Promotions

Product added to wishlist
Product added to compare.

Ce site utilise des cookies provenant de Google afin de fournir ses services et d'analyser le trafic. Les informations relatives à votre utilisation du site sont partagées avec Google. En cliquant sur "Accepter", vous acceptez l'utilisation des cookies.

Load Time 177.546 ms
Querying Time 113 ms
Queries 524
Memory Peak Usage 20.6 Mb
Included Files 988 files - 13.21 Mb
PrestaShop Cache - Mb
Global vars 0.61 Mb
PrestaShop Version 8.2.0
PHP Version 8.1.34
MySQL Version 11.4.10-MariaDB
Memory Limit 4048M
Max Execution Time 600s
Smarty Cache enabled
Smarty Compilation auto
  Time Cumulated Time Memory Usage Memory Peak Usage
config 0.942 ms 0.942 ms 3.76 Mb 4.2 Mb
__construct 0.017 ms 0.959 ms - Mb 4.2 Mb
init 4.464 ms 5.423 ms 0.80 Mb 4.9 Mb
setMedia 1.121 ms 6.544 ms 0.25 Mb 4.9 Mb
postProcess 0.001 ms 6.545 ms - Mb 4.9 Mb
initHeader 0.000 ms 6.545 ms - Mb 4.9 Mb
initContent 133.569 ms 140.114 ms 9.57 Mb 14.5 Mb
initFooter 0.002 ms 140.116 ms - Mb 14.5 Mb
display 37.430 ms 177.546 ms 5.56 Mb 20.6 Mb
Hook Time Memory Usage
displayProductListFunctionalButtons 3.253 ms 0.04 Mb
DisplayFooter 2.301 ms 0.84 Mb
displayBeforeBodyClosingTag 2.079 ms 0.63 Mb
DisplayHeader 1.347 ms 0.14 Mb
displayCountDown 1.293 ms 0.09 Mb
DisplayBeforeBodyClosingTag 0.812 ms 0.10 Mb
displayNav2 0.716 ms 0.18 Mb
displayMainMenu 0.562 ms 0.17 Mb
displayNav1 0.543 ms 0.09 Mb
displayCustomerLoginFormAfter 0.293 ms 0.07 Mb
renderWidget 0.286 ms 0.11 Mb
displayFooter 0.268 ms 0.09 Mb
displayAfterBreadcrumb 0.147 ms 0.04 Mb
ProductSearchProvider 0.122 ms - Mb
ActionFrontControllerSetMedia 0.063 ms - Mb
DisplayProductPriceBlock 0.032 ms 0.04 Mb
OverrideLayoutTemplate 0.030 ms - Mb
DisplayTop 0.012 ms - Mb
ModuleRoutes 0.004 ms - Mb
ActionDispatcher 0.004 ms - Mb
ActionProductSearchAfter 0.003 ms - Mb
Header 0.001 ms - Mb
22 hook(s) 14.171 ms 2.66 Mb
Module Time Memory Usage
ph_simpleblog 1.280 ms 0.25 Mb
iqitthemeeditor 0.339 ms 0.15 Mb
ps_emailalerts 0.091 ms 0.04 Mb
facebookconversiontrackingplus 2.955 ms 1.01 Mb
revolutpayment 0.341 ms 0.12 Mb
revsliderprestashop 0.492 ms 0.14 Mb
ps_shoppingcart 0.056 ms 0.02 Mb
ps_googleanalytics 1.085 ms 0.16 Mb
iqitcompare 1.787 ms 0.11 Mb
iqitcontactpage 0.059 ms 0.02 Mb
iqitcookielaw 0.349 ms 0.14 Mb
iqitcountdown 1.375 ms 0.08 Mb
iqitelementor 0.230 ms 0.07 Mb
iqitfreedeliverycount 0.061 ms 0.02 Mb
iqitmegamenu 0.713 ms 0.23 Mb
iqitsizecharts 0.085 ms 0.10 Mb
iqitwishlist 3.941 ms 0.67 Mb
iqitextendedproduct 0.088 ms 0.05 Mb
iqitsociallogin 0.359 ms 0.09 Mb
gmerchantcenterpro 5.966 ms 1.20 Mb
stripe_official 0.269 ms 0.11 Mb
abandonedcart 0.341 ms 0.02 Mb
vivawalletsmartcheckout 0.176 ms - Mb
ps_facetedsearch 0.568 ms 0.21 Mb
iqitlinksmanager 0.856 ms 0.17 Mb
ps_languageselector 0.194 ms 0.06 Mb
ps_currencyselector 0.169 ms 0.06 Mb
iqitsearch 0.144 ms 0.01 Mb
ps_customersignin 0.040 ms 0.02 Mb
iqitproductsnav 0.275 ms 0.06 Mb
ps_emailsubscription 0.208 ms 0.08 Mb
31 module(s) 24.891 ms 5.46 Mb

Stopwatch SQL - 524 queries

# Query Time (ms) Rows Filesort Group By Location
141
SELECT SQL_NO_CACHE p.id_product FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pl.name FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_product_lang pl ON (p.id_product = pl.id_product AND pl.id_shop = 1 AND pl.id_lang = 1) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_specific_price sp ON (
