0.166 ms 0.06 Mb
iqitsearch 0.071 ms 0.01 Mb
ps_customersignin 0.034 ms 0.02 Mb
iqitproductsnav 0.211 ms 0.06 Mb
ps_emailsubscription 0.767 ms 0.28 Mb
30 module(s) 28.471 ms 7.39 Mb

Stopwatch SQL - 525 queries

# Query Time (ms) Rows Filesort Group By Location
144
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pl.name FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_product_lang pl ON (p.id_product = pl.id_product AND pl.id_shop = 1 AND pl.id_lang = 1) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_specific_price sp ON (
sp.id_product = p.id_product AND 
sp.id_shop IN (0, 1) AND 
sp.id_currency IN (0, 1) AND 
sp.id_country IN (0, 21) AND 
sp.id_group IN (0, 1) AND 
sp.from_quantity = 1 AND
sp.reduction > 0 AND
sp.id_customer = 0 AND
sp.id_cart = 0 AND 
(sp.from = '0000-00-00 00:00:00' OR '2026-05-04 18:49:44' >= sp.from) AND 
(sp.to = '0000-00-00 00:00:00' OR '2026-05-04 18:49:44' <= sp.to) 
) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (751234, 751240, 33203, 33202, 33204, 33209))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND sp.reduction>0 GROUP BY p.id_product) p INNER JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=10)) AND ((fp_1.id_feature_value IN (751234, 751240, 33203, 33202, 33204, 33209))) GROUP BY fp.id_feature_value
21.224 ms 16636864 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
140
SELECT SQL_NO_CACHE p.id_product FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pl.name FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_product_lang pl ON (p.id_product = pl.id_product AND pl.id_shop = 1 AND pl.id_lang = 1) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_specific_price sp ON (
sp.id_product = p.id_product AND 
sp.id_shop IN (0, 1) AND 
sp.id_currency IN (0, 1) AND 
sp.id_country IN (0, 21) AND 
sp.id_group IN (0, 1) AND 
sp.from_quantity = 1 AND
sp.reduction > 0 AND
sp.id_customer = 0 AND
sp.id_cart = 0 AND 
(sp.from = '0000-00-00 00:00:00' OR '2026-05-04 18:49:44' >= sp.from) AND 
(sp.to = '0000-00-00 00:00:00' OR '2026-05-04 18:49:44' <= sp.to) 
) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value=232660)) AND ((fp_1.id_feature_value IN (751234, 751240, 33203, 33202, 33204, 33209))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND sp.reduction>0 GROUP BY p.id_product) p INNER JOIN een_product_lang pl ON (p.id_product = pl.id_product AND pl.id_shop = 1 AND pl.id_lang = 1) GROUP BY p.id_product ORDER BY p.name ASC, p.id_product DESC
15.169 ms 74092840 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
153
SELECT SQL_NO_CACHE cp.id_category, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pl.name FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_product_lang pl ON (p.id_product = pl.id_product AND pl.id_shop = 1 AND pl.id_lang = 1) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_specific_price sp ON (
sp.id_product = p.id_product AND 
sp.id_shop IN (0, 1) AND 
sp.id_currency IN (0, 1) AND 
sp.id_country IN (0, 21) AND 
sp.id_group IN (0, 1) AND 
sp.from_quantity = 1 AND
sp.reduction > 0 AND
sp.id_customer = 0 AND
sp.id_cart = 0 AND 
(sp.from = '0000-00-00 00:00:00' OR '2026-05-04 18:49:44' >= sp.from) AND 
(sp.to = '0000-00-00 00:00:00' OR '2026-05-04 18:49:44' <= sp.to) 
) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value=232660)) AND ((fp_1.id_feature_value IN (751234, 751240, 33203, 33202, 33204, 33209))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND sp.reduction>0 GROUP BY p.id_product) p INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value=232660)) AND ((fp_1.id_feature_value IN (751234, 751240, 33203, 33202, 33204, 33209))) AND cg.id_group='1' AND c.level_depth<=2 AND c.nleft>2 AND c.nright<659 GROUP BY cp.id_category
14.389 ms 16636864 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
148
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pl.name FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_product_lang pl ON (p.id_product = pl.id_product AND pl.id_shop = 1 AND pl.id_lang = 1) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_specific_price sp ON (
sp.id_product = p.id_product AND 
sp.id_shop IN (0, 1) AND 
sp.id_currency IN (0, 1) AND 
sp.id_country IN (0, 21) AND 
sp.id_group IN (0, 1) AND 
sp.from_quantity = 1 AND
sp.reduction > 0 AND
sp.id_customer = 0 AND
sp.id_cart = 0 AND 
(sp.from = '0000-00-00 00:00:00' OR '2026-05-04 18:49:44' >= sp.from) AND 
(sp.to = '0000-00-00 00:00:00' OR '2026-05-04 18:49:44' <= sp.to) 
) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value=232660)) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND sp.reduction>0 GROUP BY p.id_product) p INNER JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=29)) AND ((fp_1.id_feature_value=232660)) GROUP BY fp.id_feature_value
14.248 ms 4406752 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
154
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pl.name FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_product_lang pl ON (p.id_product = pl.id_product AND pl.id_shop = 1 AND pl.id_lang = 1) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_specific_price sp ON (
sp.id_product = p.id_product AND 
sp.id_shop IN (0, 1) AND 
sp.id_currency IN (0, 1) AND 
sp.id_country IN (0, 21) AND 
sp.id_group IN (0, 1) AND 
sp.from_quantity = 1 AND
sp.reduction > 0 AND
sp.id_customer = 0 AND
sp.id_cart = 0 AND 
(sp.from = '0000-00-00 00:00:00' OR '2026-05-04 18:49:44' >= sp.from) AND 
(sp.to = '0000-00-00 00:00:00' OR '2026-05-04 18:49:44' <= sp.to) 
) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value=232660)) AND ((fp_1.id_feature_value IN (751234, 751240, 33203, 33202, 33204, 33209))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND sp.reduction>0 GROUP BY p.id_product) p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_stock_available sa_1 ON (p.id_product = sa_1.id_product AND IFNULL(pac.id_product_attribute, 0) = sa_1.id_product_attribute AND sa_1.id_shop = 1  AND sa_1.id_shop_group = 0 ) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) LEFT JOIN een_feature_product fp_2 ON (p.id_product = fp_2.id_product) WHERE ((sa.quantity<=0 AND sa_1.out_of_stock IN (0, 2))) AND ((fp_1.id_feature_value=232660)) AND ((fp_2.id_feature_value IN (751234, 751240, 33203, 33202, 33204, 33209)))
13.181 ms 33273728 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
146
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pl.name FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_product_lang pl ON (p.id_product = pl.id_product AND pl.id_shop = 1 AND pl.id_lang = 1) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_specific_price sp ON (
sp.id_product = p.id_product AND 
sp.id_shop IN (0, 1) AND 
sp.id_currency IN (0, 1) AND 
sp.id_country IN (0, 21) AND 
sp.id_group IN (0, 1) AND 
sp.from_quantity = 1 AND
sp.reduction > 0 AND
sp.id_customer = 0 AND
sp.id_cart = 0 AND 
(sp.from = '0000-00-00 00:00:00' OR '2026-05-04 18:49:44' >= sp.from) AND 
(sp.to = '0000-00-00 00:00:00' OR '2026-05-04 18:49:44' <= sp.to) 
) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value=232660)) AND ((fp_1.id_feature_value IN (751234, 751240, 33203, 33202, 33204, 33209))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND sp.reduction>0 GROUP BY p.id_product) p INNER JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) LEFT JOIN een_feature_product fp_2 ON (p.id_product = fp_2.id_product) WHERE ((fp.id_feature=13)) AND ((fp_1.id_feature_value=232660)) AND ((fp_2.id_feature_value IN (751234, 751240, 33203, 33202, 33204, 33209))) GROUP BY fp.id_feature_value
12.423 ms 16636864 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
156
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pl.name FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_product_lang pl ON (p.id_product = pl.id_product AND pl.id_shop = 1 AND pl.id_lang = 1) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_specific_price sp ON (
sp.id_product = p.id_product AND 
sp.id_shop IN (0, 1) AND 
sp.id_currency IN (0, 1) AND 
sp.id_country IN (0, 21) AND 
sp.id_group IN (0, 1) AND 
sp.from_quantity = 1 AND
sp.reduction > 0 AND
sp.id_customer = 0 AND
sp.id_cart = 0 AND 
(sp.from = '0000-00-00 00:00:00' OR '2026-05-04 18:49:44' >= sp.from) AND 
(sp.to = '0000-00-00 00:00:00' OR '2026-05-04 18:49:44' <= sp.to) 
) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value=232660)) AND ((fp_1.id_feature_value IN (751234, 751240, 33203, 33202, 33204, 33209))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND sp.reduction>0 GROUP BY p.id_product) p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) LEFT JOIN een_feature_product fp_2 ON (p.id_product = fp_2.id_product) WHERE ((sa.quantity>0)) AND ((fp_1.id_feature_value=232660)) AND ((fp_2.id_feature_value IN (751234, 751240, 33203, 33202, 33204, 33209)))
11.222 ms 33273728 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
155
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pl.name FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_product_lang pl ON (p.id_product = pl.id_product AND pl.id_shop = 1 AND pl.id_lang = 1) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_specific_price sp ON (
sp.id_product = p.id_product AND 
sp.id_shop IN (0, 1) AND 
sp.id_currency IN (0, 1) AND 
sp.id_country IN (0, 21) AND 
sp.id_group IN (0, 1) AND 
sp.from_quantity = 1 AND
sp.reduction > 0 AND
sp.id_customer = 0 AND
sp.id_cart = 0 AND 
(sp.from = '0000-00-00 00:00:00' OR '2026-05-04 18:49:44' >= sp.from) AND 
(sp.to = '0000-00-00 00:00:00' OR '2026-05-04 18:49:44' <= sp.to) 
) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value=232660)) AND ((fp_1.id_feature_value IN (751234, 751240, 33203, 33202, 33204, 33209))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND sp.reduction>0 GROUP BY p.id_product) p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) LEFT JOIN een_feature_product fp_2 ON (p.id_product = fp_2.id_product) WHERE ((sa.out_of_stock=1) OR (sa.quantity>0)) AND ((fp_1.id_feature_value=232660)) AND ((fp_2.id_feature_value IN (751234, 751240, 33203, 33202, 33204, 33209)))
10.584 ms 33273728 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
141
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pl.name FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_product_lang pl ON (p.id_product = pl.id_product AND pl.id_shop = 1 AND pl.id_lang = 1) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_specific_price sp ON (
sp.id_product = p.id_product AND 
sp.id_shop IN (0, 1) AND 
sp.id_currency IN (0, 1) AND 
sp.id_country IN (0, 21) AND 
sp.id_group IN (0, 1) AND 
sp.from_quantity = 1 AND
sp.reduction > 0 AND
sp.id_customer = 0 AND
sp.id_cart = 0 AND 
(sp.from = '0000-00-00 00:00:00' OR '2026-05-04 18:49:44' >= sp.from) AND 
(sp.to = '0000-00-00 00:00:00' OR '2026-05-04 18:49:44' <= sp.to) 
) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value=232660)) AND ((fp_1.id_feature_value IN (751234, 751240, 33203, 33202, 33204, 33209))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND sp.reduction>0 GROUP BY p.id_product) p LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) LEFT JOIN een_feature_product fp_2 ON (p.id_product = fp_2.id_product) WHERE ((p.on_sale=1)) AND ((fp_1.id_feature_value=232660)) AND ((fp_2.id_feature_value IN (751234, 751240, 33203, 33202, 33204, 33209)))
9.941 ms 16636864 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
142
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pl.name FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_product_lang pl ON (p.id_product = pl.id_product AND pl.id_shop = 1 AND pl.id_lang = 1) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_specific_price sp ON (
sp.id_product = p.id_product AND 
sp.id_shop IN (0, 1) AND 
sp.id_currency IN (0, 1) AND 
sp.id_country IN (0, 21) AND 
sp.id_group IN (0, 1) AND 
sp.from_quantity = 1 AND
sp.reduction > 0 AND
sp.id_customer = 0 AND
sp.id_cart = 0 AND 
(sp.from = '0000-00-00 00:00:00' OR '2026-05-04 18:49:44' >= sp.from) AND 
(sp.to = '0000-00-00 00:00:00' OR '2026-05-04 18:49:44' <= sp.to) 
) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value=232660)) AND ((fp_1.id_feature_value IN (751234, 751240, 33203, 33202, 33204, 33209))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND sp.reduction>0 GROUP BY p.id_product) p LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value=232660)) AND ((fp_1.id_feature_value IN (751234, 751240, 33203, 33202, 33204, 33209))) AND p.date_add>'2026-02-04 00:00:00'
8.594 ms 16636864 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
143
SELECT SQL_NO_CACHE psi.price_min, MIN(price_min) as min, MAX(price_max) as max FROM een_product p INNER JOIN een_layered_price_index psi ON (psi.id_product = p.id_product AND psi.id_shop = 1 AND psi.id_currency = 1 AND psi.id_country = 21) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_specific_price sp ON (
sp.id_product = p.id_product AND 
sp.id_shop IN (0, 1) AND 
sp.id_currency IN (0, 1) AND 
sp.id_country IN (0, 21) AND 
sp.id_group IN (0, 1) AND 
sp.from_quantity = 1 AND
sp.reduction > 0 AND
sp.id_customer = 0 AND
sp.id_cart = 0 AND 
(sp.from = '0000-00-00 00:00:00' OR '2026-05-04 18:49:44' >= sp.from) AND 
(sp.to = '0000-00-00 00:00:00' OR '2026-05-04 18:49:44' <= sp.to) 
) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value=232660)) AND ((fp_1.id_feature_value IN (751234, 751240, 33203, 33202, 33204, 33209))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND sp.reduction>0
3.607 ms 2884 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
3
SELECT SQL_NO_CACHE c.`name`, cl.`id_lang`, IF(cl.`id_lang` IS NULL, c.`value`, cl.`value`) AS value, c.id_shop_group, c.id_shop
FROM `een_configuration` c
LEFT JOIN `een_configuration_lang` cl ON (c.`id_configuration` = cl.`id_configuration`)
1.614 ms 1696 /classes/Configuration.php:180
147
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pl.name FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_product_lang pl ON (p.id_product = pl.id_product AND pl.id_shop = 1 AND pl.id_lang = 1) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_specific_price sp ON (
sp.id_product = p.id_product AND 
sp.id_shop IN (0, 1) AND 
sp.id_currency IN (0, 1) AND 
sp.id_country IN (0, 21) AND 
sp.id_group IN (0, 1) AND 
sp.from_quantity = 1 AND
sp.reduction > 0 AND
sp.id_customer = 0 AND
sp.id_cart = 0 AND 
(sp.from = '0000-00-00 00:00:00' OR '2026-05-04 18:49:44' >= sp.from) AND 
(sp.to = '0000-00-00 00:00:00' OR '2026-05-04 18:49:44' <= sp.to) 
) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value=232660)) AND ((fp_1.id_feature_value IN (751234, 751240, 33203, 33202, 33204, 33209))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND sp.reduction>0 GROUP BY p.id_product) p INNER JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) LEFT JOIN een_feature_product fp_2 ON (p.id_product = fp_2.id_product) WHERE ((fp.id_feature=20)) AND ((fp_1.id_feature_value=232660)) AND ((fp_2.id_feature_value IN (751234, 751240, 33203, 33202, 33204, 33209))) GROUP BY fp.id_feature_value
1.605 ms 2208 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
157
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pl.name FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_product_lang pl ON (p.id_product = pl.id_product AND pl.id_shop = 1 AND pl.id_lang = 1) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_specific_price sp ON (
sp.id_product = p.id_product AND 
sp.id_shop IN (0, 1) AND 
sp.id_currency IN (0, 1) AND 
sp.id_country IN (0, 21) AND 
sp.id_group IN (0, 1) AND 
sp.from_quantity = 1 AND
sp.reduction > 0 AND
sp.id_customer = 0 AND
sp.id_cart = 0 AND 
(sp.from = '0000-00-00 00:00:00' OR '2026-05-04 18:49:44' >= sp.from) AND 
(sp.to = '0000-00-00 00:00:00' OR '2026-05-04 18:49:44' <= sp.to) 
) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value=232660)) AND ((fp_1.id_feature_value IN (751234, 751240, 33203, 33202, 33204, 33209))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND sp.reduction>0 GROUP BY p.id_product) p INNER JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) LEFT JOIN een_feature_product fp_2 ON (p.id_product = fp_2.id_product) WHERE ((fp.id_feature=17)) AND ((fp_1.id_feature_value=232660)) AND ((fp_2.id_feature_value IN (751234, 751240, 33203, 33202, 33204, 33209))) GROUP BY fp.id_feature_value
1.176 ms 4536 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
150
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pl.name FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_product_lang pl ON (p.id_product = pl.id_product AND pl.id_shop = 1 AND pl.id_lang = 1) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_specific_price sp ON (
sp.id_product = p.id_product AND 
sp.id_shop IN (0, 1) AND 
sp.id_currency IN (0, 1) AND 
sp.id_country IN (0, 21) AND 
sp.id_group IN (0, 1) AND 
sp.from_quantity = 1 AND
sp.reduction > 0 AND
sp.id_customer = 0 AND
sp.id_cart = 0 AND 
(sp.from = '0000-00-00 00:00:00' OR '2026-05-04 18:49:44' >= sp.from) AND 
(sp.to = '0000-00-00 00:00:00' OR '2026-05-04 18:49:44' <= sp.to) 
) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value=232660)) AND ((fp_1.id_feature_value IN (751234, 751240, 33203, 33202, 33204, 33209))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND sp.reduction>0 GROUP BY p.id_product) p INNER JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) LEFT JOIN een_feature_product fp_2 ON (p.id_product = fp_2.id_product) WHERE ((fp.id_feature=34)) AND ((fp_1.id_feature_value=232660)) AND ((fp_2.id_feature_value IN (751234, 751240, 33203, 33202, 33204, 33209))) GROUP BY fp.id_feature_value
1.135 ms 224 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
173
SELECT SQL_NO_CACHE h.id_hook, h.name as h_name, title, description, h.position, hm.position as hm_position, m.id_module, m.name, m.active
FROM `een_hook_module` hm
STRAIGHT_JOIN `een_hook` h ON (h.id_hook = hm.id_hook AND hm.id_shop = 1)
STRAIGHT_JOIN `een_module` as m ON (m.id_module = hm.id_module)
ORDER BY hm.position
0.920 ms 487 /classes/Hook.php:456
172
SELECT SQL_NO_CACHE `id_hook`, `name`
FROM `een_hook`
UNION
SELECT `id_hook`, ha.`alias` as name
FROM `een_hook_alias` ha
INNER JOIN `een_hook` h ON ha.name = h.name
0.906 ms 0 /classes/Hook.php:1326
14
SELECT SQL_NO_CACHE h.`name` as hook, m.`id_module`, h.`id_hook`, m.`name` as module
FROM `een_module` m
INNER JOIN een_module_shop module_shop
ON (module_shop.id_module = m.id_module AND module_shop.id_shop = 1 AND module_shop.enable_device & 1)
INNER JOIN `een_hook_module` `hm` ON hm.`id_module` = m.`id_module`
INNER JOIN `een_hook` `h` ON hm.`id_hook` = h.`id_hook`
LEFT JOIN `een_module_group` `mg` ON mg.`id_module` = m.`id_module`
WHERE (h.`name` != "paymentOptions") AND (hm.`id_shop` = 1) AND (mg.id_shop = 1 AND  mg.`id_group` IN (1))
GROUP BY hm.id_hook, hm.id_module
ORDER BY hm.`position`
0.772 ms 305 Yes Yes /classes/Hook.php:1267
152
SELECT SQL_NO_CACHE c.`id_category`, cl.`name`
FROM `een_category` c
INNER JOIN een_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `een_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
ORDER BY c.nleft, c.position
0.541 ms 330 Yes /classes/Category.php:724
158
SELECT SQL_NO_CACHE p.*,
ps.*,
pl.*,
sa.out_of_stock,
IFNULL(sa.quantity, 0) as quantity,
(DATEDIFF(
p.`date_add`,
DATE_SUB(
'2026-05-04 00:00:00',
INTERVAL 90 DAY
)
) > 0) as new
FROM een_product p
LEFT JOIN een_product_lang pl
ON pl.id_product = p.id_product
AND pl.id_shop = 1
AND pl.id_lang = 1
LEFT JOIN een_stock_available sa   ON sa.id_product = p.id_product
AND sa.id_product_attribute = 0
AND sa.id_shop = 1 LEFT JOIN een_product_shop ps
ON ps.id_product = p.id_product
AND ps.id_shop = 1
WHERE p.id_product IN (590850,576485,597831,596002,565876,573233,10087,4997,10086,40036,605174,605590,573843,606782,592103,565904,600667,542263,563542)
0.459 ms 19 /classes/ProductAssembler.php:95
99
SELECT SQL_NO_CACHE *
FROM `een_gmcp_feeds` ff
WHERE (ff.id_shop=1)
ORDER BY ff.feed_is_default ASC
0.447 ms 370 Yes /modules/gmerchantcenterpro/models/Feeds.php:62
524
SELECT SQL_NO_CACHE cp.`id_category`, cp.`id_product`, cl.`name` FROM `een_category_product` cp
LEFT JOIN `een_category` c ON (c.id_category = cp.id_category)
LEFT JOIN `een_category_lang` cl ON (cp.`id_category` = cl.`id_category` AND cl.id_shop = 1 )
INNER JOIN een_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
WHERE cp.`id_product` IN (590850,576485,597831,596002,565876,573233,10087,4997,10086,40036,605174,605590,573843,606782,592103,565904,600667,542263,563542) AND cl.`id_lang` = 1
ORDER BY c.`level_depth` DESC
0.350 ms 50 Yes /modules/ps_googleanalytics/classes/Wrapper/ProductWrapper.php:109
13
SELECT SQL_NO_CACHE lower(name) as name
FROM `een_hook` h
WHERE (h.active = 1)
0.309 ms 1060 /classes/Hook.php:1366
137
SELECT SQL_NO_CACHE DISTINCT f.id_feature, f.*, fl.*, IF(liflv.`url_name` IS NULL OR liflv.`url_name` = "", NULL, liflv.`url_name`) AS url_name, IF(liflv.`meta_title` IS NULL OR liflv.`meta_title` = "", NULL, liflv.`meta_title`) AS meta_title, lif.indexable FROM `een_feature` f  INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1) LEFT JOIN `een_feature_lang` fl ON (f.`id_feature` = fl.`id_feature` AND fl.`id_lang` = 1) LEFT JOIN `een_layered_indexable_feature` lif ON (f.`id_feature` = lif.`id_feature`) LEFT JOIN `een_layered_indexable_feature_lang_value` liflv ON (f.`id_feature` = liflv.`id_feature` AND liflv.`id_lang` = 1) ORDER BY f.`position` ASC
0.288 ms 29 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:171
138
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `een_feature_value` v LEFT JOIN `een_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `een_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 10 ORDER BY vl.`value` ASC
0.283 ms 37 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
149
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `een_feature_value` v LEFT JOIN `een_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `een_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 29 ORDER BY vl.`value` ASC
0.278 ms 40 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
16
SELECT SQL_NO_CACHE `id_hook`, `name` FROM `een_hook`
0.275 ms 1060 /classes/Hook.php:1326
145
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `een_feature_value` v LEFT JOIN `een_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `een_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 10 ORDER BY vl.`value` ASC
0.270 ms 37 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
139
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `een_feature_value` v LEFT JOIN `een_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `een_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 29 ORDER BY vl.`value` ASC
0.261 ms 40 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
94
SHOW COLUMNS FROM een_gmcp_feeds LIKE "feed_is_default"
0.259 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:128
373
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 542263 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.251 ms 1 Yes /classes/SpecificPrice.php:576
389
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 563542 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 563542 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.237 ms 0 /classes/Cart.php:1430
350
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 565904 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.235 ms 1 Yes /classes/SpecificPrice.php:576
327
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 606782 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.233 ms 1 Yes /classes/SpecificPrice.php:576
256
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 4997 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 2 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.232 ms 1 Yes /classes/SpecificPrice.php:576
366
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 600667 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 600667 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.229 ms 0 /classes/Cart.php:1430
179
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 590850 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 590850 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.228 ms 0 /classes/Cart.php:1430
185
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 576485 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.225 ms 1 Yes /classes/SpecificPrice.php:576
293
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 605174 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.225 ms 1 Yes /classes/SpecificPrice.php:576
96
SHOW COLUMNS FROM een_gmcp_tags LIKE "custom_label_set_postion"
0.224 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:128
208
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 596002 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.223 ms 1 Yes /classes/SpecificPrice.php:576
268
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 10086 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.223 ms 1 Yes /classes/SpecificPrice.php:576
338
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 592103 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.222 ms 1 Yes /classes/SpecificPrice.php:576
169
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 590850 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.220 ms 1 Yes /classes/SpecificPrice.php:576
321
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 573843 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 573843 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.220 ms 0 /classes/Cart.php:1430
343
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 592103 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 592103 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.220 ms 0 /classes/Cart.php:1430
280
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 40036 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 2 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.219 ms 1 Yes /classes/SpecificPrice.php:576
56
SHOW TABLES LIKE "een_gmcp_1800"
0.216 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:88
274
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 10086
ORDER BY f.position ASC
0.213 ms 8 Yes /classes/Product.php:6021
298
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 605174 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 605174 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.211 ms 0 /classes/Cart.php:1430
95
SHOW COLUMNS FROM een_gmcp_discount_association LIKE "channel"
0.210 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:128
213
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 596002 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 596002 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.209 ms 0 /classes/Cart.php:1430
384
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 563542 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.206 ms 1 Yes /classes/SpecificPrice.php:576
20
SELECT SQL_NO_CACHE m.page, ml.url_rewrite, ml.id_lang
FROM `een_meta` m
LEFT JOIN `een_meta_lang` ml ON (m.id_meta = ml.id_meta AND ml.id_shop = 1 )
ORDER BY LENGTH(ml.url_rewrite) DESC
0.205 ms 66 Yes /classes/Dispatcher.php:654
273
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 10086 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 10086 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.205 ms 0 /classes/Cart.php:1430
332
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 606782 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 606782 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.205 ms 0 /classes/Cart.php:1430
219
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 565876 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.205 ms 1 Yes /classes/SpecificPrice.php:576
180
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 590850
ORDER BY f.position ASC
0.200 ms 2 Yes /classes/Product.php:6021
285
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 40036 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 40036 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.200 ms 0 /classes/Cart.php:1430
379
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 542263
ORDER BY f.position ASC
0.197 ms 6 Yes /classes/Product.php:6021
286
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 40036
ORDER BY f.position ASC
0.196 ms 2 Yes /classes/Product.php:6021
262
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4997
ORDER BY f.position ASC
0.195 ms 11 Yes /classes/Product.php:6021
355
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 565904 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 565904 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.195 ms 0 /classes/Cart.php:1430
428
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 573843) AND (b.`id_shop` = 1) LIMIT 1
0.194 ms 1 /src/Adapter/EntityMapper.php:71
378
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 542263 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 542263 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.194 ms 0 /classes/Cart.php:1430
224
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 565876 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 565876 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.193 ms 0 /classes/Cart.php:1430
63
SHOW TABLES LIKE "een_gmcp_1900"
0.193 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:88
310
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 605590 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 605590 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.193 ms 0 /classes/Cart.php:1430
305
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 605590 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.192 ms 1 Yes /classes/SpecificPrice.php:576
243
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 10087 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 2 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.189 ms 1 Yes /classes/SpecificPrice.php:576
311
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 605590
ORDER BY f.position ASC
0.186 ms 2 Yes /classes/Product.php:6021
431
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 606782) AND (b.`id_shop` = 1) LIMIT 1
0.186 ms 1 /src/Adapter/EntityMapper.php:71
214
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 596002
ORDER BY f.position ASC
0.184 ms 2 Yes /classes/Product.php:6021
322
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 573843
ORDER BY f.position ASC
0.184 ms 3 Yes /classes/Product.php:6021
333
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 606782
ORDER BY f.position ASC
0.184 ms 2 Yes /classes/Product.php:6021
299
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 605174
ORDER BY f.position ASC
0.182 ms 2 Yes /classes/Product.php:6021
492
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (563542) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.182 ms 1 Yes Yes /classes/Product.php:4524
434
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 592103) AND (b.`id_shop` = 1) LIMIT 1
0.180 ms 1 /src/Adapter/EntityMapper.php:71
344
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 592103
ORDER BY f.position ASC
0.179 ms 2 Yes /classes/Product.php:6021
419
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 40036) AND (b.`id_shop` = 1) LIMIT 1
0.179 ms 1 /src/Adapter/EntityMapper.php:71
316
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 573843 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.178 ms 1 Yes /classes/SpecificPrice.php:576
429
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 573843
ORDER BY `position`
0.177 ms 8 Yes /classes/Product.php:3545
391
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 590850) AND (b.`id_shop` = 1) LIMIT 1
0.176 ms 1 /src/Adapter/EntityMapper.php:71
489
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (565904) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.176 ms 1 Yes Yes /classes/Product.php:4524
401
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 596002) AND (b.`id_shop` = 1) LIMIT 1
0.175 ms 1 /src/Adapter/EntityMapper.php:71
196
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 597831 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.173 ms 1 Yes /classes/SpecificPrice.php:576
225
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 565876
ORDER BY f.position ASC
0.172 ms 2 Yes /classes/Product.php:6021
261
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4997 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4997 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.172 ms 0 /classes/Cart.php:1430
474
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (590850) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.171 ms 1 Yes Yes /classes/Product.php:4524
24
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `een_module` m
LEFT JOIN `een_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
0.170 ms 104 /classes/module/Module.php:346
404
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 565876) AND (b.`id_shop` = 1) LIMIT 1
0.170 ms 1 /src/Adapter/EntityMapper.php:71
449
SELECT SQL_NO_CACHE 1 FROM `een_cart_rule` WHERE ((date_to >= "2026-05-04 00:00:00" AND date_to <= "2026-05-04 23:59:59") OR (date_from >= "2026-05-04 00:00:00" AND date_from <= "2026-05-04 23:59:59") OR (date_from < "2026-05-04 00:00:00" AND date_to > "2026-05-04 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
0.170 ms 2 /classes/CartRule.php:357
398
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 597831) AND (b.`id_shop` = 1) LIMIT 1
0.169 ms 1 /src/Adapter/EntityMapper.php:71
361
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 600667 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.168 ms 1 Yes /classes/SpecificPrice.php:576
390
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 563542
ORDER BY f.position ASC
0.168 ms 2 Yes /classes/Product.php:6021
446
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 563542) AND (b.`id_shop` = 1) LIMIT 1
0.168 ms 1 /src/Adapter/EntityMapper.php:71
18
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `een_module` m
LEFT JOIN `een_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
0.168 ms 104 /classes/module/Module.php:346
136
SELECT SQL_NO_CACHE type, id_value, filter_show_limit, filter_type FROM een_layered_category
WHERE controller = 'prices-drop'
AND id_category = 0
AND id_shop = 1
GROUP BY `type`, id_value ORDER BY position ASC
0.166 ms 40 Yes Yes /modules/ps_facetedsearch/src/Filters/Provider.php:61
435
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 592103
ORDER BY `position`
0.164 ms 8 Yes /classes/Product.php:3545
410
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10087) AND (b.`id_shop` = 1) LIMIT 1
0.163 ms 1 /src/Adapter/EntityMapper.php:71
422
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 605174) AND (b.`id_shop` = 1) LIMIT 1
0.163 ms 1 /src/Adapter/EntityMapper.php:71
408
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 573233
ORDER BY `position`
0.162 ms 7 Yes /classes/Product.php:3545
230
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 573233 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.160 ms 1 Yes /classes/SpecificPrice.php:576
402
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 596002
ORDER BY `position`
0.160 ms 10 Yes /classes/Product.php:3545
405
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 565876
ORDER BY `position`
0.160 ms 8 Yes /classes/Product.php:3545
432
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 606782
ORDER BY `position`
0.160 ms 8 Yes /classes/Product.php:3545
392
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 590850
ORDER BY `position`
0.159 ms 8 Yes /classes/Product.php:3545
367
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 600667
ORDER BY f.position ASC
0.158 ms 2 Yes /classes/Product.php:6021
490
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (600667) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.158 ms 1 Yes Yes /classes/Product.php:4524
249
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 10087
ORDER BY f.position ASC
0.157 ms 8 Yes /classes/Product.php:6021
395
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 576485) AND (b.`id_shop` = 1) LIMIT 1
0.157 ms 1 /src/Adapter/EntityMapper.php:71
425
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 605590) AND (b.`id_shop` = 1) LIMIT 1
0.157 ms 1 /src/Adapter/EntityMapper.php:71
190
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 576485 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 576485 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.156 ms 0 /classes/Cart.php:1430
407
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 573233) AND (b.`id_shop` = 1) LIMIT 1
0.155 ms 1 /src/Adapter/EntityMapper.php:71
248
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 10087 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 10087 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.154 ms 0 /classes/Cart.php:1430
399
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 597831
ORDER BY `position`
0.154 ms 7 Yes /classes/Product.php:3545
411
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 10087
ORDER BY `position`
0.154 ms 5 Yes /classes/Product.php:3545
235
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 573233 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 573233 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.152 ms 0 /classes/Cart.php:1430
486
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (573843) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.152 ms 1 Yes Yes /classes/Product.php:4524
356
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 565904
ORDER BY f.position ASC
0.151 ms 2 Yes /classes/Product.php:6021
201
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 597831 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 597831 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.151 ms 0 /classes/Cart.php:1430
420
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 40036
ORDER BY `position`
0.150 ms 6 Yes /classes/Product.php:3545
440
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 600667) AND (b.`id_shop` = 1) LIMIT 1
0.150 ms 1 /src/Adapter/EntityMapper.php:71
488
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (592103) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.150 ms 1 Yes Yes /classes/Product.php:4524
476
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (597831) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.148 ms 1 Yes Yes /classes/Product.php:4524
416
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 10086) AND (b.`id_shop` = 1) LIMIT 1
0.147 ms 1 /src/Adapter/EntityMapper.php:71
491
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (542263) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.147 ms 1 Yes Yes /classes/Product.php:4524
2
SELECT SQL_NO_CACHE gs.*, s.*, gs.name AS group_name, s.name AS shop_name, s.active, su.domain, su.domain_ssl, su.physical_uri, su.virtual_uri
FROM een_shop_group gs
LEFT JOIN een_shop s
ON s.id_shop_group = gs.id_shop_group
LEFT JOIN een_shop_url su
ON s.id_shop = su.id_shop AND su.main = 1
WHERE s.deleted = 0
AND gs.deleted = 0
ORDER BY gs.name, s.name
0.147 ms 1 Yes /classes/shop/Shop.php:715
480
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (10087) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.147 ms 1 Yes Yes /classes/Product.php:4524
481
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4997) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.146 ms 1 Yes Yes /classes/Product.php:4524
191
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 576485
ORDER BY f.position ASC
0.145 ms 2 Yes /classes/Product.php:6021
423
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 605174
ORDER BY `position`
0.145 ms 7 Yes /classes/Product.php:3545
437
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 565904) AND (b.`id_shop` = 1) LIMIT 1
0.145 ms 1 /src/Adapter/EntityMapper.php:71
443
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 542263) AND (b.`id_shop` = 1) LIMIT 1
0.145 ms 1 /src/Adapter/EntityMapper.php:71
484
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (605174) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.145 ms 1 Yes Yes /classes/Product.php:4524
485
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (605590) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.145 ms 1 Yes Yes /classes/Product.php:4524
174
SELECT SQL_NO_CACHE tr.*
FROM `een_tax_rule` tr
JOIN `een_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 21
AND tr.`id_tax_rules_group` = 1
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.144 ms 1 /classes/tax/TaxRulesTaxManager.php:109
487
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (606782) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.144 ms 1 Yes Yes /classes/Product.php:4524
294
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 605174)
0.143 ms 1 /classes/Product.php:3860
450
SELECT SQL_NO_CACHE * FROM `een_cart_rule` cr
LEFT JOIN `een_cart_rule_lang` crl 
ON (cr.`id_cart_rule` = crl.`id_cart_rule` AND crl.`id_lang` = 1) WHERE (cr.`id_customer` = 0) AND NOW() BETWEEN cr.date_from AND cr.date_to
AND cr.`active` = 1
AND free_shipping = 1 AND carrier_restriction = 1
0.142 ms 1 /classes/CartRule.php:423
475
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (576485) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.142 ms 1 Yes Yes /classes/Product.php:4524
413
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4997) AND (b.`id_shop` = 1) LIMIT 1
0.142 ms 1 /src/Adapter/EntityMapper.php:71
452
SELECT SQL_NO_CACHE * FROM `een_cart_rule` cr
LEFT JOIN `een_cart_rule_lang` crl 
ON (cr.`id_cart_rule` = crl.`id_cart_rule` AND crl.`id_lang` = 0) WHERE (cr.`id_customer` = 0) AND NOW() BETWEEN cr.date_from AND cr.date_to
AND cr.`active` = 1
AND cr.`quantity` > 0 AND highlight = 1 AND code NOT LIKE "BO_ORDER_%"
0.141 ms 1 /classes/CartRule.php:423
441
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 600667
ORDER BY `position`
0.138 ms 10 Yes /classes/Product.php:3545
482
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (10086) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.138 ms 1 Yes Yes /classes/Product.php:4524
438
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 565904
ORDER BY `position`
0.137 ms 7 Yes /classes/Product.php:3545
444
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 542263
ORDER BY `position`
0.137 ms 7 Yes /classes/Product.php:3545
100
SELECT SQL_NO_CACHE *
FROM `een_gmcp_feeds` ff
WHERE (ff.iso_lang="fr") AND (ff.id_shop=1)
ORDER BY ff.feed_is_default ASC
0.137 ms 370 Yes /modules/gmerchantcenterpro/models/Feeds.php:72
202
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 597831
ORDER BY f.position ASC
0.136 ms 2 Yes /classes/Product.php:6021
483
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (40036) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.135 ms 1 Yes Yes /classes/Product.php:4524
334
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 592103
AND image_shop.`cover` = 1 LIMIT 1
0.135 ms 8 /classes/Product.php:3570
236
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 573233
ORDER BY f.position ASC
0.134 ms 2 Yes /classes/Product.php:6021
426
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 605590
ORDER BY `position`
0.134 ms 8 Yes /classes/Product.php:3545
396
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 576485
ORDER BY `position`
0.133 ms 7 Yes /classes/Product.php:3545
447
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 563542
ORDER BY `position`
0.132 ms 8 Yes /classes/Product.php:3545
477
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (596002) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.132 ms 1 Yes Yes /classes/Product.php:4524
478
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (565876) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.131 ms 1 Yes Yes /classes/Product.php:4524
215
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 565876
AND image_shop.`cover` = 1 LIMIT 1
0.130 ms 8 /classes/Product.php:3570
41
SELECT SQL_NO_CACHE *
FROM een_meta m
LEFT JOIN een_meta_lang ml ON m.id_meta = ml.id_meta
WHERE (
m.page = "prices-drop"
OR m.page = "pricesdrop"
)
AND ml.id_lang = 1
AND ml.id_shop = 1 LIMIT 1
0.129 ms 2 /classes/Meta.php:193
159
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 590850
AND image_shop.`cover` = 1 LIMIT 1
0.129 ms 8 /classes/Product.php:3570
339
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 592103)
0.129 ms 1 /classes/Product.php:3860
220
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 565876)
0.128 ms 1 /classes/Product.php:3860
351
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 565904)
0.127 ms 1 /classes/Product.php:3860
269
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 10086)
0.126 ms 1 /classes/Product.php:3860
479