sp.id_product = p.id_product AND 
sp.id_shop IN (0, 1) AND 
sp.id_currency IN (0, 1) AND 
sp.id_country IN (0, 21) AND 
sp.id_group IN (0, 1) AND 
sp.from_quantity = 1 AND
sp.reduction > 0 AND
sp.id_customer = 0 AND
sp.id_cart = 0 AND 
(sp.from = '0000-00-00 00:00:00' OR '2026-04-28 18:47:45' >= sp.from) AND 
(sp.to = '0000-00-00 00:00:00' OR '2026-04-28 18:47:45' <= sp.to) 
) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (55029, 33207, 751256, 33206, 33210, 33209, 86883))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND sp.reduction>0 GROUP BY p.id_product) p INNER JOIN een_product_lang pl ON (p.id_product = pl.id_product AND pl.id_shop = 1 AND pl.id_lang = 1) GROUP BY p.id_product ORDER BY p.name ASC, p.id_product DESC
7.395 ms 28493040 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
142
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pl.name FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_product_lang pl ON (p.id_product = pl.id_product AND pl.id_shop = 1 AND pl.id_lang = 1) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_specific_price sp ON (
sp.id_product = p.id_product AND 
sp.id_shop IN (0, 1) AND 
sp.id_currency IN (0, 1) AND 
sp.id_country IN (0, 21) AND 
sp.id_group IN (0, 1) AND 
sp.from_quantity = 1 AND
sp.reduction > 0 AND
sp.id_customer = 0 AND
sp.id_cart = 0 AND 
(sp.from = '0000-00-00 00:00:00' OR '2026-04-28 18:47:45' >= sp.from) AND 
(sp.to = '0000-00-00 00:00:00' OR '2026-04-28 18:47:45' <= sp.to) 
) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (55029, 33207, 751256, 33206, 33210, 33209, 86883))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND sp.reduction>0 GROUP BY p.id_product) p LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((p.on_sale=1)) AND ((fp_1.id_feature_value IN (55029, 33207, 751256, 33206, 33210, 33209, 86883)))
7.237 ms 6401520 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
157
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pl.name FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_product_lang pl ON (p.id_product = pl.id_product AND pl.id_shop = 1 AND pl.id_lang = 1) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_specific_price sp ON (
sp.id_product = p.id_product AND 
sp.id_shop IN (0, 1) AND 
sp.id_currency IN (0, 1) AND 
sp.id_country IN (0, 21) AND 
sp.id_group IN (0, 1) AND 
sp.from_quantity = 1 AND
sp.reduction > 0 AND
sp.id_customer = 0 AND
sp.id_cart = 0 AND 
(sp.from = '0000-00-00 00:00:00' OR '2026-04-28 18:47:45' >= sp.from) AND 
(sp.to = '0000-00-00 00:00:00' OR '2026-04-28 18:47:45' <= sp.to) 
) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (55029, 33207, 751256, 33206, 33210, 33209, 86883))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND sp.reduction>0 GROUP BY p.id_product) p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((sa.out_of_stock=1) OR (sa.quantity>0)) AND ((fp_1.id_feature_value IN (55029, 33207, 751256, 33206, 33210, 33209, 86883)))
6.958 ms 12803040 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
156
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pl.name FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_product_lang pl ON (p.id_product = pl.id_product AND pl.id_shop = 1 AND pl.id_lang = 1) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_specific_price sp ON (
sp.id_product = p.id_product AND 
sp.id_shop IN (0, 1) AND 
sp.id_currency IN (0, 1) AND 