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (573233) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.126 ms 1 Yes Yes /classes/Product.php:4524
414
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4997
ORDER BY `position`
0.125 ms 5 Yes /classes/Product.php:3545
12
SELECT SQL_NO_CACHE COUNT(DISTINCT l.id_lang) FROM `een_lang` l
JOIN een_lang_shop lang_shop ON (lang_shop.id_lang = l.id_lang AND lang_shop.id_shop = 1)
WHERE l.`active` = 1 LIMIT 1
0.124 ms 1 /classes/Language.php:1216
287
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 605174
AND image_shop.`cover` = 1 LIMIT 1
0.124 ms 7 /classes/Product.php:3570
1
SELECT SQL_NO_CACHE s.id_shop, CONCAT(su.physical_uri, su.virtual_uri) AS uri, su.domain, su.main
FROM een_shop_url su
LEFT JOIN een_shop s ON (s.id_shop = su.id_shop)
WHERE (su.domain = 'decozzia.com' OR su.domain_ssl = 'decozzia.com')
AND s.active = 1
AND s.deleted = 0
ORDER BY LENGTH(CONCAT(su.physical_uri, su.virtual_uri)) DESC
0.122 ms 1 Yes /classes/shop/Shop.php:1364
328
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 606782)
0.122 ms 1 /classes/Product.php:3860
417
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 10086
ORDER BY `position`
0.120 ms 5 Yes /classes/Product.php:3545
300
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 605590
AND image_shop.`cover` = 1 LIMIT 1
0.119 ms 8 /classes/Product.php:3570
192
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 597831
AND image_shop.`cover` = 1 LIMIT 1
0.118 ms 7 /classes/Product.php:3570
281
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 40036)
0.118 ms 1 /classes/Product.php:3860
317
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 573843)
0.118 ms 1 /classes/Product.php:3860
323
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 606782
AND image_shop.`cover` = 1 LIMIT 1
0.117 ms 8 /classes/Product.php:3570
451
SELECT SQL_NO_CACHE 1 FROM `een_cart_rule` WHERE ((date_to >= "2026-05-04 00:00:00" AND date_to <= "2026-05-04 23:59:59") OR (date_from >= "2026-05-04 00:00:00" AND date_from <= "2026-05-04 23:59:59") OR (date_from < "2026-05-04 00:00:00" AND date_to > "2026-05-04 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
0.117 ms 2 /classes/CartRule.php:357
275
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 40036
AND image_shop.`cover` = 1 LIMIT 1
0.116 ms 6 /classes/Product.php:3570
151
SELECT SQL_NO_CACHE *
FROM `een_category` a
LEFT JOIN `een_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `een_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 2) AND (b.`id_shop` = 1) LIMIT 1
0.116 ms 1 /src/Adapter/EntityMapper.php:71
209
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 596002)
0.115 ms 1 /classes/Product.php:3860
306
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 605590)
0.110 ms 1 /classes/Product.php:3860
362
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 600667)
0.110 ms 1 /classes/Product.php:3860
368
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 542263
AND image_shop.`cover` = 1 LIMIT 1
0.110 ms 7 /classes/Product.php:3570
181
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 576485
AND image_shop.`cover` = 1 LIMIT 1
0.108 ms 7 /classes/Product.php:3570
345
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 565904
AND image_shop.`cover` = 1 LIMIT 1
0.107 ms 7 /classes/Product.php:3570
312
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 573843
AND image_shop.`cover` = 1 LIMIT 1
0.107 ms 8 /classes/Product.php:3570
380
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 563542
AND image_shop.`cover` = 1 LIMIT 1
0.106 ms 8 /classes/Product.php:3570
374
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 542263)
0.106 ms 1 /classes/Product.php:3860
263
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 10086
AND image_shop.`cover` = 1 LIMIT 1
0.105 ms 5 /classes/Product.php:3570
170
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 590850)
0.104 ms 1 /classes/Product.php:3860
203
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 596002
AND image_shop.`cover` = 1 LIMIT 1
0.104 ms 10 /classes/Product.php:3570
186
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 576485)
0.104 ms 1 /classes/Product.php:3860
385
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 563542)
0.102 ms 1 /classes/Product.php:3860
28
SELECT SQL_NO_CACHE *
FROM `een_currency` a
LEFT JOIN `een_currency_lang` `b` ON a.`id_currency` = b.`id_currency` AND b.`id_lang` = 1
LEFT JOIN `een_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
0.100 ms 1 /src/Adapter/EntityMapper.php:71
453
SELECT SQL_NO_CACHE COUNT(*) FROM `een_orders` o
LEFT JOIN `een_order_cart_rule` ocr ON (ocr.`id_order` = o.`id_order`)
WHERE o.`id_customer` = 0
AND ocr.`deleted` = 0 AND ocr.`id_cart_rule` = 0 LIMIT 1
0.099 ms 1 /classes/order/Order.php:881
197
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 597831)
0.099 ms 1 /classes/Product.php:3860
244
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 10087)
0.098 ms 1 /classes/Product.php:3860
257
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4997)
0.098 ms 1 /classes/Product.php:3860
5
SELECT SQL_NO_CACHE su.physical_uri, su.virtual_uri, su.domain, su.domain_ssl
FROM een_shop s
LEFT JOIN een_shop_url su ON (s.id_shop = su.id_shop)
WHERE s.id_shop = 1
AND s.active = 1 AND s.deleted = 0 AND su.main = 1 LIMIT 1
0.097 ms 1 /classes/shop/Shop.php:218
266
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 10086 LIMIT 1
0.097 ms 1 /classes/SpecificPrice.php:435
348
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 565904 LIMIT 1
0.097 ms 1 /classes/SpecificPrice.php:435
15
SELECT SQL_NO_CACHE `name`, `alias` FROM `een_hook_alias`
0.095 ms 87 /classes/Hook.php:287
342
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 592103) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.094 ms 1 /classes/stock/StockAvailable.php:453
388
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 563542) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.094 ms 1 /classes/stock/StockAvailable.php:453
231
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 573233)
0.093 ms 1 /classes/Product.php:3860
9
SELECT SQL_NO_CACHE *
FROM `een_lang` a
LEFT JOIN `een_lang_shop` `c` ON a.`id_lang` = c.`id_lang` AND c.`id_shop` = 1
WHERE (a.`id_lang` = 1) LIMIT 1
0.092 ms 1 /src/Adapter/EntityMapper.php:71
250
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4997
AND image_shop.`cover` = 1 LIMIT 1
0.092 ms 5 /classes/Product.php:3570
11
SELECT SQL_NO_CACHE domain, domain_ssl
FROM een_shop_url
WHERE main = 1
AND id_shop = 1 LIMIT 1
0.091 ms 1 /classes/shop/ShopUrl.php:182
297
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 605174) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.091 ms 1 /classes/stock/StockAvailable.php:453
226
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 573233
AND image_shop.`cover` = 1 LIMIT 1
0.089 ms 7 /classes/Product.php:3570
177
SELECT SQL_NO_CACHE tr.*
FROM `een_tax_rule` tr
JOIN `een_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 21
AND tr.`id_tax_rules_group` = 0
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.088 ms 0 /classes/tax/TaxRulesTaxManager.php:109
25
SELECT SQL_NO_CACHE * FROM `een_currency` c ORDER BY `iso_code` ASC
0.087 ms 1 Yes /classes/Currency.php:709
107
SELECT SQL_NO_CACHE c.id_currency
FROM `een_currency` c
WHERE (deleted = 0) AND (iso_code = 'TND') LIMIT 1
0.087 ms 1 /classes/Currency.php:893
320
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 573843) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.086 ms 1 /classes/stock/StockAvailable.php:453
357
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 600667
AND image_shop.`cover` = 1 LIMIT 1
0.086 ms 10 /classes/Product.php:3570
237
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 10087
AND image_shop.`cover` = 1 LIMIT 1
0.085 ms 5 /classes/Product.php:3570
284
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 40036) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.085 ms 1 /classes/stock/StockAvailable.php:453
394
SELECT SQL_NO_CACHE state FROM een_feature_flag WHERE name = 'multiple_image_format' LIMIT 1
0.084 ms 1 /classes/FeatureFlag.php:105
178
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 590850) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.084 ms 1 /classes/stock/StockAvailable.php:453
7
SELECT SQL_NO_CACHE *
FROM `een_country` a
LEFT JOIN `een_country_lang` `b` ON a.`id_country` = b.`id_country` AND b.`id_lang` = 1
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 8) LIMIT 1
0.082 ms 1 /src/Adapter/EntityMapper.php:71
354
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 565904) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.082 ms 1 /classes/stock/StockAvailable.php:453
430
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 573843
0.082 ms 1 /classes/Product.php:2902
223
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 565876) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.081 ms 1 /classes/stock/StockAvailable.php:453
278
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 40036 LIMIT 1
0.081 ms 1 /classes/SpecificPrice.php:435
44
SELECT SQL_NO_CACHE * FROM `een_image_type` WHERE 1 AND `products` = 1  ORDER BY `width` DESC, `height` DESC, `name`ASC
0.080 ms 8 Yes /classes/ImageType.php:109
436
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 592103
0.079 ms 1 /classes/Product.php:2902
19
SELECT SQL_NO_CACHE name, alias FROM `een_hook_alias`
0.079 ms 87 /classes/Hook.php:339
314
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 573843 LIMIT 1
0.079 ms 1 /classes/SpecificPrice.php:435
212
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 596002) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.078 ms 1 /classes/stock/StockAvailable.php:453
309
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 605590) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.078 ms 1 /classes/stock/StockAvailable.php:453
465
SELECT SQL_NO_CACHE SUM(`quantity`)
FROM `een_cart_product`
WHERE `id_cart` = 0 LIMIT 1
0.078 ms 1 /classes/Cart.php:1303
521
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "iqitcookielaw" LIMIT 1
0.078 ms 1 /classes/module/Module.php:2659
17
SELECT SQL_NO_CACHE value FROM `een_configuration` WHERE `name` = "PS_MULTISHOP_FEATURE_ACTIVE" LIMIT 1
0.077 ms 1 /classes/shop/Shop.php:1183
31
SELECT SQL_NO_CACHE *
FROM `een_country` a
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 21) LIMIT 1
0.077 ms 1 /src/Adapter/EntityMapper.php:71
393
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 590850
0.077 ms 1 /classes/Product.php:2902
4
SELECT SQL_NO_CACHE *
FROM `een_shop` a
WHERE (a.`id_shop` = 1) LIMIT 1
0.076 ms 1 /src/Adapter/EntityMapper.php:71
6
SELECT SQL_NO_CACHE l.*, ls.`id_shop`
FROM `een_lang` l
LEFT JOIN `een_lang_shop` ls ON (l.id_lang = ls.id_lang)
0.076 ms 1 /classes/Language.php:1080
175
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 590850 AND `id_group` = 1 LIMIT 1
0.076 ms 0 /classes/GroupReduction.php:156
433
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 606782
0.076 ms 1 /classes/Product.php:2902
365
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 600667) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.076 ms 1 /classes/stock/StockAvailable.php:453
116
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'FR' LIMIT 1
0.074 ms 1 /classes/Country.php:194
412
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 10087
0.074 ms 1 /classes/Product.php:2902
114
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'FR' LIMIT 1
0.073 ms 1 /classes/Country.php:194
194
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 597831 LIMIT 1
0.073 ms 1 /classes/SpecificPrice.php:435
424
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 605174
0.073 ms 1 /classes/Product.php:2902
30
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'US' LIMIT 1
0.072 ms 1 /classes/Country.php:194
260
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 4997) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.072 ms 1 /classes/stock/StockAvailable.php:453
318
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 573843 AND id_shop=1 LIMIT 1
0.072 ms 1 /classes/Product.php:6876
397
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 576485
0.072 ms 1 /classes/Product.php:2902
403
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 596002
0.072 ms 1 /classes/Product.php:2902
165
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE `id_product` != 0 LIMIT 1
0.071 ms 1442 /classes/SpecificPrice.php:297
427
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 605590
0.071 ms 1 /classes/Product.php:2902
120
SELECT SQL_NO_CACHE *
FROM `een_country` a
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 19) LIMIT 1
0.071 ms 1 /src/Adapter/EntityMapper.php:71
409
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 573233
0.071 ms 1 /classes/Product.php:2902
23
SELECT SQL_NO_CACHE * FROM `een_hook_module_exceptions`
WHERE `id_shop` IN (1)
0.070 ms 1 /classes/module/Module.php:2041
57
CREATE TABLE IF NOT EXISTS `een_gmcp_reporting` (`id_reporting` int(11) NOT NULL AUTO_INCREMENT,`iso_feed` LONGTEXT NOT NULL,    `reporting_content` LONGTEXT NOT NULL,`id_shop` int(11) NOT NULL,`date_add` datetime NOT NULL,`date_upd` datetime NOT NULL,PRIMARY KEY (`id_reporting`)) ENGINE=' . _MYSQL_ENGINE_ . ' DEFAULT CHARSET=utf8;
0.070 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
117
SELECT SQL_NO_CACHE c.id_currency
FROM `een_currency` c
WHERE (deleted = 0) AND (iso_code = 'MAD') LIMIT 1
0.070 ms 1 /classes/Currency.php:893
163
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 0 LIMIT 1
0.070 ms 1 /classes/SpecificPrice.php:426
288
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 997 LIMIT 1
0.070 ms 1 /classes/Category.php:1378
421
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 40036
0.070 ms 1 /classes/Product.php:2902
36
SELECT SQL_NO_CACHE *
FROM `een_group` a
LEFT JOIN `een_group_shop` `c` ON a.`id_group` = c.`id_group` AND c.`id_shop` = 1
WHERE (a.`id_group` = 1) LIMIT 1
0.070 ms 1 /src/Adapter/EntityMapper.php:71
166
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE `from` BETWEEN '2026-05-04 00:00:00' AND '2026-05-04 23:59:59' LIMIT 1
0.070 ms 1 /classes/SpecificPrice.php:377
313
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 5727 LIMIT 1
0.070 ms 1 /classes/Product.php:5659
456
SELECT SQL_NO_CACHE COUNT(DISTINCT c.id_currency) FROM `een_currency` c
LEFT JOIN een_currency_shop cs ON (cs.id_currency = c.id_currency AND cs.id_shop = 1)
WHERE c.`active` = 1 AND c.`deleted` = 0 LIMIT 1
0.070 ms 1 /classes/Currency.php:1136
21
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "ets_superspeed" LIMIT 1
0.069 ms 0 /classes/module/Module.php:2659
98
SELECT SQL_NO_CACHE id_feed
FROM `een_gmcp_feeds` ff
WHERE (ff.id_shop=1) LIMIT 1
0.069 ms 370 /modules/gmerchantcenterpro/models/Feeds.php:53
111
SELECT SQL_NO_CACHE c.id_currency
FROM `een_currency` c
WHERE (deleted = 0) AND (iso_code = 'XAF') LIMIT 1
0.069 ms 1 /classes/Currency.php:893
134
SELECT SQL_NO_CACHE id_order
FROM `een_orders` o
WHERE (o.id_cart=0) LIMIT 1
0.069 ms 1 /modules/gmerchantcenterpro/lib/dao/moduleDao.php:450
193
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 411 LIMIT 1
0.069 ms 1 /classes/Product.php:5659
47
SELECT SQL_NO_CACHE *
FROM `een_country` a
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 17) LIMIT 1
0.069 ms 1 /src/Adapter/EntityMapper.php:71
210
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 596002 AND id_shop=1 LIMIT 1
0.069 ms 1 /classes/Product.php:6876
382
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 563542 LIMIT 1
0.068 ms 1 /classes/SpecificPrice.php:435
454
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "iqitlinksmanager" LIMIT 1
0.068 ms 1 /classes/module/Module.php:2659
26
SELECT SQL_NO_CACHE `id_lang` FROM `een_lang`
WHERE `locale` = 'fr-fr'
OR `language_code` = 'fr-fr' LIMIT 1
0.068 ms 1 /classes/Language.php:883
45
SELECT SQL_NO_CACHE format
FROM `een_address_format`
WHERE `id_country` = 17 LIMIT 1
0.068 ms 1 /classes/AddressFormat.php:656
160
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 411 LIMIT 1
0.068 ms 1 /classes/Category.php:1378
258
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 4997 AND id_shop=1 LIMIT 1
0.068 ms 1 /classes/Product.php:6876
331
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 606782) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.068 ms 1 /classes/stock/StockAvailable.php:453
33
SELECT SQL_NO_CACHE *
FROM `een_currency` a
LEFT JOIN `een_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
0.067 ms 1 /src/Adapter/EntityMapper.php:71
51
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "pm_advancedpack" LIMIT 1
0.067 ms 0 /classes/module/Module.php:2659
109
SELECT SQL_NO_CACHE c.id_currency
FROM `een_currency` c
WHERE (deleted = 0) AND (iso_code = 'DZD') LIMIT 1
0.067 ms 1 /classes/Currency.php:893
115
SELECT SQL_NO_CACHE c.id_currency
FROM `een_currency` c
WHERE (deleted = 0) AND (iso_code = 'MGA') LIMIT 1
0.067 ms 1 /classes/Currency.php:893
135
SELECT SQL_NO_CACHE `name`
FROM `een_hook`
WHERE `id_hook` = 1013 LIMIT 1
0.067 ms 1 /classes/Hook.php:244
329
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 606782 AND id_shop=1 LIMIT 1
0.067 ms 1 /classes/Product.php:6876
336
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 592103 LIMIT 1
0.067 ms 1 /classes/SpecificPrice.php:435
371
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 542263 LIMIT 1
0.067 ms 1 /classes/SpecificPrice.php:435
103
SELECT SQL_NO_CACHE *
FROM `een_country` a
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 8) LIMIT 1
0.066 ms 1 /src/Adapter/EntityMapper.php:71
124
SELECT SQL_NO_CACHE *
FROM `een_country` a
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 4) LIMIT 1
0.066 ms 1 /src/Adapter/EntityMapper.php:71
128
SELECT SQL_NO_CACHE *
FROM `een_country` a
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 3) LIMIT 1
0.066 ms 1 /src/Adapter/EntityMapper.php:71
183
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 576485 LIMIT 1
0.066 ms 1 /classes/SpecificPrice.php:435
217
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 565876 LIMIT 1
0.066 ms 1 /classes/SpecificPrice.php:435
272
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 10086) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.066 ms 1 /classes/stock/StockAvailable.php:453
468
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "iqitproductsnav" LIMIT 1
0.066 ms 1 /classes/module/Module.php:2659
289
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 997 LIMIT 1
0.066 ms 1 /classes/Product.php:5659
439
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 565904
0.066 ms 1 /classes/Product.php:2902
519
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "iqitsociallogin" LIMIT 1
0.066 ms 1 /classes/module/Module.php:2659
108
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'FR' LIMIT 1
0.065 ms 1 /classes/Country.php:194
221
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 565876 AND id_shop=1 LIMIT 1
0.065 ms 1 /classes/Product.php:6876
325
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 606782 LIMIT 1
0.065 ms 1 /classes/SpecificPrice.php:435
442
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 600667
0.065 ms 1 /classes/Product.php:2902
470
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "ps_facetedsearch" LIMIT 1
0.065 ms 1 /classes/module/Module.php:2659
132
SELECT SQL_NO_CACHE *
FROM `een_country` a
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 186) LIMIT 1
0.065 ms 1 /src/Adapter/EntityMapper.php:71
270
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 10086 AND id_shop=1 LIMIT 1
0.065 ms 1 /classes/Product.php:6876
162
SELECT SQL_NO_CACHE `name`
FROM `een_manufacturer`
WHERE `id_manufacturer` = 11523
AND `active` = 1 LIMIT 1
0.064 ms 1 /classes/Manufacturer.php:316
167
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE `to` BETWEEN '2026-05-04 00:00:00' AND '2026-05-04 23:59:59' LIMIT 1
0.064 ms 1 /classes/SpecificPrice.php:381
290
SELECT SQL_NO_CACHE `name`
FROM `een_manufacturer`
WHERE `id_manufacturer` = 11543
AND `active` = 1 LIMIT 1
0.064 ms 1 /classes/Manufacturer.php:316
295
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 605174 AND id_shop=1 LIMIT 1
0.064 ms 1 /classes/Product.php:6876
400
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 597831
0.064 ms 1 /classes/Product.php:2902
241
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 10087 LIMIT 1
0.064 ms 1 /classes/SpecificPrice.php:435
341
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 592103 AND `id_group` = 1 LIMIT 1
0.064 ms 0 /classes/GroupReduction.php:156
164
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 590850 LIMIT 1
0.063 ms 1 /classes/SpecificPrice.php:435
303
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 605590 LIMIT 1
0.063 ms 1 /classes/SpecificPrice.php:435
377
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 542263) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.063 ms 1 /classes/stock/StockAvailable.php:453
27
SELECT SQL_NO_CACHE c.id_currency
FROM `een_currency` c
WHERE (iso_code = 'EUR') LIMIT 1
0.063 ms 1 /classes/Currency.php:893
176
SELECT SQL_NO_CACHE `reduction`
FROM `een_group`
WHERE `id_group` = 1 LIMIT 1
0.063 ms 1 /classes/Group.php:154
187
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 576485 AND id_shop=1 LIMIT 1
0.063 ms 1 /classes/Product.php:6876
264
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 367 LIMIT 1
0.063 ms 1 /classes/Category.php:1378
42
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "ps_legalcompliance" LIMIT 1
0.062 ms 0 /classes/module/Module.php:2659
113
SELECT SQL_NO_CACHE c.id_currency
FROM `een_currency` c
WHERE (deleted = 0) AND (iso_code = 'XOF') LIMIT 1
0.062 ms 1 /classes/Currency.php:893
126
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'BE' LIMIT 1
0.062 ms 1 /classes/Country.php:194
195
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 597831
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.062 ms 0 /classes/SpecificPrice.php:259
218
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 565876
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.062 ms 0 /classes/SpecificPrice.php:259
291
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 605174 LIMIT 1
0.062 ms 1 /classes/SpecificPrice.php:435
349
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 565904