sp.id_country IN (0, 21) AND 
sp.id_group IN (0, 1) AND 
sp.from_quantity = 1 AND
sp.reduction > 0 AND
sp.id_customer = 0 AND
sp.id_cart = 0 AND 
(sp.from = '0000-00-00 00:00:00' OR '2026-04-28 18:47:45' >= sp.from) AND 
(sp.to = '0000-00-00 00:00:00' OR '2026-04-28 18:47:45' <= sp.to) 
) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (55029, 33207, 751256, 33206, 33210, 33209, 86883))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND sp.reduction>0 GROUP BY p.id_product) p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_stock_available sa_1 ON (p.id_product = sa_1.id_product AND IFNULL(pac.id_product_attribute, 0) = sa_1.id_product_attribute AND sa_1.id_shop = 1  AND sa_1.id_shop_group = 0 ) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((sa.quantity<=0 AND sa_1.out_of_stock IN (0, 2))) AND ((fp_1.id_feature_value IN (55029, 33207, 751256, 33206, 33210, 33209, 86883)))
6.925 ms 12803040 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
158
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pl.name FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_product_lang pl ON (p.id_product = pl.id_product AND pl.id_shop = 1 AND pl.id_lang = 1) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_specific_price sp ON (
sp.id_product = p.id_product AND 
sp.id_shop IN (0, 1) AND 
sp.id_currency IN (0, 1) AND 
sp.id_country IN (0, 21) AND 
sp.id_group IN (0, 1) AND 
sp.from_quantity = 1 AND
sp.reduction > 0 AND
sp.id_customer = 0 AND
sp.id_cart = 0 AND 
(sp.from = '0000-00-00 00:00:00' OR '2026-04-28 18:47:45' >= sp.from) AND 
(sp.to = '0000-00-00 00:00:00' OR '2026-04-28 18:47:45' <= sp.to) 
) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (55029, 33207, 751256, 33206, 33210, 33209, 86883))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND sp.reduction>0 GROUP BY p.id_product) p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((sa.quantity>0)) AND ((fp_1.id_feature_value IN (55029, 33207, 751256, 33206, 33210, 33209, 86883)))
6.921 ms 12803040 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
147
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pl.name FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_product_lang pl ON (p.id_product = pl.id_product AND pl.id_shop = 1 AND pl.id_lang = 1) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_specific_price sp ON (
sp.id_product = p.id_product AND 
sp.id_shop IN (0, 1) AND 
sp.id_currency IN (0, 1) AND 
sp.id_country IN (0, 21) AND 
sp.id_group IN (0, 1) AND 
sp.from_quantity = 1 AND
sp.reduction > 0 AND
sp.id_customer = 0 AND
sp.id_cart = 0 AND 
(sp.from = '0000-00-00 00:00:00' OR '2026-04-28 18:47:45' >= sp.from) AND 
(sp.to = '0000-00-00 00:00:00' OR '2026-04-28 18:47:45' <= sp.to) 
) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (55029, 33207, 751256, 33206, 33210, 33209, 86883))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND sp.reduction>0 GROUP BY p.id_product) p INNER JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=13)) AND ((fp_1.id_feature_value IN (55029, 33207, 751256, 33206, 33210, 33209, 86883))) GROUP BY fp.id_feature_value
6.841 ms 6401520 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
143
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pl.name FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_product_lang pl ON (p.id_product = pl.id_product AND pl.id_shop = 1 AND pl.id_lang = 1) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_specific_price sp ON (