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.062 ms 0 /classes/SpecificPrice.php:259
369
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 1021 LIMIT 1
0.062 ms 1 /classes/Category.php:1378
418
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 10086
0.062 ms 1 /classes/Product.php:2902
10
SELECT SQL_NO_CACHE id_shop
FROM `een_lang_shop`
WHERE `id_lang` = 1
AND id_shop = 1 LIMIT 1
0.061 ms 1 /classes/ObjectModel.php:1729
267
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 10086
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.061 ms 0 /classes/SpecificPrice.php:259
301
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 997 LIMIT 1
0.061 ms 1 /classes/Product.php:5659
307
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 605590 AND id_shop=1 LIMIT 1
0.061 ms 1 /classes/Product.php:6876
324
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 997 LIMIT 1
0.061 ms 1 /classes/Product.php:5659
340
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 592103 AND id_shop=1 LIMIT 1
0.061 ms 1 /classes/Product.php:6876
445
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 542263
0.061 ms 1 /classes/Product.php:2902
32
SELECT SQL_NO_CACHE *
FROM `een_country_lang`
WHERE `id_country` = 21
0.060 ms 1 /src/Adapter/EntityMapper.php:79
105
SELECT SQL_NO_CACHE c.id_currency
FROM `een_currency` c
WHERE (deleted = 0) AND (iso_code = 'EUR') LIMIT 1
0.060 ms 1 /classes/Currency.php:893
308
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 605590 AND `id_group` = 1 LIMIT 1
0.060 ms 0 /classes/GroupReduction.php:156
346
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 1020 LIMIT 1
0.060 ms 1 /classes/Category.php:1378
0
SELECT SQL_NO_CACHE * FROM een_memcached_servers
0.060 ms 1 /classes/cache/CacheMemcached.php:263
110
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'FR' LIMIT 1
0.060 ms 1 /classes/Country.php:194
122
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'CA' LIMIT 1
0.060 ms 1 /classes/Country.php:194
204
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 5727 LIMIT 1
0.060 ms 1 /classes/Category.php:1378
121
SELECT SQL_NO_CACHE *
FROM `een_country_lang`
WHERE `id_country` = 19
0.059 ms 1 /src/Adapter/EntityMapper.php:79
216
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 5727 LIMIT 1
0.059 ms 1 /classes/Product.php:5659
372
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 542263
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.059 ms 0 /classes/SpecificPrice.php:259
381
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1021 LIMIT 1
0.059 ms 1 /classes/Product.php:5659
29
SELECT SQL_NO_CACHE `id_lang` FROM `een_lang`
WHERE `locale` = 'fr-fr'
OR `language_code` = 'fr-fr' LIMIT 1
0.059 ms 1 /classes/Language.php:883
211
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 596002 AND `id_group` = 1 LIMIT 1
0.059 ms 0 /classes/GroupReduction.php:156
292
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 605174
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.059 ms 0 /classes/SpecificPrice.php:259
347
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1020 LIMIT 1
0.059 ms 1 /classes/Product.php:5659
352
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 565904 AND id_shop=1 LIMIT 1
0.059 ms 1 /classes/Product.php:6876
283
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 40036 AND `id_group` = 1 LIMIT 1
0.058 ms 0 /classes/GroupReduction.php:156
39
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "facebookproductsfeed" LIMIT 1
0.058 ms 0 /classes/module/Module.php:2659
48
SELECT SQL_NO_CACHE *
FROM `een_country_lang`
WHERE `id_country` = 17
0.058 ms 1 /src/Adapter/EntityMapper.php:79
101
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'FR' LIMIT 1
0.058 ms 1 /classes/Country.php:194
118
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'CH' LIMIT 1
0.058 ms 1 /classes/Country.php:194
130
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'SA' LIMIT 1
0.058 ms 1 /classes/Country.php:194
161
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 411 LIMIT 1
0.058 ms 1 /classes/Product.php:5659
259
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 4997 AND `id_group` = 1 LIMIT 1
0.058 ms 0 /classes/GroupReduction.php:156
276
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 369 LIMIT 1
0.058 ms 1 /classes/Category.php:1378
315
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 573843
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.058 ms 0 /classes/SpecificPrice.php:259
335
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 997 LIMIT 1
0.058 ms 1 /classes/Product.php:5659
363
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 600667 AND id_shop=1 LIMIT 1
0.058 ms 1 /classes/Product.php:6876
406
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 565876
0.058 ms 1 /classes/Product.php:2902
493
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "supercheckout" LIMIT 1
0.058 ms 0 /classes/module/Module.php:2659
112
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'FR' LIMIT 1
0.057 ms 1 /classes/Country.php:194
189
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 576485) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.057 ms 1 /classes/stock/StockAvailable.php:453
206
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 596002 LIMIT 1
0.057 ms 1 /classes/SpecificPrice.php:435
222
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 565876 AND `id_group` = 1 LIMIT 1
0.057 ms 0 /classes/GroupReduction.php:156
457
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "ps_languageselector" LIMIT 1
0.057 ms 1 /classes/module/Module.php:2659
472
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "iqitcountdown" LIMIT 1
0.057 ms 1 /classes/module/Module.php:2659
129
SELECT SQL_NO_CACHE *
FROM `een_country_lang`
WHERE `id_country` = 3
0.056 ms 1 /src/Adapter/EntityMapper.php:79
133
SELECT SQL_NO_CACHE *
FROM `een_country_lang`
WHERE `id_country` = 186
0.056 ms 1 /src/Adapter/EntityMapper.php:79
168
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 590850
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.056 ms 0 /classes/SpecificPrice.php:259
171
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 590850 AND id_shop=1 LIMIT 1
0.056 ms 1 /classes/Product.php:6876
279
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 40036
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.056 ms 0 /classes/SpecificPrice.php:259
282
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 40036 AND id_shop=1 LIMIT 1
0.056 ms 1 /classes/Product.php:6876
277
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 369 LIMIT 1
0.055 ms 1 /classes/Product.php:5659
302
SELECT SQL_NO_CACHE `name`
FROM `een_manufacturer`
WHERE `id_manufacturer` = 11545
AND `active` = 1 LIMIT 1
0.055 ms 1 /classes/Manufacturer.php:316
375
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 542263 AND id_shop=1 LIMIT 1
0.055 ms 1 /classes/Product.php:6876
448
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 563542
0.055 ms 1 /classes/Product.php:2902
37
SELECT SQL_NO_CACHE *
FROM `een_group_lang`
WHERE `id_group` = 1
0.054 ms 1 /src/Adapter/EntityMapper.php:79
304
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 605590
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.054 ms 0 /classes/SpecificPrice.php:259
509
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "attributewizardpro" LIMIT 1
0.054 ms 0 /classes/module/Module.php:2659
34
SELECT SQL_NO_CACHE *
FROM `een_currency_lang`
WHERE `id_currency` = 1
0.054 ms 1 /src/Adapter/EntityMapper.php:79
125
SELECT SQL_NO_CACHE *
FROM `een_country_lang`
WHERE `id_country` = 4
0.054 ms 1 /src/Adapter/EntityMapper.php:79
265
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 367 LIMIT 1
0.054 ms 1 /classes/Product.php:5659
319
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 573843 AND `id_group` = 1 LIMIT 1
0.053 ms 0 /classes/GroupReduction.php:156
415
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 4997
0.053 ms 1 /classes/Product.php:2902
376
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 542263 AND `id_group` = 1 LIMIT 1
0.053 ms 0 /classes/GroupReduction.php:156
386
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 563542 AND id_shop=1 LIMIT 1
0.053 ms 1 /classes/Product.php:6876
387
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 563542 AND `id_group` = 1 LIMIT 1
0.053 ms 0 /classes/GroupReduction.php:156
182
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 411 LIMIT 1
0.052 ms 1 /classes/Product.php:5659
22
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.052 ms 0 /classes/module/Module.php:2132
50
SELECT SQL_NO_CACHE * FROM een_revslider_sliders
0.052 ms 1 /modules/revsliderprestashop/includes/revslider_db.class.php:214
49
SELECT SQL_NO_CACHE id_required_field, object_name, field_name
FROM een_required_field
0.051 ms 1 /classes/ObjectModel.php:1592
119
SELECT SQL_NO_CACHE `name`
FROM `een_country_lang`
WHERE `id_lang` = 1
AND `id_country` = 19 LIMIT 1
0.051 ms 1 /classes/Country.php:252
127
SELECT SQL_NO_CACHE `name`
FROM `een_country_lang`
WHERE `id_lang` = 1
AND `id_country` = 3 LIMIT 1
0.051 ms 1 /classes/Country.php:252
242
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 10087
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.051 ms 0 /classes/SpecificPrice.php:259
330
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 606782 AND `id_group` = 1 LIMIT 1
0.051 ms 0 /classes/GroupReduction.php:156
383
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 563542
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.051 ms 0 /classes/SpecificPrice.php:259
466
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "iqitmegamenu" LIMIT 1
0.051 ms 1 /classes/module/Module.php:2659
523
SELECT SQL_NO_CACHE data
FROM `een_ganalytics_data`
WHERE id_cart = 0
AND id_shop = 1 LIMIT 1
0.051 ms 0 /modules/ps_googleanalytics/classes/Repository/GanalyticsDataRepository.php:43
228
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 573233 LIMIT 1
0.050 ms 1 /classes/SpecificPrice.php:435
234
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 573233) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.050 ms 1 /classes/stock/StockAvailable.php:453
326
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 606782
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.050 ms 0 /classes/SpecificPrice.php:259
370
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1021 LIMIT 1
0.050 ms 1 /classes/Product.php:5659
494
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.050 ms 0 /classes/module/Module.php:2132
40
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.050 ms 0 /classes/module/Module.php:2132
131
SELECT SQL_NO_CACHE `name`
FROM `een_country_lang`
WHERE `id_lang` = 1
AND `id_country` = 186 LIMIT 1
0.049 ms 1 /classes/Country.php:252
251
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 253 LIMIT 1
0.049 ms 1 /classes/Category.php:1378
455
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 78 AND `id_shop` = 1 LIMIT 1
0.049 ms 1 /classes/module/Module.php:2132
8
SELECT SQL_NO_CACHE *
FROM `een_shop_group` a
WHERE (a.`id_shop_group` = 1) LIMIT 1
0.049 ms 1 /src/Adapter/EntityMapper.php:71
200
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 597831) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.049 ms 1 /classes/stock/StockAvailable.php:453
245
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 10087 AND id_shop=1 LIMIT 1
0.049 ms 1 /classes/Product.php:6876
35
SELECT SQL_NO_CACHE id_shop
FROM `een_currency_shop`
WHERE `id_currency` = 1
AND id_shop = 1 LIMIT 1
0.048 ms 1 /classes/ObjectModel.php:1729
104
SELECT SQL_NO_CACHE *
FROM `een_country_lang`
WHERE `id_country` = 8
0.048 ms 1 /src/Adapter/EntityMapper.php:79
198
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 597831 AND id_shop=1 LIMIT 1
0.048 ms 1 /classes/Product.php:6876
296
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 605174 AND `id_group` = 1 LIMIT 1
0.048 ms 0 /classes/GroupReduction.php:156
106
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'FR' LIMIT 1
0.048 ms 1 /classes/Country.php:194
123
SELECT SQL_NO_CACHE `name`
FROM `een_country_lang`
WHERE `id_lang` = 1
AND `id_country` = 4 LIMIT 1
0.048 ms 1 /classes/Country.php:252
238
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 742 LIMIT 1
0.048 ms 1 /classes/Category.php:1378
247
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 10087) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.048 ms 1 /classes/stock/StockAvailable.php:453
254
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 4997 LIMIT 1
0.048 ms 1 /classes/SpecificPrice.php:435
271
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 10086 AND `id_group` = 1 LIMIT 1
0.048 ms 0 /classes/GroupReduction.php:156
353
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 565904 AND `id_group` = 1 LIMIT 1
0.048 ms 0 /classes/GroupReduction.php:156
359
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 600667 LIMIT 1
0.048 ms 1 /classes/SpecificPrice.php:435
54
SELECT SQL_NO_CACHE * FROM `een_image_type`
0.047 ms 8 /classes/ImageType.php:161
205
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 5727 LIMIT 1
0.047 ms 1 /classes/Product.php:5659
207
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 596002
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.047 ms 0 /classes/SpecificPrice.php:259
227
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 5727 LIMIT 1
0.047 ms 1 /classes/Product.php:5659
337
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 592103
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.047 ms 0 /classes/SpecificPrice.php:259
232
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 573233 AND id_shop=1 LIMIT 1
0.046 ms 1 /classes/Product.php:6876
510
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.046 ms 0 /classes/module/Module.php:2132
515
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "blockwishlist" LIMIT 1
0.046 ms 1 /classes/module/Module.php:2659
522
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 72 AND `id_shop` = 1 LIMIT 1
0.046 ms 1 /classes/module/Module.php:2132
188
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 576485 AND `id_group` = 1 LIMIT 1
0.046 ms 0 /classes/GroupReduction.php:156
43
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.045 ms 0 /classes/module/Module.php:2132
184
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 576485
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.045 ms 0 /classes/SpecificPrice.php:259
459
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "ps_currencyselector" LIMIT 1
0.045 ms 1 /classes/module/Module.php:2659
469
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 81 AND `id_shop` = 1 LIMIT 1
0.045 ms 1 /classes/module/Module.php:2132
495
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "onepagecheckout" LIMIT 1
0.045 ms 0 /classes/module/Module.php:2659
520
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 93 AND `id_shop` = 1 LIMIT 1
0.045 ms 1 /classes/module/Module.php:2132
38
SELECT SQL_NO_CACHE id_shop
FROM `een_group_shop`
WHERE `id_group` = 1
AND id_shop = 1 LIMIT 1
0.045 ms 1 /classes/ObjectModel.php:1729
358
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1020 LIMIT 1
0.045 ms 1 /classes/Product.php:5659
102
SELECT SQL_NO_CACHE `name`
FROM `een_country_lang`
WHERE `id_lang` = 1
AND `id_country` = 8 LIMIT 1
0.044 ms 1 /classes/Country.php:252
463
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "iqitcompare" LIMIT 1
0.044 ms 1 /classes/module/Module.php:2659
517
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "ps_emailsubscription" LIMIT 1
0.044 ms 1 /classes/module/Module.php:2659
46
SELECT SQL_NO_CACHE `need_identification_number`
FROM `een_country`
WHERE `id_country` = 17 LIMIT 1
0.043 ms 1 /classes/Country.php:405
65
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_last_product_not_ordered` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `last_product_ordered` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
0.043 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
458
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 6 AND `id_shop` = 1 LIMIT 1
0.043 ms 1 /classes/module/Module.php:2132
507
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "easycheckout" LIMIT 1
0.043 ms 0 /classes/module/Module.php:2659
508
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.043 ms 0 /classes/module/Module.php:2132
496
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.042 ms 0 /classes/module/Module.php:2132
52
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "gsnippetsreviews" LIMIT 1
0.042 ms 0 /classes/module/Module.php:2659
471
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 24 AND `id_shop` = 1 LIMIT 1
0.041 ms 1 /classes/module/Module.php:2132
64
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_last_product_not_ordered` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `last_product_ordered` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
0.040 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
364
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 600667 AND `id_group` = 1 LIMIT 1
0.040 ms 0 /classes/GroupReduction.php:156
461
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "iqitwishlist" LIMIT 1
0.040 ms 1 /classes/module/Module.php:2659
68
CREATE TABLE IF NOT EXISTS `een_gmcp_taxonomy` (`id_taxonomy` int(11) NOT NULL AUTO_INCREMENT, `value` text NOT NULL, `lang` varchar(5) NOT NULL, PRIMARY KEY (`id_taxonomy`), KEY `lang` (`lang`), FULLTEXT KEY `ft_index` (`value`)) ENGINE=MyISAM DEFAULT CHARSET=utf8 AUTO_INCREMENT=1;
0.039 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
81
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_new_product` (`id_tag` int(11) NOT NULL,  `from_date` DATETIME, `id_product` int,  `id_shop` int(11) NOT NULL,  UNIQUE KEY `tag_new_product` (`id_tag`, `id_product`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
0.039 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
233
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 573233 AND `id_group` = 1 LIMIT 1
0.039 ms 0 /classes/GroupReduction.php:156
460
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 7 AND `id_shop` = 1 LIMIT 1
0.039 ms 1 /classes/module/Module.php:2132
464
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 70 AND `id_shop` = 1 LIMIT 1
0.039 ms 1 /classes/module/Module.php:2132
467
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 79 AND `id_shop` = 1 LIMIT 1
0.039 ms 1 /classes/module/Module.php:2132
239
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 742 LIMIT 1
0.039 ms 1 /classes/Product.php:5659
511
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "cdesigner" LIMIT 1
0.039 ms 0 /classes/module/Module.php:2659
252
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 253 LIMIT 1
0.038 ms 1 /classes/Product.php:5659
91
CREATE TABLE IF NOT EXISTS `een_gmcp_tmp_rules`(`id` int(11) NOT NULL AUTO_INCREMENT, `id_shop` int(11) NOT NULL DEFAULT "1",`type` char(255) NOT NULL, `exclusion_values` longtext NOT NULL, PRIMARY KEY (`id`)) ENGINE=InnoDB DEFAULT CHARSET=utf8 AUTO_INCREMENT=1;
0.038 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
229
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 573233
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.038 ms 0 /classes/SpecificPrice.php:259
240
SELECT SQL_NO_CACHE `name`
FROM `een_manufacturer`
WHERE `id_manufacturer` = 1635
AND `active` = 1 LIMIT 1
0.038 ms 1 /classes/Manufacturer.php:316
253
SELECT SQL_NO_CACHE `name`
FROM `een_manufacturer`
WHERE `id_manufacturer` = 11559
AND `active` = 1 LIMIT 1
0.038 ms 1 /classes/Manufacturer.php:316
473
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 74 AND `id_shop` = 1 LIMIT 1
0.038 ms 1 /classes/module/Module.php:2132
512
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.038 ms 0 /classes/module/Module.php:2132
513
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "configurator" LIMIT 1
0.038 ms 0 /classes/module/Module.php:2659
514
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.038 ms 0 /classes/module/Module.php:2132
67
CREATE TABLE IF NOT EXISTS `een_gmcp_tags` (`id_tag` int(11) NOT NULL AUTO_INCREMENT, `id_shop` int(11) NOT NULL DEFAULT "1", `name` char(255) NOT NULL, `type` char(255) NOT NULL, `active` TINYINT NOT NULL, `position` INT NOT NULL, `end_date` DATE, PRIMARY KEY (`id_tag`)) ENGINE=MyISAM DEFAULT CHARSET=utf8 AUTO_INCREMENT=1 ;
0.037 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
85
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_promotion` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `promotion` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
0.037 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
255
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 4997
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.037 ms 0 /classes/SpecificPrice.php:259
360
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 600667
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.037 ms 0 /classes/SpecificPrice.php:259
53
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "gremarketing" LIMIT 1
0.037 ms 0 /classes/module/Module.php:2659
77
CREATE TABLE IF NOT EXISTS `een_gmcp_features_by_cat` (`id_cat` int(11) NOT NULL DEFAULT '0', `id_shop` int(3) NOT NULL DEFAULT "1", `values` text NOT NULL, PRIMARY KEY (`id_cat`, `id_shop`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
0.037 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
79
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_features` (`id_tag` int(11) NOT NULL, `id_feature` int(11) NOT NULL, `id_shop` int(11) NOT NULL,  UNIQUE KEY `tag_feature` (`id_tag`, `id_feature`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
0.037 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
506
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.037 ms 0 /classes/module/Module.php:2132
70
CREATE TABLE IF NOT EXISTS `een_gmcp_taxonomy_categories` (`id_category` int(11) NOT NULL, `id_shop` int(3) NOT NULL DEFAULT "1", `txt_taxonomy` text NOT NULL, `lang` char(5) NOT NULL, KEY `id_category` (`id_category`,`lang`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
0.036 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
87
CREATE TABLE IF NOT EXISTS `een_gmcp_feeds` (`id_feed` int(11) NOT NULL AUTO_INCREMENT,`iso_lang` LONGTEXT NOT NULL,`iso_country` LONGTEXT NOT NULL,`iso_currency` LONGTEXT NOT NULL, `taxonomy` LONGTEXT NOT NULL, `id_shop` int(11) NOT NULL,`date_add` datetime NOT NULL,`date_upd` datetime NOT NULL,PRIMARY KEY (`id_feed`)) ENGINE=' . _MYSQL_ENGINE_ . ' DEFAULT CHARSET=utf8;
0.036 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
462
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 87 AND `id_shop` = 1 LIMIT 1
0.036 ms 1 /classes/module/Module.php:2132
503
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "idxropc" LIMIT 1
0.036 ms 0 /classes/module/Module.php:2659
246
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 10087 AND `id_group` = 1 LIMIT 1
0.035 ms 0 /classes/GroupReduction.php:156
502
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.035 ms 0 /classes/module/Module.php:2132
71
CREATE TABLE IF NOT EXISTS `een_gmcp_brands` (`id_brands` int(11) NOT NULL, `id_shop` int(11) NOT NULL DEFAULT "1",  UNIQUE KEY `id_brands` (`id_brands`, `id_shop`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
0.034 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
83
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_last_product_ordered` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `last_product_ordered` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
0.034 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
86
CREATE TABLE IF NOT EXISTS `een_gmcp_reporting` (`id_reporting` int(11) NOT NULL AUTO_INCREMENT,`iso_feed` LONGTEXT NOT NULL,    `reporting_content` LONGTEXT NOT NULL,`id_shop` int(11) NOT NULL,`date_add` datetime NOT NULL,`date_upd` datetime NOT NULL,PRIMARY KEY (`id_reporting`)) ENGINE=' . _MYSQL_ENGINE_ . ' DEFAULT CHARSET=utf8;
0.034 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
199
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 597831 AND `id_group` = 1 LIMIT 1
0.034 ms 0 /classes/GroupReduction.php:156
497
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "onepagecheckoutps" LIMIT 1
0.034 ms 0 /classes/module/Module.php:2659
505
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "pwpaysoncheckout" LIMIT 1
0.034 ms 0 /classes/module/Module.php:2659
58
CREATE TABLE IF NOT EXISTS `een_gmcp_feeds` (`id_feed` int(11) NOT NULL AUTO_INCREMENT,`iso_lang` LONGTEXT NOT NULL,`iso_country` LONGTEXT NOT NULL,`iso_currency` LONGTEXT NOT NULL, `taxonomy` LONGTEXT NOT NULL, `id_shop` int(11) NOT NULL,`date_add` datetime NOT NULL,`date_upd` datetime NOT NULL,PRIMARY KEY (`id_feed`)) ENGINE=' . _MYSQL_ENGINE_ . ' DEFAULT CHARSET=utf8;
0.034 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
516
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 3 AND `id_shop` = 1 LIMIT 1
0.033 ms 0 /classes/module/Module.php:2132
66
CREATE TABLE IF NOT EXISTS `een_gmcp_discount_association` (`id_association` int(11) NOT NULL AUTO_INCREMENT, `id_discount` int(11) NOT NULL, `id_product` int(11) NOT NULL, `channel` CHAR(120) NOT NULL DEFAULT "SHOPPING_ADS", PRIMARY KEY (`id_association`) ) ENGINE=MyISAM DEFAULT CHARSET=utf8;
0.032 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
504
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.032 ms 0 /classes/module/Module.php:2132
518
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 19 AND `id_shop` = 1 LIMIT 1
0.032 ms 0 /classes/module/Module.php:2132
72
CREATE TABLE IF NOT EXISTS `een_gmcp_tags` (`id_tag` int(11) NOT NULL AUTO_INCREMENT, `id_shop` int(11) NOT NULL DEFAULT "1", `name` char(255) NOT NULL, `type` char(255) NOT NULL, `active` TINYINT NOT NULL, `position` INT NOT NULL, `end_date` DATE, PRIMARY KEY (`id_tag`)) ENGINE=MyISAM DEFAULT CHARSET=utf8 AUTO_INCREMENT=1 ;
0.031 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
90
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_price_range` (`id_tag` int(11) NOT NULL, `price_min` CHAR(255) NOT NULL, `price_max` CHAR(255), `id_product` CHAR(255), UNIQUE KEY `tag_price_range` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
0.031 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
59
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_price_range` (`id_tag` int(11) NOT NULL, `price_min` CHAR(255) NOT NULL, `price_max` CHAR(255), `id_product` CHAR(255), UNIQUE KEY `tag_price_range` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
0.030 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
80
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_categories` (`id_tag` int(11) NOT NULL, `id_category` int(11) NOT NULL, `id_shop` int(11) NOT NULL,  UNIQUE KEY `tag_feature` (`id_tag`, `id_category`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
0.030 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
78
CREATE TABLE IF NOT EXISTS `een_gmcp_discount_association` (`id_association` int(11) NOT NULL AUTO_INCREMENT, `id_discount` int(11) NOT NULL, `id_product` int(11) NOT NULL, `channel` CHAR(120) NOT NULL DEFAULT "SHOPPING_ADS", PRIMARY KEY (`id_association`) ) ENGINE=MyISAM DEFAULT CHARSET=utf8;
0.029 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
84
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_last_product_not_ordered` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `last_product_ordered` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
0.029 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
498
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.029 ms 0 /classes/module/Module.php:2132
76
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_suppliers` (`id_tag` int(11) NOT NULL, `id_supplier` int(11) NOT NULL, UNIQUE KEY `tag_supplier` (`id_tag`,`id_supplier`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
0.028 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
82
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_best_sale` (`id_tag` int(11) NOT NULL, `amount` CHAR(255) NOT NULL, `unit` CHAR(255) ,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255),  `id_shop` int(11) NOT NULL,  UNIQUE KEY `tag_best_sales` (`id_tag`, `id_product`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
0.028 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
60
CREATE TABLE IF NOT EXISTS `een_gmcp_tmp_rules`(`id` int(11) NOT NULL AUTO_INCREMENT, `id_shop` int(11) NOT NULL DEFAULT "1",`type` char(255) NOT NULL, `exclusion_values` longtext NOT NULL, PRIMARY KEY (`id`)) ENGINE=InnoDB DEFAULT CHARSET=utf8 AUTO_INCREMENT=1;
0.028 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
69
CREATE TABLE IF NOT EXISTS `een_gmcp_categories` (`id_category` int(11) NOT NULL, `id_shop` int(11) NOT NULL DEFAULT "1",  UNIQUE KEY `id_category` (`id_category`, `id_shop`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
0.028 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
88
CREATE TABLE IF NOT EXISTS `een_gmcp_advanced_exclusion` (`id` int(11) NOT NULL AUTO_INCREMENT, `status` int(11) NOT NULL DEFAULT "1", `id_shop` int(11) NOT NULL DEFAULT "1", `name` char(255) NOT NULL, `type` char(255) NOT NULL, `exclusion_value` longtext NOT NULL, PRIMARY KEY (`id`)) ENGINE=InnoDB DEFAULT CHARSET=utf8 AUTO_INCREMENT=1;
0.028 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
500
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.027 ms 0 /classes/module/Module.php:2132
55
BEGIN
0.027 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:81
89
CREATE TABLE IF NOT EXISTS `een_gmcp_product_excluded` (`id_rule` int(11) NOT NULL DEFAULT "0",`id_product` int(11) NOT NULL DEFAULT "0", `id_product_attribute` int(11)) ENGINE=InnoDB DEFAULT CHARSET=utf8 AUTO_INCREMENT=1;
0.027 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
499
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "steasycheckout" LIMIT 1
0.027 ms 0 /classes/module/Module.php:2659
61
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_last_product_ordered` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `last_product_ordered` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
0.026 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
62
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_promotion` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `promotion` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
0.026 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
75
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_products` (`id_tag` int(11) NOT NULL, `id_product` int(11) NOT NULL, product_name VARCHAR (255) NOT NULL, UNIQUE KEY `tag_product` (`id_tag`,`id_product`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
0.026 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
501
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "thecheckout" LIMIT 1
0.026 ms 0 /classes/module/Module.php:2659
97
COMMIT
0.025 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:155
73
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_brands` (`id_tag` int(11) NOT NULL, `id_brand` int(11) NOT NULL, UNIQUE KEY `tag_brand` (`id_tag`,`id_brand`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
0.024 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
74
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_cats` (`id_tag` int(11) NOT NULL, `id_category` int(11) NOT NULL, UNIQUE KEY `tag_cat` (`id_tag`,`id_category`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
0.023 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
93
BEGIN
0.022 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:121
92
COMMIT
0.020 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:107

Doubles

27 queries
SELECT `id_module` FROM `een_module_shop` WHERE `id_module` = XX AND `id_shop` = XX LIMIT XX
20 queries
SELECT XX FROM `een_specific_price` WHERE id_product = XX LIMIT XX
19 queries
SELECT image_shop.`id_image`
                    FROM `een_image` i
                     INNER JOIN een_image_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
                    WHERE i.`id_product` = XX
                    AND image_shop.`cover` = XX LIMIT XX
19 queries
SELECT name FROM een_category_lang WHERE id_shop = XX AND id_lang = XX AND id_category = XX LIMIT XX
19 queries
				SELECT `priority`, `id_specific_price_priority`
				FROM `een_specific_price_priority`
				WHERE `id_product` = XX
				ORDER BY `id_specific_price_priority` DESC LIMIT XX
19 queries
			SELECT *, ( IF (`id_shop` = XX, XX, XX) +  IF (`id_country` = XX, XX, XX) +  IF (`id_currency` = XX, XX, XX) +  IF (`id_group` = XX, XX, XX) +  IF (`id_customer` = XX, XX, XX)) AS `score`
				FROM `een_specific_price`
				WHERE
                `id_shop` IN (XX, XX) AND
                `id_currency` IN (XX, XX) AND
                `id_country` IN (XX, XX) AND
                `id_group` IN (XX, XX) AND `id_product` = XX AND `id_customer` = XX AND `id_product_attribute` = XX AND `id_cart` = XX  AND (`from` = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' >= `from`) AND (`to` = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' <= `to`)
				AND IF(`from_quantity` > XX, `from_quantity`, XX) <= XX ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT XX
19 queries
SELECT product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,XX) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = XX)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = XX)
WHERE (p.`id_product` = XX)
19 queries
                            SELECT `id_tax_rules_group`
                            FROM `een_product_shop`
                            WHERE `id_product` = XX AND id_shop=XX LIMIT XX
19 queries
			SELECT `reduction`
			FROM `een_product_group_reduction_cache`
			WHERE `id_product` = XX AND `id_group` = XX LIMIT XX
19 queries
SELECT SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
19 queries
SELECT
            COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), XX) as deep_quantity,
            COALESCE(SUM(first_level_quantity), XX) as quantity
          FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, XX as pack_quantity
          FROM `een_cart_product` cp
            WHERE cp.`id_product_attribute` = XX
            
            AND cp.`id_cart` = XX AND cp.`id_product` = XX UNION SELECT XX as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
          FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
            WHERE cp.`id_product_attribute` = XX
            
            AND cp.`id_cart` = XX AND p.`id_product_item` = XX AND (pr.`pack_stock_type` IN (XX,XX) OR (
            pr.`pack_stock_type` = XX
            AND XX = XX
        ))) as q LIMIT XX
19 queries
                SELECT name, value, pf.id_feature, f.position, fvl.id_feature_value
                FROM een_feature_product pf
                LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = XX)
                LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = XX)
                LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = XX)
                 INNER JOIN een_feature_shop feature_shop
        ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = XX)
                WHERE pf.id_product = XX
                ORDER BY f.position ASC
19 queries
SELECT *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = XX
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = XX
WHERE (a.`id_product` = XX) AND (b.`id_shop` = XX) LIMIT XX
19 queries
            SELECT image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
            FROM `een_image` i
             INNER JOIN een_image_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
            LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = XX)
            WHERE i.`id_product` = XX
            ORDER BY `position`
19 queries
SELECT `id_product_attribute`
            FROM `een_product_attribute`
            WHERE `id_product` = XX
19 queries
SELECT pa.`id_product`, a.`color`, pac.`id_product_attribute`, XX qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
            FROM `een_product_attribute` pa
             INNER JOIN een_product_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX)
            JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
            JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
            JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = XX)
            JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
            WHERE pa.`id_product` IN (XX) AND ag.`is_color_group` = XX
            GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
            
            ORDER BY a.`position` ASC;
9 queries
			SELECT cl.`link_rewrite`
			FROM `een_category_lang` cl
			WHERE `id_lang` = XX
			 AND cl.id_shop = XX 
			AND cl.`id_category` = XX LIMIT XX
7 queries
SELECT *
FROM `een_country` a
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = XX
WHERE (a.`id_country` = XX) LIMIT XX
7 queries
SELECT *
							FROM `een_country_lang`
							WHERE `id_country` = XX
7 queries
			SELECT `id_country`
			FROM `een_country`
			WHERE `iso_code` = 'FR' LIMIT XX
5 queries
							SELECT `name`
							FROM `een_country_lang`
							WHERE `id_lang` = XX
							AND `id_country` = XX LIMIT XX
5 queries
				SELECT `name`
				FROM `een_manufacturer`
				WHERE `id_manufacturer` = XX
				AND `active` = XX LIMIT XX
4 queries
SELECT v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `een_feature_value` v LEFT JOIN `een_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = XX) LEFT JOIN `een_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = XX) WHERE v.`id_feature` = XX ORDER BY vl.`value` ASC
4 queries
SELECT fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pl.name FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, XX) = sa.id_product_attribute AND sa.id_shop = XX  AND sa.id_shop_group = XX ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_product_lang pl ON (p.id_product = pl.id_product AND pl.id_shop = XX AND pl.id_lang = XX) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = XX AND ps.active = TRUE) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=XX) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_specific_price sp ON (
                    sp.id_product = p.id_product AND 
                    sp.id_shop IN (XX, XX) AND 
                    sp.id_currency IN (XX, XX) AND 
                    sp.id_country IN (XX, XX) AND 
                    sp.id_group IN (XX, XX) AND 
                    sp.from_quantity = XX AND
                    sp.reduction > XX AND
                    sp.id_customer = XX AND
                    sp.id_cart = XX AND 
                    (sp.from = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' >= sp.from) AND 
                    (sp.to = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' <= sp.to) 
                ) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_XX ON (p.id_product = fp_XX.id_product) WHERE ((fp.id_feature_value=XX)) AND ((fp_XX.id_feature_value IN (XX, XX, XX, XX, XX, XX))) AND ps.id_shop='XX' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='XX' AND sp.reduction>XX GROUP BY p.id_product) p INNER JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_XX ON (p.id_product = fp_XX.id_product) LEFT JOIN een_feature_product fp_XX ON (p.id_product = fp_XX.id_product) WHERE ((fp.id_feature=XX)) AND ((fp_XX.id_feature_value=XX)) AND ((fp_XX.id_feature_value IN (XX, XX, XX, XX, XX, XX))) GROUP BY fp.id_feature_value
3 queries
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_last_product_not_ordered` (`id_tag` int(XX) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(XX), UNIQUE KEY `last_product_ordered` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utfXX;
2 queries
                SELECT m.`id_module`, m.`name`, ms.`id_module`as `mshop`
                FROM `een_module` m
                LEFT JOIN `een_module_shop` ms
                ON m.`id_module` = ms.`id_module`
                AND ms.`id_shop` = XX
2 queries
SELECT `id_lang` FROM `een_lang`
                    WHERE `locale` = 'fr-fr'
                    OR `language_code` = 'fr-fr' LIMIT XX
2 queries
BEGIN
2 queries
SHOW TABLES LIKE "een_gmcp_XX"
2 queries
CREATE TABLE IF NOT EXISTS `een_gmcp_reporting` (`id_reporting` int(XX) NOT NULL AUTO_INCREMENT,`iso_feed` LONGTEXT NOT NULL,    `reporting_content` LONGTEXT NOT NULL,`id_shop` int(XX) NOT NULL,`date_add` datetime NOT NULL,`date_upd` datetime NOT NULL,PRIMARY KEY (`id_reporting`)) ENGINE=' . _MYSQL_ENGINE_ . ' DEFAULT CHARSET=utfXX;
2 queries
CREATE TABLE IF NOT EXISTS `een_gmcp_feeds` (`id_feed` int(XX) NOT NULL AUTO_INCREMENT,`iso_lang` LONGTEXT NOT NULL,`iso_country` LONGTEXT NOT NULL,`iso_currency` LONGTEXT NOT NULL, `taxonomy` LONGTEXT NOT NULL, `id_shop` int(XX) NOT NULL,`date_add` datetime NOT NULL,`date_upd` datetime NOT NULL,PRIMARY KEY (`id_feed`)) ENGINE=' . _MYSQL_ENGINE_ . ' DEFAULT CHARSET=utfXX;
2 queries
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_price_range` (`id_tag` int(XX) NOT NULL, `price_min` CHAR(XX) NOT NULL, `price_max` CHAR(XX), `id_product` CHAR(XX), UNIQUE KEY `tag_price_range` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utfXX;
2 queries
CREATE TABLE IF NOT EXISTS `een_gmcp_tmp_rules`(`id` int(XX) NOT NULL AUTO_INCREMENT, `id_shop` int(XX) NOT NULL DEFAULT "XX",`type` char(XX) NOT NULL, `exclusion_values` longtext NOT NULL, PRIMARY KEY (`id`)) ENGINE=InnoDB DEFAULT CHARSET=utfXX AUTO_INCREMENT=XX;
2 queries
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_last_product_ordered` (`id_tag` int(XX) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(XX), UNIQUE KEY `last_product_ordered` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utfXX;
2 queries
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_promotion` (`id_tag` int(XX) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(XX), UNIQUE KEY `promotion` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utfXX;
2 queries
CREATE TABLE IF NOT EXISTS `een_gmcp_discount_association` (`id_association` int(XX) NOT NULL AUTO_INCREMENT, `id_discount` int(XX) NOT NULL, `id_product` int(XX) NOT NULL, `channel` CHAR(XX) NOT NULL DEFAULT "SHOPPING_ADS", PRIMARY KEY (`id_association`) ) ENGINE=MyISAM DEFAULT CHARSET=utfXX;
2 queries
CREATE TABLE IF NOT EXISTS `een_gmcp_tags` (`id_tag` int(XX) NOT NULL AUTO_INCREMENT, `id_shop` int(XX) NOT NULL DEFAULT "XX", `name` char(XX) NOT NULL, `type` char(XX) NOT NULL, `active` TINYINT NOT NULL, `position` INT NOT NULL, `end_date` DATE, PRIMARY KEY (`id_tag`)) ENGINE=MyISAM DEFAULT CHARSET=utfXX AUTO_INCREMENT=XX ;
2 queries
COMMIT
2 queries
				SELECT tr.*
				FROM `een_tax_rule` tr
				JOIN `een_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
				WHERE trg.`active` = XX
				AND tr.`id_country` = XX
				AND tr.`id_tax_rules_group` = XX
				AND tr.`id_state` IN (XX, XX)
				AND ('XX' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
					OR (tr.`zipcode_to` = XX AND tr.`zipcode_from` IN(XX, 'XX')))
				ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
2 queries
SELECT XX FROM `een_cart_rule` WHERE ((date_to >= "XX-XX-XX XX:XX:XX" AND date_to <= "XX-XX-XX XX:XX:XX") OR (date_from >= "XX-XX-XX XX:XX:XX" AND date_from <= "XX-XX-XX XX:XX:XX") OR (date_from < "XX-XX-XX XX:XX:XX" AND date_to > "XX-XX-XX XX:XX:XX")) AND `id_customer` IN (XX,XX) LIMIT XX

Tables stress

73 feature_product
72 product
72 product_shop
56 specific_price
54 product_attribute
39 cart_product
38 image
38 image_shop
38 product_attribute_shop
37 stock_available
35 product_attribute_combination
34 module
34 product_lang
31 category_lang
30 module_shop
23 feature_value_lang
21 country
20 feature
20 feature_shop
20 feature_lang
19 specific_price_priority
19 product_group_reduction_cache
19 pack
19 image_lang
19 attribute
19 attribute_lang
19 attribute_group
18 category
16 category_product
15 category_group
13 country_lang
13 product_sale
12 currency
8 country_shop
7 hook
5 lang
5 manufacturer
4 shop_url
4 shop
4 lang_shop
4 currency_shop
4 gmcp_feeds
4 feature_value
4 layered_indexable_feature_value_lang_value
4 cart_rule
3 hook_alias
3 category_shop
2 shop_group
2 configuration
2 hook_module
2 meta
2 meta_lang
2 currency_lang
2 group
2 group_shop
2 image_type
2 orders
2 tax_rule
2 tax_rules_group
2 cart_rule_lang
1 memcached_servers
1 configuration_lang
1 module_group
1 hook_module_exceptions
1 group_lang
1 address_format
1 required_field
1 revslider_sliders
1 gmcp_discount_association
1 gmcp_tags
1 layered_category
1 layered_indexable_feature
1 layered_indexable_feature_lang_value
1 layered_price_index
1 feature_flag
1 order_cart_rule
1 ganalytics_data

ObjectModel instances

Name Instances Source