sp.id_product = p.id_product AND 
sp.id_shop IN (0, 1) AND 
sp.id_currency IN (0, 1) AND 
sp.id_country IN (0, 21) AND 
sp.id_group IN (0, 1) AND 
sp.from_quantity = 1 AND
sp.reduction > 0 AND
sp.id_customer = 0 AND
sp.id_cart = 0 AND 
(sp.from = '0000-00-00 00:00:00' OR '2026-04-28 18:47:45' >= sp.from) AND 
(sp.to = '0000-00-00 00:00:00' OR '2026-04-28 18:47:45' <= sp.to) 
) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (55029, 33207, 751256, 33206, 33210, 33209, 86883))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND sp.reduction>0 GROUP BY p.id_product) p LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (55029, 33207, 751256, 33206, 33210, 33209, 86883))) AND p.date_add>'2026-01-29 00:00:00'
6.819 ms 6401520 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
145
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pl.name FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_product_lang pl ON (p.id_product = pl.id_product AND pl.id_shop = 1 AND pl.id_lang = 1) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_specific_price sp ON (
sp.id_product = p.id_product AND 
sp.id_shop IN (0, 1) AND 
sp.id_currency IN (0, 1) AND 
sp.id_country IN (0, 21) AND 
sp.id_group IN (0, 1) AND 
sp.from_quantity = 1 AND
sp.reduction > 0 AND
sp.id_customer = 0 AND
sp.id_cart = 0 AND 
(sp.from = '0000-00-00 00:00:00' OR '2026-04-28 18:47:45' >= sp.from) AND 
(sp.to = '0000-00-00 00:00:00' OR '2026-04-28 18:47:45' <= sp.to) 
) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (55029, 33207, 751256, 33206, 33210, 33209, 86883))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND sp.reduction>0 GROUP BY p.id_product) p INNER JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=10)) AND ((fp_1.id_feature_value IN (55029, 33207, 751256, 33206, 33210, 33209, 86883))) GROUP BY fp.id_feature_value
6.812 ms 6401520 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
150
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pl.name FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_product_lang pl ON (p.id_product = pl.id_product AND pl.id_shop = 1 AND pl.id_lang = 1) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_specific_price sp ON (
sp.id_product = p.id_product AND 
sp.id_shop IN (0, 1) AND 
sp.id_currency IN (0, 1) AND 
sp.id_country IN (0, 21) AND 
sp.id_group IN (0, 1) AND 
sp.from_quantity = 1 AND
sp.reduction > 0 AND
sp.id_customer = 0 AND
sp.id_cart = 0 AND 
(sp.from = '0000-00-00 00:00:00' OR '2026-04-28 18:47:45' >= sp.from) AND 
(sp.to = '0000-00-00 00:00:00' OR '2026-04-28 18:47:45' <= sp.to) 
) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND sp.reduction>0 GROUP BY p.id_product) p INNER JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature=29)) GROUP BY fp.id_feature_value
6.210 ms 1094116 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
155
SELECT SQL_NO_CACHE cp.id_category, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pl.name FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_product_lang pl ON (p.id_product = pl.id_product AND pl.id_shop = 1 AND pl.id_lang = 1) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_specific_price sp ON (
sp.id_product = p.id_product AND 
sp.id_shop IN (0, 1) AND 
sp.id_currency IN (0, 1) AND 
sp.id_country IN (0, 21) AND 
sp.id_group IN (0, 1) AND 
sp.from_quantity = 1 AND
sp.reduction > 0 AND