Product 19 /src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 590850]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 576485]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 597831]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 596002]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 565876]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 573233]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 10087]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4997]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 10086]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 40036]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 605174]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 605590]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 573843]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 606782]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 592103]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 565904]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 600667]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 542263]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 563542]
Country 15 /config/config.inc.php:148 (__construct) [id: 8]
/classes/controller/FrontController.php:946 (__construct) [id: 21]
/classes/AddressFormat.php:404 (__construct) [id: 17]
/classes/controller/FrontController.php:1779 (__construct) [id: 17]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 8]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 8]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 8]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 8]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 8]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 8]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 8]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 19]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 4]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 3]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 186]
Language 13 /config/config.inc.php:213 (__construct) [id: 1]
/classes/Tools.php:560 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
Currency 9 /src/Adapter/Currency/CurrencyDataProvider.php:101 (__construct) [id: 1]
/classes/Tools.php:690 (getCurrencyInstance) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:213 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:213 (__construct) [id: 0]
/modules/gmerchantcenterpro/lib/moduleTools.php:213 (__construct) [id: 0]
/modules/gmerchantcenterpro/lib/moduleTools.php:213 (__construct) [id: 0]
/modules/gmerchantcenterpro/lib/moduleTools.php:213 (__construct) [id: 0]
/modules/gmerchantcenterpro/lib/moduleTools.php:213 (__construct) [id: 0]
/modules/gmerchantcenterpro/lib/moduleTools.php:213 (__construct) [id: 0]
Address 4 /classes/shop/Shop.php:486 (__construct) [id: ]
/classes/Product.php:3694 (initialize) [id: ]
/classes/Product.php:3804 (__construct) [id: ]
/classes/Product.php:5964 (__construct) [id: ]
Cart 2 /classes/controller/FrontController.php:467 (__construct) [id: ]
/classes/controller/FrontController.php:541 (__construct) [id: ]
Shop 1 /config/config.inc.php:119 (initialize) [id: 1]
ShopGroup 1 /classes/shop/Shop.php:561 (__construct) [id: 1]
Customer 1 /config/config.inc.php:266 (__construct) [id: ]
Group 1 /classes/Cart.php:249 (getCurrent) [id: 1]
Gender 1 /classes/controller/FrontController.php:1702 (__construct) [id: 0]
Risk 1 /classes/controller/FrontController.php:1705 (__construct) [id: ]
AddressFormat 1 /classes/controller/FrontController.php:1773 (generateAddress) [id: ]
State 1 /classes/controller/FrontController.php:1778 (__construct) [id: 0]
Category 1 /modules/ps_facetedsearch/src/Filters/Block.php:157 (__construct) [id: 2]

Included Files

# Filename
0 /index.php
1 /config/config.inc.php
2 /config/defines.inc.php
3 /config/autoload.php
4 /vendor/autoload.php
5 /vendor/composer/autoload_real.php
6 /vendor/composer/platform_check.php
7 /vendor/composer/ClassLoader.php
8 /vendor/composer/include_paths.php
9 /vendor/composer/autoload_static.php
10 /vendor/symfony/polyfill-php72/bootstrap.php
11 /vendor/symfony/polyfill-mbstring/bootstrap.php
12 /vendor/symfony/polyfill-mbstring/bootstrap80.php
13 /vendor/symfony/polyfill-intl-normalizer/bootstrap.php
14 /vendor/symfony/polyfill-intl-normalizer/bootstrap80.php
15 /vendor/symfony/polyfill-intl-idn/bootstrap.php
16 /vendor/symfony/deprecation-contracts/function.php
17 /vendor/ralouphie/getallheaders/src/getallheaders.php
18 /vendor/symfony/polyfill-ctype/bootstrap.php
19 /vendor/symfony/polyfill-ctype/bootstrap80.php
20 /vendor/symfony/polyfill-php80/bootstrap.php
21 /vendor/guzzlehttp/promises/src/functions_include.php
22 /vendor/guzzlehttp/promises/src/functions.php
23 /vendor/guzzlehttp/guzzle/src/functions_include.php
24 /vendor/guzzlehttp/guzzle/src/functions.php
25 /vendor/symfony/polyfill-iconv/bootstrap.php
26 /vendor/ezyang/htmlpurifier/library/HTMLPurifier.composer.php
27 /vendor/jakeasmith/http_build_url/src/http_build_url.php
28 /vendor/lcobucci/jwt/compat/class-aliases.php
29 /vendor/lcobucci/jwt/src/Token.php
30 /vendor/lcobucci/jwt/src/Signature.php
31 /vendor/lcobucci/jwt/compat/json-exception-polyfill.php
32 /vendor/lcobucci/jwt/compat/lcobucci-clock-polyfill.php
33 /vendor/swiftmailer/swiftmailer/lib/swift_required.php
34 /vendor/swiftmailer/swiftmailer/lib/classes/Swift.php
35 /vendor/symfony/polyfill-intl-icu/bootstrap.php
36 /vendor/symfony/polyfill-php73/bootstrap.php
37 /vendor/symfony/polyfill-php81/bootstrap.php
38 /vendor/api-platform/core/src/deprecation.php
39 /vendor/api-platform/core/src/Api/FilterInterface.php
40 /vendor/api-platform/core/src/Api/ResourceClassResolverInterface.php
41 /vendor/api-platform/core/src/deprecated_interfaces.php
42 /vendor/api-platform/core/src/Metadata/Property/Factory/PropertyNameCollectionFactoryInterface.php
43 /vendor/api-platform/core/src/Metadata/Resource/Factory/ResourceNameCollectionFactoryInterface.php
44 /vendor/api-platform/core/src/Metadata/Extractor/ResourceExtractorInterface.php
45 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/DateFilterInterface.php
46 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/ExistsFilterInterface.php
47 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/OrderFilterInterface.php
48 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/RangeFilterInterface.php
49 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/SearchFilterInterface.php
50 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationCollectionExtensionInterface.php
51 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationItemExtensionInterface.php
52 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultCollectionExtensionInterface.php
53 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultItemExtensionInterface.php
54 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Filter/FilterInterface.php
55 /vendor/api-platform/core/src/Doctrine/Orm/QueryAwareInterface.php
56 /vendor/api-platform/core/src/Doctrine/Orm/Util/QueryNameGeneratorInterface.php
57 /vendor/api-platform/core/src/Elasticsearch/Metadata/Document/Factory/DocumentMetadataFactoryInterface.php
58 /vendor/api-platform/core/src/Symfony/Validator/ValidationGroupsGeneratorInterface.php
59 /vendor/api-platform/core/src/Symfony/Validator/Exception/ConstraintViolationListAwareExceptionInterface.php
60 /vendor/api-platform/core/src/Exception/ExceptionInterface.php
61 /vendor/api-platform/core/src/Core/Bridge/Symfony/Validator/Metadata/Property/Restriction/PropertySchemaRestrictionMetadataInterface.php
62 /vendor/api-platform/core/src/State/Pagination/PaginatorInterface.php
63 /vendor/api-platform/core/src/State/Pagination/PartialPaginatorInterface.php
64 /vendor/api-platform/core/src/Documentation/DocumentationInterface.php
65 /vendor/api-platform/core/src/JsonLd/AnonymousContextBuilderInterface.php
66 /vendor/api-platform/core/src/JsonLd/ContextBuilderInterface.php
67 /vendor/api-platform/core/src/Core/JsonSchema/SchemaFactoryInterface.php
68 /vendor/api-platform/core/src/JsonSchema/TypeFactoryInterface.php
69 /vendor/api-platform/core/src/OpenApi/Factory/OpenApiFactoryInterface.php
70 /vendor/api-platform/core/src/PathResolver/OperationPathResolverInterface.php
71 /vendor/api-platform/core/src/Symfony/Security/ResourceAccessCheckerInterface.php
72 /vendor/api-platform/core/src/Serializer/Filter/FilterInterface.php
73 /vendor/api-platform/core/src/Serializer/SerializerContextBuilderInterface.php
74 /vendor/api-platform/core/src/Validator/ValidatorInterface.php
75 /vendor/api-platform/core/src/Api/UrlGeneratorInterface.php
76 /vendor/api-platform/core/src/GraphQl/ExecutorInterface.php
77 /vendor/api-platform/core/src/GraphQl/Error/ErrorHandlerInterface.php
78 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ValidateStageInterface.php
79 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ReadStageInterface.php
80 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityPostDenormalizeStageInterface.php
81 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityStageInterface.php
82 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/WriteStageInterface.php
83 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SerializeStageInterface.php
84 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/DeserializeStageInterface.php
85 /vendor/api-platform/core/src/GraphQl/Resolver/QueryItemResolverInterface.php
86 /vendor/api-platform/core/src/GraphQl/Resolver/QueryCollectionResolverInterface.php
87 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Factory/ResolverFactoryInterface.php
88 /vendor/api-platform/core/src/GraphQl/Resolver/MutationResolverInterface.php
89 /vendor/api-platform/core/src/Core/GraphQl/Subscription/MercureSubscriptionIriGeneratorInterface.php
90 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionIdentifierGeneratorInterface.php
91 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionManagerInterface.php
92 /vendor/api-platform/core/src/Core/GraphQl/Serializer/SerializerContextBuilderInterface.php
93 /vendor/api-platform/core/src/GraphQl/Type/TypesFactoryInterface.php
94 /vendor/api-platform/core/src/GraphQl/Type/Definition/TypeInterface.php
95 /vendor/api-platform/core/src/GraphQl/Type/TypesContainerInterface.php
96 /vendor/psr/container/src/ContainerInterface.php
97 /vendor/api-platform/core/src/Operation/PathSegmentNameGeneratorInterface.php
98 /vendor/ircmaxell/password-compat/lib/password.php
99 /vendor/martinlindhe/php-mb-helpers/src/mb_helpers.php
100 /vendor/prestashop/laminas-code-lts/polyfill/ReflectionEnumPolyfill.php
101 /src/Core/Version.php
102 /config/alias.php
103 /vendor/prestashop/autoload/src/PrestashopAutoload.php
104 /vendor/prestashop/autoload/src/LegacyClassLoader.php
105 /vendor/symfony/symfony/src/Symfony/Component/Filesystem/Filesystem.php
106 /vendor/prestashop/autoload/src/Autoloader.php
107 /config/bootstrap.php
108 /src/Core/ContainerBuilder.php
109 /src/Core/Foundation/IoC/Container.php
110 /src/Adapter/ServiceLocator.php
111 /var/cache/prod/appParameters.php
114 /var/cache/prod/class_index.php
115 /classes/controller/Controller.php
117 /classes/ObjectModel.php
118 /src/Core/Foundation/Database/EntityInterface.php
120 /classes/db/Db.php
122 /classes/Hook.php
124 /classes/module/Module.php
125 /src/Core/Module/Legacy/ModuleInterface.php
127 /classes/Tools.php
128 /classes/Context.php
129 /classes/shop/Shop.php
130 /src/Core/Security/PasswordGenerator.php
131 /classes/db/DbPDO.php
132 /classes/AddressFormat.php
133 /classes/cache/Cache.php
134 /classes/cache/CacheMemcached.php
135 /config/db_slave_server.inc.php
136 /src/Core/Security/Hashing.php
137 /classes/Configuration.php
138 /classes/Validate.php
139 /src/Adapter/EntityMapper.php
140 /classes/db/DbQuery.php
141 /src/Core/Addon/Theme/ThemeManagerBuilder.php
142 /vendor/psr/log/Psr/Log/NullLogger.php
143 /vendor/psr/log/Psr/Log/AbstractLogger.php
144 /vendor/psr/log/Psr/Log/LoggerInterface.php
145 /src/Adapter/Configuration.php
146 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ParameterBag.php
147 /src/Core/Domain/Configuration/ShopConfigurationInterface.php
148 /src/Core/ConfigurationInterface.php
149 /src/Core/Addon/Theme/ThemeRepository.php
150 /src/Core/Addon/AddonRepositoryInterface.php
151 /src/Core/Domain/Shop/ValueObject/ShopConstraint.php
152 /src/Core/Addon/Theme/Theme.php
153 /src/Core/Addon/AddonInterface.php
154 /src/Core/Util/ArrayFinder.php
155 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccess.php
156 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorBuilder.php
157 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessor.php
158 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorInterface.php
159 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPath.php
160 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPathInterface.php
161 /config/defines_uri.inc.php
162 /classes/Language.php
163 /src/Core/Language/LanguageInterface.php
164 /classes/Country.php
165 /classes/PrestaShopCollection.php
166 /classes/shop/ShopGroup.php
167 /classes/Cookie.php
168 /classes/PhpEncryption.php
169 /classes/PhpEncryptionEngine.php
170 /vendor/defuse/php-encryption/src/Key.php
171 /vendor/defuse/php-encryption/src/Encoding.php
172 /vendor/defuse/php-encryption/src/Core.php
173 /vendor/defuse/php-encryption/src/Crypto.php
174 /vendor/defuse/php-encryption/src/KeyOrPassword.php
175 /vendor/defuse/php-encryption/src/RuntimeTests.php
176 /vendor/defuse/php-encryption/src/DerivedKeys.php
177 /vendor/defuse/php-encryption/src/Exception/WrongKeyOrModifiedCiphertextException.php
178 /vendor/defuse/php-encryption/src/Exception/CryptoException.php
179 /src/Core/Session/SessionHandler.php
180 /src/Core/Session/SessionHandlerInterface.php
181 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Session.php
182 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBag.php
183 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBagInterface.php
184 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagInterface.php
185 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBag.php
186 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBagInterface.php
187 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagProxy.php
188 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionInterface.php
189 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/PhpBridgeSessionStorage.php
190 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/NativeSessionStorage.php
191 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/MetadataBag.php
192 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/StrictSessionHandler.php
193 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/AbstractSessionHandler.php
194 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/SessionHandlerProxy.php
195 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/AbstractProxy.php
196 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/SessionStorageInterface.php
197 /config/smarty.config.inc.php
198 /vendor/smarty/smarty/libs/Smarty.class.php
199 /vendor/smarty/smarty/libs/functions.php
200 /vendor/smarty/smarty/libs/Autoloader.php
201 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_data.php
202 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_extension_handler.php
203 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php
204 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php
205 /vendor/smarty/smarty/libs/sysplugins/smarty_resource.php
206 /vendor/smarty/smarty/libs/sysplugins/smarty_variable.php
207 /vendor/smarty/smarty/libs/sysplugins/smarty_template_source.php
208 /vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php
209 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_resource_file.php
210 /config/smartyfront.config.inc.php
211 /classes/Smarty/SmartyResourceModule.php
212 /vendor/smarty/smarty/libs/sysplugins/smarty_resource_custom.php
213 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerresource.php
214 /classes/Smarty/SmartyResourceParent.php
215 /classes/Smarty/SmartyLazyRegister.php
216 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerplugin.php
217 /vendor/smarty/smarty/libs/plugins/modifier.truncate.php
218 /classes/Customer.php
219 /classes/Group.php
220 /override/classes/Link.php
221 /classes/Link.php
222 /classes/shop/ShopUrl.php
223 /override/classes/Dispatcher.php
224 /classes/Dispatcher.php
225 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Request.php
226 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeader.php
227 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeaderItem.php
228 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/FileBag.php
229 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderBag.php
230 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderUtils.php
231 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ServerBag.php
232 /src/Adapter/SymfonyContainer.php
233 /vendor/mobiledetect/mobiledetectlib/Mobile_Detect.php
234 /modules/ph_simpleblog/ph_simpleblog.php
235 /modules/ph_simpleblog/assets/phpthumb/ThumbLib.inc.php
236 /modules/ph_simpleblog/assets/phpthumb/PhpThumb.inc.php
237 /modules/ph_simpleblog/assets/phpthumb/ThumbBase.inc.php
238 /modules/ph_simpleblog/assets/phpthumb/GdThumb.inc.php
239 /modules/ph_simpleblog/vendor/autoload.php
240 /modules/ph_simpleblog/vendor/composer/autoload_real.php
241 /modules/ph_simpleblog/vendor/composer/platform_check.php
242 /modules/ph_simpleblog/vendor/composer/autoload_static.php
243 /modules/ph_simpleblog/models/SimpleBlogCategory.php
244 /modules/ph_simpleblog/models/SimpleBlogPost.php
245 /modules/ph_simpleblog/models/SimpleBlogPostType.php
246 /modules/ph_simpleblog/models/SimpleBlogPostImage.php
247 /modules/ph_simpleblog/models/SimpleBlogTag.php
248 /modules/ph_simpleblog/models/SimpleBlogComment.php
249 /modules/ph_simpleblog/models/SimpleBlogPostAuthor.php
250 /modules/ph_simpleblog/classes/SimpleBlogHelper.php
251 /modules/ph_simpleblog/classes/BlogPostsFinder.php
252 /modules/ph_simpleblog/controllers/front/default_list.php
253 /classes/controller/ModuleFrontController.php
254 /override/classes/controller/FrontController.php
255 /classes/controller/FrontController.php
256 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_createdata.php
257 /vendor/smarty/smarty/libs/sysplugins/smarty_data.php
258 /classes/Translate.php
259 /modules/ph_simpleblog/translations/fr.php
260 /src/PrestaShopBundle/Translation/TranslatorComponent.php
261 /vendor/symfony/symfony/src/Symfony/Component/Translation/Translator.php
262 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorInterface.php
263 /vendor/symfony/contracts/Translation/LocaleAwareInterface.php
264 /vendor/symfony/contracts/Translation/TranslatorInterface.php
265 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorBagInterface.php
266 /src/PrestaShopBundle/Translation/PrestaShopTranslatorTrait.php
267 /src/PrestaShopBundle/Translation/TranslatorLanguageTrait.php
268 /src/PrestaShopBundle/Translation/TranslatorInterface.php
269 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatter.php
270 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatter.php
271 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatterInterface.php
272 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatterInterface.php
273 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/ChoiceMessageFormatterInterface.php
274 /vendor/symfony/symfony/src/Symfony/Component/Translation/IdentityTranslator.php
275 /vendor/symfony/contracts/Translation/TranslatorTrait.php
276 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactory.php
277 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactoryInterface.php
278 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCache.php
279 /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerConfigCache.php
280 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheInterface.php
281 /var/cache/prod/translations/catalogue.fr-FR.NXhscRe.php
282 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogue.php
283 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogueInterface.php
284 /vendor/symfony/symfony/src/Symfony/Component/Translation/MetadataAwareInterface.php
285 /controllers/front/listing/PricesDropController.php
286 /classes/controller/ProductListingFrontController.php
287 /classes/controller/ProductPresentingFrontController.php
288 /src/Adapter/Presenter/Object/ObjectPresenter.php
289 /src/Adapter/Presenter/PresenterInterface.php
290 /src/Adapter/Presenter/Cart/CartPresenter.php
291 /src/Adapter/Image/ImageRetriever.php
292 /classes/tax/TaxConfiguration.php
293 /classes/Smarty/TemplateFinder.php
294 /classes/assets/StylesheetManager.php
295 /classes/assets/AbstractAssetManager.php
296 /src/Adapter/Assets/AssetUrlGeneratorTrait.php
297 /classes/assets/JavascriptManager.php
298 /classes/assets/CccReducer.php
299 /modules/iqitthemeeditor/iqitthemeeditor.php
300 /modules/iqitthemeeditor/src/IqitSmartyModifiers.php
301 /modules/iqitthemeeditor/translations/fr.php
302 /src/Adapter/ContainerBuilder.php
303 /src/Adapter/Environment.php
304 /src/Core/EnvironmentInterface.php
305 /vendor/symfony/symfony/src/Symfony/Component/Cache/DoctrineProvider.php
306 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/CacheProvider.php
307 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Cache.php
308 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/FlushableCache.php
309 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/ClearableCache.php
310 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiOperationCache.php
311 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiGetCache.php
312 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiDeleteCache.php
313 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiPutCache.php
314 /vendor/symfony/symfony/src/Symfony/Component/Cache/PruneableInterface.php
315 /vendor/symfony/symfony/src/Symfony/Component/Cache/ResettableInterface.php
316 /vendor/symfony/contracts/Service/ResetInterface.php
317 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/ArrayAdapter.php
318 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ArrayTrait.php
319 /vendor/psr/log/Psr/Log/LoggerAwareTrait.php
320 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AdapterInterface.php
321 /vendor/symfony/symfony/src/Symfony/Component/Cache/CacheItem.php
322 /vendor/symfony/contracts/Cache/ItemInterface.php
323 /vendor/psr/cache/src/CacheItemInterface.php
324 /vendor/psr/cache/src/CacheItemPoolInterface.php
325 /vendor/symfony/contracts/Cache/CacheInterface.php
326 /vendor/psr/log/Psr/Log/LoggerAwareInterface.php
327 /vendor/doctrine/orm/lib/Doctrine/ORM/Tools/Setup.php
328 /vendor/doctrine/deprecations/lib/Doctrine/Deprecations/Deprecation.php
329 /vendor/doctrine/orm/lib/Doctrine/ORM/Configuration.php
330 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Configuration.php
331 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/CacheAdapter.php
332 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/DoctrineProvider.php
333 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationReader.php
334 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Reader.php
335 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationRegistry.php
336 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/DoctrineAnnotations.php
337 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Annotation.php
338 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Entity.php
339 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embeddable.php
340 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embedded.php
341 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/MappedSuperclass.php
342 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/InheritanceType.php
343 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorColumn.php
344 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorMap.php
345 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Id.php
346 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/GeneratedValue.php
347 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Version.php
348 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumn.php
349 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumns.php
350 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Column.php
351 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToOne.php
352 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToMany.php
353 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToOne.php
354 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToMany.php
355 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Table.php
356 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/UniqueConstraint.php
357 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Index.php
358 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinTable.php
359 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SequenceGenerator.php
360 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/CustomIdGenerator.php
361 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ChangeTrackingPolicy.php
362 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OrderBy.php
363 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQueries.php
364 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQuery.php
365 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/HasLifecycleCallbacks.php
366 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PrePersist.php
367 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostPersist.php
368 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreUpdate.php
369 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostUpdate.php
370 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreRemove.php
371 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostRemove.php
372 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostLoad.php
373 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreFlush.php
374 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/FieldResult.php
375 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ColumnResult.php
376 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityResult.php
377 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQuery.php
378 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQueries.php
379 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMapping.php
380 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMappings.php
381 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverride.php
382 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverrides.php
383 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverride.php
384 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverrides.php
385 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityListeners.php
386 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Cache.php
387 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/SimpleAnnotationReader.php
388 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocParser.php
389 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocLexer.php
390 /vendor/doctrine/lexer/lib/Doctrine/Common/Lexer/AbstractLexer.php
391 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Target.php
392 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/AnnotationDriver.php
393 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/CompatibilityAnnotationDriver.php
394 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/MappingDriver.php
395 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/ColocatedMappingDriver.php
396 /var/cache/prod/FrontContainer.php
397 /src/Adapter/Container/LegacyContainer.php
398 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Container.php
399 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/RewindableGenerator.php
400 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/ServiceLocator.php
401 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ServiceLocator.php
402 /vendor/symfony/contracts/Service/ServiceLocatorTrait.php
403 /vendor/psr/container/src/ContainerExceptionInterface.php
404 /vendor/psr/container/src/NotFoundExceptionInterface.php
405 /vendor/symfony/contracts/Service/ServiceProviderInterface.php
406 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ResettableContainerInterface.php
407 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ContainerInterface.php
408 /src/Adapter/Container/LegacyContainerInterface.php
409 /modules/ps_categorytree/vendor/autoload.php
410 /modules/ps_categorytree/vendor/composer/autoload_real.php
411 /modules/ps_categorytree/vendor/composer/platform_check.php
412 /modules/ps_categorytree/vendor/composer/autoload_static.php
413 /modules/ps_facetedsearch/vendor/autoload.php
414 /modules/ps_facetedsearch/vendor/composer/autoload_real.php
415 /modules/ps_facetedsearch/vendor/composer/platform_check.php
416 /modules/ps_facetedsearch/vendor/composer/autoload_static.php
417 /modules/contactform/vendor/autoload.php
418 /modules/contactform/vendor/composer/autoload_real.php
419 /modules/contactform/vendor/composer/platform_check.php
420 /modules/contactform/vendor/composer/autoload_static.php
421 /modules/ps_sharebuttons/vendor/autoload.php
422 /modules/ps_sharebuttons/vendor/composer/autoload_real.php
423 /modules/ps_sharebuttons/vendor/composer/platform_check.php
424 /modules/ps_sharebuttons/vendor/composer/autoload_static.php
425 /modules/gsitemap/vendor/autoload.php
426 /modules/gsitemap/vendor/composer/autoload_real.php
427 /modules/gsitemap/vendor/composer/platform_check.php
428 /modules/gsitemap/vendor/composer/autoload_static.php
429 /modules/ps_crossselling/vendor/autoload.php
430 /modules/ps_crossselling/vendor/composer/autoload_real.php
431 /modules/ps_crossselling/vendor/composer/platform_check.php
432 /modules/ps_crossselling/vendor/composer/autoload_static.php
433 /modules/ps_themecusto/vendor/autoload.php
434 /modules/ps_themecusto/vendor/composer/autoload_real.php
435 /modules/ps_themecusto/vendor/composer/platform_check.php
436 /modules/ps_themecusto/vendor/composer/autoload_static.php
437 /modules/ps_supplierlist/vendor/autoload.php
438 /modules/ps_supplierlist/vendor/composer/autoload_real.php
439 /modules/ps_supplierlist/vendor/composer/platform_check.php
440 /modules/ps_supplierlist/vendor/composer/autoload_static.php
441 /modules/ps_googleanalytics/vendor/autoload.php
442 /modules/ps_googleanalytics/vendor/composer/autoload_real.php
443 /modules/ps_googleanalytics/vendor/composer/platform_check.php
444 /modules/ps_googleanalytics/vendor/composer/autoload_static.php
445 /modules/statssearch/vendor/autoload.php
446 /modules/statssearch/vendor/composer/autoload_real.php
447 /modules/statssearch/vendor/composer/platform_check.php
448 /modules/statssearch/vendor/composer/autoload_static.php
449 /modules/ps_categoryproducts/vendor/autoload.php
450 /modules/ps_categoryproducts/vendor/composer/autoload_real.php
451 /modules/ps_categoryproducts/vendor/composer/platform_check.php
452 /modules/ps_categoryproducts/vendor/composer/autoload_static.php
453 /modules/ps_wirepayment/vendor/autoload.php
454 /modules/ps_wirepayment/vendor/composer/autoload_real.php
455 /modules/ps_wirepayment/vendor/composer/platform_check.php
456 /modules/ps_wirepayment/vendor/composer/autoload_static.php
457 /modules/statsregistrations/vendor/autoload.php
458 /modules/statsregistrations/vendor/composer/autoload_real.php
459 /modules/statsregistrations/vendor/composer/platform_check.php
460 /modules/statsregistrations/vendor/composer/autoload_static.php
461 /modules/ps_distributionapiclient/vendor/autoload.php
462 /modules/ps_distributionapiclient/vendor/composer/autoload_real.php
463 /modules/ps_distributionapiclient/vendor/composer/platform_check.php
464 /modules/ps_distributionapiclient/vendor/composer/autoload_static.php
465 /modules/ps_distributionapiclient/vendor/symfony/polyfill-intl-grapheme/bootstrap.php
466 /modules/ps_distributionapiclient/vendor/symfony/string/Resources/functions.php
467 /modules/ps_emailalerts/vendor/autoload.php
468 /modules/ps_emailalerts/vendor/composer/autoload_real.php
469 /modules/ps_emailalerts/vendor/composer/platform_check.php
470 /modules/ps_emailalerts/vendor/composer/autoload_static.php
471 /modules/ps_brandlist/vendor/autoload.php
472 /modules/ps_brandlist/vendor/composer/autoload_real.php
473 /modules/ps_brandlist/vendor/composer/platform_check.php
474 /modules/ps_brandlist/vendor/composer/autoload_static.php
475 /modules/ps_viewedproduct/vendor/autoload.php
476 /modules/ps_viewedproduct/vendor/composer/autoload_real.php
477 /modules/ps_viewedproduct/vendor/composer/platform_check.php
478 /modules/ps_viewedproduct/vendor/composer/autoload_static.php
479 /modules/iqitsociallogin/vendor/autoload.php
480 /modules/iqitsociallogin/vendor/composer/autoload_real.php
481 /modules/iqitsociallogin/vendor/composer/platform_check.php
482 /modules/iqitsociallogin/vendor/composer/autoload_static.php
483 /modules/gmerchantcenterpro/vendor/autoload.php
484 /modules/gmerchantcenterpro/vendor/composer/autoload_real.php
485 /modules/gmerchantcenterpro/vendor/composer/platform_check.php
486 /modules/gmerchantcenterpro/vendor/composer/autoload_static.php
487 /modules/wizardai/vendor/autoload.php
488 /modules/wizardai/vendor/composer/autoload_real.php
489 /modules/wizardai/vendor/composer/platform_check.php
490 /modules/wizardai/vendor/composer/autoload_static.php
491 /modules/wizardai/vendor/clue/stream-filter/src/functions_include.php
492 /modules/wizardai/vendor/clue/stream-filter/src/functions.php
493 /modules/wizardai/vendor/guzzlehttp/psr7/src/functions_include.php
494 /modules/wizardai/vendor/guzzlehttp/psr7/src/functions.php
495 /modules/wizardai/vendor/php-http/message/src/filters.php
496 /modules/wizardai/vendor/symfony/polyfill-apcu/bootstrap.php
497 /modules/stripe_official/vendor/autoload.php
498 /modules/stripe_official/vendor/composer/autoload_real.php
499 /modules/stripe_official/vendor/composer/platform_check.php
500 /modules/stripe_official/vendor/composer/autoload_static.php
501 /modules/vivawalletsmartcheckout/vendor/autoload.php
502 /modules/vivawalletsmartcheckout/vendor/composer/autoload_real.php
503 /modules/vivawalletsmartcheckout/vendor/composer/autoload_static.php
504 /modules/autoupgrade/vendor/autoload.php
505 /modules/autoupgrade/vendor/composer/autoload_real.php
506 /modules/autoupgrade/vendor/composer/autoload_static.php
507 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment.php
508 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Client.php
509 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer.php
510 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/QueueConsumer.php
511 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/File.php
512 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/ForkCurl.php
513 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/LibCurl.php
514 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/Socket.php
515 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Version.php
516 /modules/ps_faviconnotificationbo/vendor/autoload.php
517 /modules/ps_faviconnotificationbo/vendor/composer/autoload_real.php
518 /modules/ps_faviconnotificationbo/vendor/composer/platform_check.php
519 /modules/ps_faviconnotificationbo/vendor/composer/autoload_static.php
520 /src/Core/Localization/Locale/Repository.php
521 /src/Core/Localization/Locale/RepositoryInterface.php
522 /src/Core/Localization/CLDR/LocaleRepository.php
523 /src/Core/Localization/CLDR/LocaleDataSource.php
524 /src/Core/Localization/CLDR/DataLayer/LocaleCache.php
525 /src/Core/Data/Layer/AbstractDataLayer.php
526 /src/Core/Localization/CLDR/LocaleDataLayerInterface.php
527 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/FilesystemAdapter.php
528 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AbstractAdapter.php
529 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractAdapterTrait.php
530 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractTrait.php
531 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ContractsTrait.php
532 /vendor/symfony/contracts/Cache/CacheTrait.php
533 /vendor/psr/cache/src/InvalidArgumentException.php
534 /vendor/psr/cache/src/CacheException.php
535 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemTrait.php
536 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemCommonTrait.php
537 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/DefaultMarshaller.php
538 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/MarshallerInterface.php
539 /src/Core/Localization/CLDR/DataLayer/LocaleReference.php
540 /src/Core/Localization/CLDR/Reader.php
541 /src/Core/Localization/CLDR/ReaderInterface.php
542 /src/Core/Localization/Currency/Repository.php
543 /src/Core/Localization/Currency/RepositoryInterface.php
544 /src/Core/Localization/Currency/CurrencyDataSource.php
545 /src/Core/Localization/Currency/DataSourceInterface.php
546 /src/Core/Localization/Currency/DataLayer/CurrencyCache.php
547 /src/Core/Localization/Currency/CurrencyDataLayerInterface.php
548 /src/Core/Localization/Currency/DataLayer/CurrencyDatabase.php
549 /src/Adapter/Currency/CurrencyDataProvider.php
550 /src/Core/Currency/CurrencyDataProviderInterface.php
551 /src/Adapter/LegacyContext.php
552 /src/Adapter/Tools.php
553 /src/Core/Localization/Currency/DataLayer/CurrencyReference.php
554 /src/Core/Localization/Currency/DataLayer/CurrencyInstalled.php
555 /vendor/prestashop/decimal/src/Operation/Rounding.php
556 /src/Core/Localization/Locale.php
557 /src/Core/Localization/LocaleInterface.php
558 /src/Core/Localization/Specification/Price.php
559 /src/Core/Localization/Specification/Number.php
560 /src/Core/Localization/Specification/NumberInterface.php
561 /src/Core/Localization/Specification/Factory.php
562 /src/Core/Localization/CLDR/LocaleData.php
563 /src/Core/Localization/CLDR/NumberSymbolsData.php
564 /src/Core/Localization/CLDR/CurrencyData.php
565 /src/Core/Localization/CLDR/Locale.php
566 /src/Core/Localization/CLDR/LocaleInterface.php
567 /src/Core/Localization/Specification/NumberSymbolList.php
568 /classes/Currency.php
569 /src/Core/Localization/Currency/LocalizedCurrencyId.php
570 /classes/webservice/WebserviceRequest.php
571 /src/Core/Localization/Currency/CurrencyData.php
572 /src/Core/Localization/Currency/CurrencyCollection.php
573 /src/Core/Localization/Currency.php
574 /src/Core/Localization/CurrencyInterface.php
575 /src/Core/Localization/Specification/NumberCollection.php
576 /src/Core/Localization/Number/Formatter.php
577 /classes/Cart.php
578 /src/Adapter/AddressFactory.php
579 /override/classes/CartRule.php
580 /classes/CartRule.php
581 /classes/Product.php
582 /src/Core/Domain/Product/ValueObject/RedirectType.php
583 /src/Core/Util/DateTime/DateTime.php
584 /src/Core/Domain/Product/Stock/ValueObject/OutOfStockType.php
585 /src/Core/Domain/Product/Pack/ValueObject/PackStockType.php
586 /src/Core/Domain/Product/ValueObject/ProductType.php
587 /src/Core/Domain/Product/ValueObject/Reference.php
588 /src/Core/Domain/Product/ValueObject/Ean13.php
589 /src/Core/Domain/Product/ValueObject/Isbn.php
590 /src/Core/Domain/Product/ValueObject/Upc.php
591 /src/Core/Domain/Product/ProductSettings.php
592 /src/Core/Domain/Shop/ValueObject/ShopId.php
593 /src/Core/Domain/Shop/ValueObject/ShopIdInterface.php
594 /modules/ps_emailalerts/ps_emailalerts.php
595 /modules/ps_emailalerts/MailAlert.php
596 /src/PrestaShopBundle/Translation/DomainNormalizer.php
597 /modules/facebookconversiontrackingplus/facebookconversiontrackingplus.php
598 /modules/facebookconversiontrackingplus/classes/autoload.php
599 /modules/facebookconversiontrackingplus/translations/fr.php
600 /modules/facebookconversiontrackingplus/classes/ConversionApi.php
601 /modules/facebookconversiontrackingplus/classes/PixelTools.php
602 /modules/facebookconversiontrackingplus/classes/IpGeolocation.php
603 /src/Core/Security/OpenSsl/OpenSSL.php
604 /src/Core/Security/OpenSsl/OpenSSLInterface.php
605 /modules/facebookconversiontrackingplus/classes/SmartForm.php
606 /override/classes/Media.php
607 /classes/Media.php
608 /src/Adapter/Presenter/Cart/CartLazyArray.php
609 /src/Adapter/Presenter/AbstractLazyArray.php
610 /src/Adapter/Product/PriceFormatter.php
611 /src/Core/Util/Inflector.php
612 /vendor/doctrine/inflector/lib/Doctrine/Inflector/InflectorFactory.php
613 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Language.php
614 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/InflectorFactory.php
615 /vendor/doctrine/inflector/lib/Doctrine/Inflector/GenericLanguageInflectorFactory.php
616 /vendor/doctrine/inflector/lib/Doctrine/Inflector/LanguageInflectorFactory.php
617 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Rules.php
618 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Ruleset.php
619 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformations.php
620 /vendor/doctrine/inflector/lib/Doctrine/Inflector/WordInflector.php
621 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Inflectible.php
622 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformation.php
623 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Pattern.php
624 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Patterns.php
625 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Uninflected.php
626 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitutions.php
627 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitution.php
628 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Word.php
629 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Inflector.php
630 /vendor/doctrine/inflector/lib/Doctrine/Inflector/CachedWordInflector.php
631 /vendor/doctrine/inflector/lib/Doctrine/Inflector/RulesetInflector.php
632 /classes/Gender.php
633 /classes/Risk.php
634 /classes/Meta.php
635 /modules/revsliderprestashop/revsliderprestashop.php
636 /modules/revsliderprestashop/rev-loader.php
637 /modules/revsliderprestashop/includes/revslider_db.class.php
638 /modules/revsliderprestashop/includes/data.class.php
639 /modules/revsliderprestashop/includes/functions.class.php
640 /modules/revsliderprestashop/includes/em-integration.class.php
641 /modules/revsliderprestashop/includes/cssparser.class.php
642 /modules/revsliderprestashop/includes/woocommerce.class.php
643 /modules/revsliderprestashop/includes/wpml.class.php
644 /modules/revsliderprestashop/includes/colorpicker.class.php
645 /modules/revsliderprestashop/includes/navigation.class.php
646 /modules/revsliderprestashop/includes/object-library.class.php
647 /modules/revsliderprestashop/admin/includes/loadbalancer.class.php
648 /modules/revsliderprestashop/admin/includes/plugin-update.class.php
649 /modules/revsliderprestashop/includes/extension.class.php
650 /modules/revsliderprestashop/includes/favorite.class.php
651 /modules/revsliderprestashop/includes/aq-resizer.class.php
652 /modules/revsliderprestashop/includes/external-sources.class.php
653 /modules/revsliderprestashop/includes/page-template.class.php
654 /modules/revsliderprestashop/includes/slider.class.php
655 /modules/revsliderprestashop/includes/slide.class.php
656 /modules/revsliderprestashop/includes/output.class.php
657 /modules/revsliderprestashop/public/revslider-front.class.php
658 /modules/revsliderprestashop/includes/backwards.php
659 /modules/revsliderprestashop/admin/includes/class-pclzip.php
660 /modules/revsliderprestashop/admin/includes/license.class.php
661 /modules/revsliderprestashop/admin/includes/addons.class.php
662 /modules/revsliderprestashop/admin/includes/template.class.php
663 /modules/revsliderprestashop/admin/includes/functions-admin.class.php
664 /modules/revsliderprestashop/admin/includes/folder.class.php
665 /modules/revsliderprestashop/admin/includes/import.class.php
666 /modules/revsliderprestashop/admin/includes/export.class.php
667 /modules/revsliderprestashop/admin/includes/export-html.class.php
668 /modules/revsliderprestashop/admin/includes/newsletter.class.php
669 /modules/revsliderprestashop/admin/revslider-admin.class.php
670 /modules/revsliderprestashop/includes/update.class.php
671 /modules/revsliderprestashop/includes/resize-imag.php
672 /modules/revsliderprestashop/translations/fr.php
673 /classes/Address.php
674 /classes/ImageType.php
675 /classes/State.php
676 /src/Core/Security/PasswordPolicyConfiguration.php
677 /src/Core/Configuration/DataConfigurationInterface.php
678 /src/Core/Filter/FrontEndObject/MainFilter.php
679 /src/Core/Filter/FilterInterface.php
680 /src/Core/Filter/FrontEndObject/CartFilter.php
681 /src/Core/Filter/HashMapWhitelistFilter.php
682 /src/Core/Filter/CollectionFilter.php
683 /src/Core/Filter/FrontEndObject/ProductFilter.php
684 /src/Core/Filter/FrontEndObject/EmbeddedAttributesFilter.php
685 /src/Core/Filter/FrontEndObject/CustomerFilter.php
686 /src/Core/Filter/FrontEndObject/ShopFilter.php
687 /src/Core/Filter/FrontEndObject/ConfigurationFilter.php
688 /modules/ps_shoppingcart/ps_shoppingcart.php
689 /src/Core/Module/WidgetInterface.php
690 /modules/ps_googleanalytics/ps_googleanalytics.php
691 /modules/ps_googleanalytics/classes/Hook/HookDisplayHeader.php
692 /modules/ps_googleanalytics/classes/Hook/HookInterface.php
693 /vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php
694 /var/cache/prod/smarty/compile/warehouse/ee/78/8a/ee788a7ffa4b95e0a488ef6dc4b9f3c8b40ce111_2.file.ps_googleanalytics.tpl.php
695 /vendor/smarty/smarty/libs/plugins/modifier.escape.php
696 /modules/iqitcompare/iqitcompare.php
697 /modules/iqitcompare/translations/fr.php
698 /modules/iqitcontactpage/iqitcontactpage.php
699 /modules/iqitcontactpage/translations/fr.php
700 /modules/iqitcookielaw/iqitcookielaw.php
701 /modules/iqitcookielaw/translations/fr.php
702 /modules/iqitcountdown/iqitcountdown.php
703 /modules/iqitcountdown/translations/fr.php
704 /modules/iqitelementor/iqitelementor.php
705 /modules/iqitelementor/src/IqitElementorLanding.php
706 /modules/iqitelementor/src/IqitElementorTemplate.php
707 /modules/iqitelementor/src/IqitElementorProduct.php
708 /modules/iqitelementor/src/IqitElementorCategory.php
709 /modules/iqitelementor/src/IqitElementorContent.php
710 /modules/iqitelementor/src/iqitElementorWpHelper.php
711 /modules/iqitelementor/includes/plugin-elementor.php
712 /modules/iqitelementor/src/widgets/IqitElementorWidget_Brands.php
713 /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsList.php
714 /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsListTabs.php
715 /modules/iqitelementor/src/widgets/IqitElementorWidget_Modules.php
716 /modules/iqitelementor/src/widgets/IqitElementorWidget_CustomTpl.php
717 /modules/iqitelementor/src/widgets/IqitElementorWidget_Menu.php
718 /modules/iqitelementor/src/widgets/IqitElementorWidget_RevolutionSlider.php
719 /modules/iqitelementor/src/widgets/IqitElementorWidget_Newsletter.php
720 /modules/iqitelementor/src/widgets/IqitElementorWidget_Blog.php
721 /modules/iqitelementor/src/widgets/IqitElementorWidget_Search.php
722 /modules/iqitelementor/src/widgets/IqitElementorWidget_Links.php
723 /modules/iqitelementor/src/widgets/IqitElementorWidget_ContactForm.php
724 /modules/iqitelementor/translations/fr.php
725 /modules/iqitfreedeliverycount/iqitfreedeliverycount.php
726 /modules/iqitfreedeliverycount/translations/fr.php
727 /modules/iqitmegamenu/iqitmegamenu.php
728 /modules/iqitmegamenu/models/IqitMenuTab.php
729 /modules/iqitmegamenu/models/IqitMenuHtml.php
730 /modules/iqitmegamenu/models/IqitMenuLinks.php
731 /modules/iqitmegamenu/translations/fr.php
732 /modules/iqitsizecharts/iqitsizecharts.php
733 /modules/iqitsizecharts/src/IqitSizeCharts.php
734 /modules/iqitsizecharts/translations/fr.php
735 /modules/iqitwishlist/iqitwishlist.php
736 /modules/iqitwishlist/src/IqitWishlistProduct.php
737 /modules/iqitwishlist/translations/fr.php
738 /modules/iqitextendedproduct/iqitextendedproduct.php
739 /modules/iqitextendedproduct/src/IqitThreeSixty.php
740 /modules/iqitextendedproduct/src/IqitProductVideo.php
741 /modules/iqitextendedproduct/translations/fr.php
742 /classes/assets/PrestashopAssetsLibraries.php
743 /modules/iqitsociallogin/iqitsociallogin.php
744 /modules/iqitsociallogin/translations/fr.php
745 /modules/gmerchantcenterpro/gmerchantcenterpro.php
746 /modules/gmerchantcenterpro/translations/fr.php
747 /modules/gmerchantcenterpro/lib/moduleTools.php
748 /modules/gmerchantcenterpro/conf/moduleConfiguration.php
749 /modules/gmerchantcenterpro/lib/moduleUpdate.php
750 /modules/gmerchantcenterpro/lib/install/installController.php
751 /modules/gmerchantcenterpro/lib/install/installSql.php
752 /modules/gmerchantcenterpro/lib/install/installInterface.php
753 /modules/gmerchantcenterpro/models/Feeds.php
754 /modules/gmerchantcenterpro/lib/hook/hookController.php
755 /modules/gmerchantcenterpro/lib/hook/hookDisplay.php
756 /modules/gmerchantcenterpro/lib/hook/hookBase.php
757 /modules/gmerchantcenterpro/lib/dao/moduleDao.php
758 /var/cache/prod/smarty/compile/warehouse/f7/5f/75/f75f75b788ebecd0995da205f357ac74693f8076_2.file.header.tpl.php
759 /modules/stripe_official/stripe_official.php
760 /classes/PaymentModule.php
761 /modules/stripe_official/vendor/stripe/stripe-php/lib/Event.php
762 /modules/stripe_official/vendor/stripe/stripe-php/lib/ApiResource.php
763 /modules/stripe_official/vendor/stripe/stripe-php/lib/StripeObject.php
764 /modules/stripe_official/vendor/stripe/stripe-php/lib/ApiOperations/Request.php
765 /modules/stripe_official/classes/services/PrestashopTranslationService.php
766 /src/Adapter/Localization/LegacyTranslator.php
767 /modules/stripe_official/smarty/plugins/modifier.stripelreplace.php
768 /modules/stripe_official/vendor/stripe/stripe-php/lib/Stripe.php
769 /modules/stripe_official/vendor/stripe/stripe-php/lib/Util/ApiVersion.php
770 /modules/wizardai/vendor/prestashop/module-lib-service-container/src/DependencyInjection/ServiceContainer.php
771 /modules/stripe_official/classes/services/StripeDisplayHeaderService.php
772 /modules/abandonedcart/abandonedcart.php
773 /modules/abandonedcart/classes/abandonedcart_core.php
774 /modules/abandonedcart/translations/fr.php
775 /var/cache/prod/smarty/compile/warehouse/7f/09/a0/7f09a045a9b3f592faaac1a3835665419330db11_2.file.abandonedcart_front.tpl.php
776 /modules/vivawalletsmartcheckout/vivawalletsmartcheckout.php
777 /modules/vivawalletsmartcheckout/src/Helpers/Config.php
778 /modules/vivawalletsmartcheckout/config/app.php
779 /modules/vivawalletsmartcheckout/src/Helpers/General.php
780 /modules/vivawalletsmartcheckout/translations/fr.php
781 /modules/vivawalletsmartcheckout/vendor/vivawallet/vivawallet-php/lib/Application.php
782 /src/Core/Product/Search/ProductSearchContext.php
783 /src/Core/Product/Search/ProductSearchQuery.php
784 /src/Core/Product/Search/SortOrder.php
785 /modules/ps_facetedsearch/ps_facetedsearch.php
786 /modules/ps_facetedsearch/src/HookDispatcher.php
787 /modules/ps_facetedsearch/src/Hook/Attribute.php
788 /modules/ps_facetedsearch/src/Hook/AbstractHook.php
789 /modules/ps_facetedsearch/src/Hook/AttributeGroup.php
790 /modules/ps_facetedsearch/src/Hook/Category.php
791 /modules/ps_facetedsearch/src/Hook/Configuration.php
792 /modules/ps_facetedsearch/src/Hook/Design.php
793 /modules/ps_facetedsearch/src/Hook/Feature.php
794 /modules/ps_facetedsearch/src/Form/Feature/FormModifier.php
795 /modules/ps_facetedsearch/src/Form/Feature/FormDataProvider.php
796 /modules/ps_facetedsearch/src/Hook/FeatureValue.php
797 /modules/ps_facetedsearch/src/Form/FeatureValue/FormModifier.php
798 /modules/ps_facetedsearch/src/Form/FeatureValue/FormDataProvider.php
799 /modules/ps_facetedsearch/src/Hook/Product.php
800 /modules/ps_facetedsearch/src/Hook/ProductSearch.php
801 /modules/ps_facetedsearch/src/Hook/SpecificPrice.php
802 /modules/ps_facetedsearch/src/Filters/Provider.php
803 /modules/ps_facetedsearch/src/URLSerializer.php
804 /modules/ps_facetedsearch/src/Filters/DataAccessor.php
805 /modules/ps_facetedsearch/src/Product/SearchProvider.php
806 /src/Core/Product/Search/FacetsRendererInterface.php
807 /src/Core/Product/Search/ProductSearchProviderInterface.php
808 /modules/ps_facetedsearch/src/Filters/Converter.php
809 /modules/ps_facetedsearch/src/Product/SearchFactory.php
810 /src/Core/Product/Search/ProductSearchResult.php
811 /modules/ps_facetedsearch/src/Product/Search.php
812 /modules/ps_facetedsearch/src/Adapter/MySQL.php
813 /modules/ps_facetedsearch/src/Adapter/AbstractAdapter.php
814 /modules/ps_facetedsearch/src/Adapter/InterfaceAdapter.php
815 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ArrayCollection.php
816 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Collection.php
817 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ReadableCollection.php
818 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Selectable.php
819 /modules/ps_facetedsearch/src/Filters/Products.php
820 /classes/stock/StockAvailable.php
821 /modules/ps_facetedsearch/src/Filters/Block.php
822 /classes/Category.php
823 /modules/ps_facetedsearch/src/Definition/Availability.php
824 /src/Core/Product/Search/Facet.php
825 /src/Core/Product/Search/Filter.php
826 /vendor/prestashop/decimal/src/DecimalNumber.php
827 /vendor/prestashop/decimal/src/Builder.php
828 /src/Core/Product/Search/FacetCollection.php
829 /classes/ProductAssembler.php
830 /classes/Combination.php
831 /classes/tax/Tax.php
832 /classes/Manufacturer.php
833 /classes/SpecificPrice.php
834 /classes/tax/TaxManagerFactory.php
835 /classes/tax/TaxRulesTaxManager.php
836 /classes/tax/TaxManagerInterface.php
837 /classes/tax/TaxCalculator.php
838 /classes/GroupReduction.php
839 /src/Core/Localization/CLDR/ComputingPrecision.php
840 /src/Core/Localization/CLDR/ComputingPrecisionInterface.php
841 /classes/Pack.php
842 /override/classes/order/Order.php
843 /classes/order/Order.php
844 /classes/Feature.php
845 /classes/ProductPresenterFactory.php
846 /src/Adapter/Presenter/Product/ProductListingPresenter.php
847 /src/Adapter/Presenter/Product/ProductPresenter.php
848 /src/Adapter/Product/ProductColorsRetriever.php
849 /src/Adapter/HookManager.php
850 /src/Core/Product/ProductPresentationSettings.php
851 /src/Adapter/Presenter/Product/ProductListingLazyArray.php
852 /src/Adapter/Presenter/Product/ProductLazyArray.php
853 /classes/Image.php
854 /src/Core/Image/ImageFormatConfiguration.php
855 /src/Core/Image/ImageFormatConfigurationInterface.php
856 /classes/FeatureFlag.php
857 /src/Core/FeatureFlag/FeatureFlagSettings.php
858 /vendor/prestashop/decimal/src/Operation/Multiplication.php
859 /vendor/prestashop/decimal/src/Operation/Addition.php
860 /var/cache/prod/smarty/compile/warehouse/d4/1d/65/d41d65d76b9471b5d365fe06cf1737c89a53af9f_2.module.ps_facetedsearchviewstemplatesfrontcatalogfacets.tpl.php
861 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_block.php
862 /vendor/smarty/smarty/libs/plugins/modifier.count.php
863 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php
864 /var/cache/prod/smarty/compile/warehouse/fb/ea/98/fbea98a84e509d7477392fb3e2519b1e908ae1d0_2.module.ps_facetedsearchviewstemplatesfrontcatalogfacetsdropdown.tpl.php
865 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_foreach.php
866 /var/cache/prod/smarty/compile/warehouse/2e/80/73/2e807335546cfa2360c36327ac89dd2fcb054379_2.module.ps_facetedsearchviewstemplatesfrontcatalogactivefilters.tpl.php
867 /src/Core/Product/Search/Pagination.php
868 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/ed/b5/3f/edb53f222ce1fd2513bbdc5d9fc4357d962657b5_2.file.prices-drop.tpl.php
869 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/90/cf/46/90cf4679dc49439c314d4747bbab91e7cd883211_2.file.product-list.tpl.php
870 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/20/1d/59/201d594b12ddb0579e97d2d00a38f32349d7f8e2_2.file.layout-full-width.tpl.php
871 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/9f/c0/0d/9fc00de9dab18af4bad561c5978e37a5cf7ba8dc_2.file.layout-both-columns.tpl.php
872 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/cb/45/38/cb4538e80db186323bd2c849a93c3a874eb9fa44_2.file.helpers.tpl.php
873 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_tplfunction.php
874 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/a3/5d/99/a35d9996c0259409d557b9de6f17182667bd08c0_2.file.head.tpl.php
875 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/d8/66/63/d8666378896e3199131756b2a049789ce82f9145_2.file.head-jsonld.tpl.php
876 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/8e/7c/ff/8e7cff5cfb78f6670e25ee2a2964eb6ccbe1b9d5_2.file.product-list-jsonld.tpl.php
877 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/b5/08/e2/b508e285f88ade9f85c8711af34aa86844c85366_2.file.pagination-seo.tpl.php
878 /vendor/smarty/smarty/libs/plugins/modifier.replace.php
879 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/52/ed/5b/52ed5bf4088d07f918e31ad1872568dff1a15122_2.file.stylesheets.tpl.php
880 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/2a/77/40/2a7740ed942475bcc06c5e40d5346b6b574f1441_2.file.javascript.tpl.php
881 /classes/ProductDownload.php
882 /src/Core/Cart/Calculator.php
883 /src/Core/Cart/CartRowCollection.php
884 /src/Core/Cart/Fees.php
885 /src/Core/Cart/AmountImmutable.php
886 /src/Core/Cart/CartRuleCollection.php
887 /src/Core/Cart/CartRuleCalculator.php
888 /src/Adapter/Product/PriceCalculator.php
889 /src/Core/Cart/CartRow.php
890 /vendor/symfony/symfony/src/Symfony/Component/Translation/PluralizationRules.php
891 /src/Core/Util/String/StringModifier.php
892 /src/Core/Util/String/StringModifierInterface.php
893 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/05/ac/4e/05ac4e59da39afc94ba29fd4c5bed100b6b3da19_2.file.product-activation.tpl.php
894 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/05/4d/41/054d41abc5a541ea4fd30d63caa94ec106d2993b_2.file.header.tpl.php
895 /modules/iqitlinksmanager/iqitlinksmanager.php
896 /modules/iqitlinksmanager/src/IqitLinkBlockRepository.php
897 /modules/iqitlinksmanager/src/IqitLinkBlock.php
898 /modules/iqitlinksmanager/src/IqitLinkBlockPresenter.php
899 /modules/iqitlinksmanager/translations/fr.php
900 /vendor/smarty/smarty/libs/sysplugins/smarty_template_cached.php
901 /vendor/smarty/smarty/libs/sysplugins/smarty_cacheresource.php
902 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_cacheresource_file.php
903 /var/cache/prod/smarty/cache/iqitlinksmanager/1/1/1/21/displayNav1/warehouse/a9/f2/c1/a9f2c1869604c8c628073c46891a26fcf1453e27.iqitlinksmanagerviewstemplateshookiqitlinksmanager.tpl.php
904 /modules/ps_languageselector/ps_languageselector.php
905 /modules/ps_currencyselector/ps_currencyselector.php
906 /var/cache/prod/smarty/compile/warehouse/73/27/77/73277702161b17505d668b28b8368941cf42c568_2.module.iqitwishlistviewstemplateshookdisplaynav.tpl.php
907 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/03/c2/a5/03c2a55aa51a9b7d61e7f129a111606f12475287_2.file.header-3.tpl.php
908 /modules/iqitsearch/iqitsearch.php
909 /modules/iqitsearch/translations/fr.php
910 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_gettemplatevars.php
911 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/d9/9b/94/d99b947421dcff226f28b1d6cb674c91f17399db_2.module.iqitsearchviewstemplateshookiqitsearchbtn.tpl.php
912 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/46/29/db/4629dbb3c4efa13c090c633dc2e46e5f2b42bed3_2.module.iqitsearchviewstemplateshooksearchbar.tpl.php
913 /modules/ps_customersignin/ps_customersignin.php
914 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/72/be/19/72be192e406191c1cad554abe284e159adeb4234_2.module.ps_customersigninps_customersigninbtn.tpl.php
915 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/b4/a4/76/b4a476e0a8201677b298f7c0f8ca1ac698e1bac3_2.module.ps_shoppingcartps_shoppingcartbtn.tpl.php
916 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/35/65/5e/35655e6409b6198f29dd6e732ef9598dec599880_2.module.ps_shoppingcartps_shoppingcart.tpl.php
917 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/f6/e9/f2/f6e9f2b1680a466582d2199d038efe2cfa3a83f7_2.module.ps_shoppingcartps_shoppingcartcontent.tpl.php
918 /var/cache/prod/smarty/cache/iqitmegamenu/index/1/1/1/21/warehouse/70/ca/47/70ca47640f8f16a0dd1dc3b1fce177bbeed38257.iqitmegamenuviewstemplateshookhorizontal.tpl.php
919 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/ce/2d/19/ce2d19cd13f5f27943d104183b745be20e3618a6_2.file.mobile-header-1.tpl.php
920 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/7a/30/38/7a3038780284d52e9fcd7a66e51e5b86a166106b_2.module.iqitsearchviewstemplateshooksearchbarmobile.tpl.php
921 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/be/ee/e6/beeee6f3d87613010f8af1cabc4c4562f8cf600a_2.module.ps_customersigninps_customersigninmobile.tpl.php
922 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/d4/e1/57/d4e1571b6b210795247564db06deb17061778b51_2.module.ps_shoppingcartps_shoppingcartmqty.tpl.php
923 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/28/b8/a6/28b8a6fb36f22bef1e0b5c53910267c19ceae859_2.file.breadcrumb.tpl.php
924 /modules/iqitproductsnav/iqitproductsnav.php
925 /modules/iqitproductsnav/translations/fr.php
926 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/f1/e6/1e/f1e61e7ca59d67ddb45735d3ba11885aabdcd7c1_2.file.notifications.tpl.php
927 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/8f/2c/f2/8f2cf264e8ef24eff54cdc3881bd1071ff6abcc5_2.file.products-top.tpl.php
928 /vendor/smarty/smarty/libs/plugins/modifier.regex_replace.php
929 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/ca/43/26/ca432646d2c581a6631dbab0f8a0ded19562cc5d_2.file.sort-orders.tpl.php
930 /var/cache/prod/smarty/compile/warehouse/81/a1/04/81a1040ed0eeab6f58198f9907167c7fced628c5_2.module.ps_facetedsearchps_facetedsearch.tpl.php
931 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/52/57/07/52570740bcdee3193f952d35d0d11ce53ff537f4_2.file.products.tpl.php
932 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/45/91/09/4591095b1d399add495fc541674f2fceb9d0f0e3_2.file.product.tpl.php
933 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/cb/91/6c/cb916c508b6fcc743788f1d7f95631e94668cb9d_2.file.product-miniature-1.tpl.php
934 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/31/03/a9/3103a9a485af7d714612ac0c47dbcfbc05c4fd95_2.file.product-miniature-thumb.tpl.php
935 /var/cache/prod/smarty/compile/warehouse/e9/21/d5/e921d51c062189725606e51308456f33ad945843_2.module.iqitwishlistviewstemplateshookproductminiature.tpl.php
936 /var/cache/prod/smarty/compile/warehouse/90/53/a0/9053a0dd520a39bef75969a0e9efeeae750df91b_2.module.iqitcompareviewstemplateshookproductminiature.tpl.php
937 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_capture.php
938 /var/cache/prod/smarty/compile/warehouse/55/c7/a8/55c7a89f423f7f64b1b84881dcb668e4d788f013_2.module.iqitcountdownviewstemplateshookproduct.tpl.php
939 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/6c/98/2d/6c982d5090ff11db9654f1a7f6945865bc19603f_2.file.product-miniature-btn.tpl.php
940 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/8f/7a/83/8f7a832567456fbcc9b33e35ba7ca0da997b29d7_2.file.pagination.tpl.php
941 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/b1/d3/1b/b1d31b2d2e40bf3996d3350fd9793c705dd5bee6_2.file.products-bottom.tpl.php
942 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/99/9e/63/999e637a129f69005ecaa1ec5a360060ed703447_2.file.footer.tpl.php
943 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/7b/ea/10/7bea10cca96ef6b28b8f036ef026a7c11e3bde56_2.file.footer-1.tpl.php
944 /var/cache/prod/smarty/cache/iqitlinksmanager/1/1/1/21/displayFooter/warehouse/a9/f2/c1/a9f2c1869604c8c628073c46891a26fcf1453e27.iqitlinksmanagerviewstemplateshookiqitlinksmanager.tpl.php
945 /var/cache/prod/smarty/compile/warehouse/47/ac/57/47ac57039d904771d1de42366e1791900bdd2c2f_2.file.pixelheader.tpl.php
946 /vendor/smarty/smarty/libs/plugins/shared.mb_str_replace.php
947 /var/cache/prod/smarty/compile/warehouse/d5/a3/51/d5a351153329745771ab994e1aac2c50a2871ed1_2.file.pages_viewed.tpl.php
948 /var/cache/prod/smarty/compile/warehouse/e8/03/5a/e8035a8d1c12c085b510041163fece5592f47256_2.file.addtocart17.tpl.php
949 /var/cache/prod/smarty/compile/warehouse/77/34/89/773489e70d2bbbc33a3532f583f69463b9e8d34b_2.file.wishlist-iqitwishlist.tpl.php
950 /var/cache/prod/smarty/compile/warehouse/0b/1e/ae/0b1eae8b95d210de6545ab4d36ef1e0da4a2995c_2.file.newsletter.tpl.php
951 /var/cache/prod/smarty/compile/warehouse/bb/a9/2e/bba92e35e07193f35df4d88c25fef9c1ee267db4_2.file.page_time_event.tpl.php
952 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/2f/e6/59/2fe659ce5c8a3b849eecceed2fd2484c04ba6f2b_2.file.social-links.tpl.php
953 /modules/ps_emailsubscription/ps_emailsubscription.php
954 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/ca/11/75/ca1175f42cce659c415ef88a938d72e6064791dd_2.file.footer-copyrights-1.tpl.php
955 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/b2/b4/18/b2b418437d59a5c40ab3bf79b4a0534fdfc59e9d_2.file.password-policy-template.tpl.php
956 /classes/form/CustomerLoginForm.php
957 /classes/form/AbstractForm.php
958 /classes/form/FormInterface.php
959 /src/Core/Foundation/Templating/RenderableInterface.php
960 /classes/form/CustomerLoginFormatter.php
961 /classes/form/FormFormatterInterface.php
962 /classes/ValidateConstraintTranslator.php
963 /src/Core/Util/InternationalizedDomainNameConverter.php
964 /src/Core/Foundation/Templating/RenderableProxy.php
965 /var/cache/prod/smarty/compile/warehouse/52/f1/b8/52f1b8b385d74962f57df5c0ac1b0e91d62e4760_2.module.iqitwishlistviewstemplateshookdisplaymodal.tpl.php
966 /classes/form/FormField.php
967 /var/cache/prod/smarty/compile/warehouse/30/f5/ac/30f5acd1c8eb485e903c518c39df62f6dab88d7e_2.file.login-form.tpl.php
968 /var/cache/prod/smarty/compile/warehouse/21/f2/27/21f227e16d661dac3c649c0ff89b74dcf6812c75_2.file.form-errors.tpl.php
969 /var/cache/prod/smarty/compile/08/dc/b1/08dcb1adde6be40af6fcc0544d63eb4badcd22a6_2.file.form-fields.tpl.php
970 /var/cache/prod/smarty/compile/21/f2/27/21f227e16d661dac3c649c0ff89b74dcf6812c75_2.file.form-errors.tpl.php
971 /var/cache/prod/smarty/cache/iqitsociallogin/1/1/1/21/warehouse/7b/d5/c3/7bd5c305fe941e7514c4da4c50a911312eb62349.iqitsocialloginviewstemplateshookauthentication.tpl.php
972 /var/cache/prod/smarty/compile/warehouse/d4/a2/00/d4a200912ea9e133f46cf39b7eadc37ea7dd3d2f_2.module.iqitcompareviewstemplateshookdisplaymodal.tpl.php
973 /var/cache/prod/smarty/cache/iqitcookielaw/1/1/1/21/warehouse/6c/9a/c7/6c9ac7fc236180074d341c4bb3247222ad3545d0.iqitcookielawviewstemplateshookiqitcookielaw.tpl.php
974 /modules/ps_googleanalytics/classes/Hook/HookDisplayBeforeBodyClosingTag.php
975 /modules/ps_googleanalytics/classes/Handler/GanalyticsJsHandler.php
976 /modules/ps_googleanalytics/classes/Handler/GanalyticsDataHandler.php
977 /modules/ps_googleanalytics/classes/Repository/GanalyticsDataRepository.php
978 /modules/ps_googleanalytics/classes/Wrapper/ProductWrapper.php
979 /modules/ps_googleanalytics/classes/GoogleAnalyticsTools.php
980 /var/cache/prod/smarty/compile/warehouse/5c/93/46/5c93465cfee83ad9edb76aeff8896d92c35ee986_2.file.ga_tag.tpl.php