sp.id_customer = 0 AND
sp.id_cart = 0 AND 
(sp.from = '0000-00-00 00:00:00' OR '2026-04-28 18:47:45' >= sp.from) AND 
(sp.to = '0000-00-00 00:00:00' OR '2026-04-28 18:47:45' <= sp.to) 
) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (55029, 33207, 751256, 33206, 33210, 33209, 86883))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND sp.reduction>0 GROUP BY p.id_product) p INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (55029, 33207, 751256, 33206, 33210, 33209, 86883))) AND cg.id_group='1' AND c.level_depth<=2 AND c.nleft>2 AND c.nright<659 GROUP BY cp.id_category
1.835 ms 49280 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
159
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pl.name FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_product_lang pl ON (p.id_product = pl.id_product AND pl.id_shop = 1 AND pl.id_lang = 1) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_specific_price sp ON (
sp.id_product = p.id_product AND 
sp.id_shop IN (0, 1) AND 
sp.id_currency IN (0, 1) AND 
sp.id_country IN (0, 21) AND 
sp.id_group IN (0, 1) AND 
sp.from_quantity = 1 AND
sp.reduction > 0 AND
sp.id_customer = 0 AND
sp.id_cart = 0 AND 
(sp.from = '0000-00-00 00:00:00' OR '2026-04-28 18:47:45' >= sp.from) AND 
(sp.to = '0000-00-00 00:00:00' OR '2026-04-28 18:47:45' <= sp.to) 
) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (55029, 33207, 751256, 33206, 33210, 33209, 86883))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND sp.reduction>0 GROUP BY p.id_product) p INNER JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=17)) AND ((fp_1.id_feature_value IN (55029, 33207, 751256, 33206, 33210, 33209, 86883))) GROUP BY fp.id_feature_value
1.745 ms 4536 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
144
SELECT SQL_NO_CACHE psi.price_min, MIN(price_min) as min, MAX(price_max) as max FROM een_product p INNER JOIN een_layered_price_index psi ON (psi.id_product = p.id_product AND psi.id_shop = 1 AND psi.id_currency = 1 AND psi.id_country = 21) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_specific_price sp ON (
sp.id_product = p.id_product AND 
sp.id_shop IN (0, 1) AND 
sp.id_currency IN (0, 1) AND 
sp.id_country IN (0, 21) AND 
sp.id_group IN (0, 1) AND 
sp.from_quantity = 1 AND
sp.reduction > 0 AND
sp.id_customer = 0 AND
sp.id_cart = 0 AND 
(sp.from = '0000-00-00 00:00:00' OR '2026-04-28 18:47:45' >= sp.from) AND 
(sp.to = '0000-00-00 00:00:00' OR '2026-04-28 18:47:45' <= sp.to) 
) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (55029, 33207, 751256, 33206, 33210, 33209, 86883))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND sp.reduction>0
1.311 ms 1046 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
148
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pl.name FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_product_lang pl ON (p.id_product = pl.id_product AND pl.id_shop = 1 AND pl.id_lang = 1) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_specific_price sp ON (
sp.id_product = p.id_product AND 
sp.id_shop IN (0, 1) AND 
sp.id_currency IN (0, 1) AND 
sp.id_country IN (0, 21) AND 
sp.id_group IN (0, 1) AND 
sp.from_quantity = 1 AND
sp.reduction > 0 AND
sp.id_customer = 0 AND
sp.id_cart = 0 AND 
(sp.from = '0000-00-00 00:00:00' OR '2026-04-28 18:47:45' >= sp.from) AND 
(sp.to = '0000-00-00 00:00:00' OR '2026-04-28 18:47:45' <= sp.to) 
) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (55029, 33207, 751256, 33206, 33210, 33209, 86883))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND sp.reduction>0 GROUP BY p.id_product) p INNER JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=20)) AND ((fp_1.id_feature_value IN (55029, 33207, 751256, 33206, 33210, 33209, 86883))) GROUP BY fp.id_feature_value
1.055 ms 2208 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
3
SELECT SQL_NO_CACHE c.`name`, cl.`id_lang`, IF(cl.`id_lang` IS NULL, c.`value`, cl.`value`) AS value, c.id_shop_group, c.id_shop
FROM `een_configuration` c
LEFT JOIN `een_configuration_lang` cl ON (c.`id_configuration` = cl.`id_configuration`)
1.042 ms 1696 /classes/Configuration.php:180
14
SELECT SQL_NO_CACHE h.`name` as hook, m.`id_module`, h.`id_hook`, m.`name` as module
FROM `een_module` m
INNER JOIN een_module_shop module_shop
ON (module_shop.id_module = m.id_module AND module_shop.id_shop = 1 AND module_shop.enable_device & 1)
INNER JOIN `een_hook_module` `hm` ON hm.`id_module` = m.`id_module`
INNER JOIN `een_hook` `h` ON hm.`id_hook` = h.`id_hook`
LEFT JOIN `een_module_group` `mg` ON mg.`id_module` = m.`id_module`
WHERE (h.`name` != "paymentOptions") AND (hm.`id_shop` = 1) AND (mg.id_shop = 1 AND  mg.`id_group` IN (1))
GROUP BY hm.id_hook, hm.id_module
ORDER BY hm.`position`
0.650 ms 244 Yes Yes /classes/Hook.php:1267
174
SELECT SQL_NO_CACHE `id_hook`, `name`
FROM `een_hook`
UNION
SELECT `id_hook`, ha.`alias` as name
FROM `een_hook_alias` ha
INNER JOIN `een_hook` h ON ha.name = h.name
0.649 ms 0 /classes/Hook.php:1326
175
SELECT SQL_NO_CACHE h.id_hook, h.name as h_name, title, description, h.position, hm.position as hm_position, m.id_module, m.name, m.active
FROM `een_hook_module` hm
STRAIGHT_JOIN `een_hook` h ON (h.id_hook = hm.id_hook AND hm.id_shop = 1)
STRAIGHT_JOIN `een_module` as m ON (m.id_module = hm.id_module)
ORDER BY hm.position
0.607 ms 486 /classes/Hook.php:456
152
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pl.name FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_product_lang pl ON (p.id_product = pl.id_product AND pl.id_shop = 1 AND pl.id_lang = 1) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_specific_price sp ON (
sp.id_product = p.id_product AND 
sp.id_shop IN (0, 1) AND 
sp.id_currency IN (0, 1) AND 
sp.id_country IN (0, 21) AND 
sp.id_group IN (0, 1) AND 
sp.from_quantity = 1 AND
sp.reduction > 0 AND
sp.id_customer = 0 AND
sp.id_cart = 0 AND 
(sp.from = '0000-00-00 00:00:00' OR '2026-04-28 18:47:45' >= sp.from) AND 
(sp.to = '0000-00-00 00:00:00' OR '2026-04-28 18:47:45' <= sp.to) 
) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (55029, 33207, 751256, 33206, 33210, 33209, 86883))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND sp.reduction>0 GROUP BY p.id_product) p INNER JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=34)) AND ((fp_1.id_feature_value IN (55029, 33207, 751256, 33206, 33210, 33209, 86883))) GROUP BY fp.id_feature_value
0.581 ms 224 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
523
SELECT SQL_NO_CACHE cp.`id_category`, cp.`id_product`, cl.`name` FROM `een_category_product` cp
LEFT JOIN `een_category` c ON (c.id_category = cp.id_category)
LEFT JOIN `een_category_lang` cl ON (cp.`id_category` = cl.`id_category` AND cl.id_shop = 1 )
INNER JOIN een_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
WHERE cp.`id_product` IN (3893,647813,40017,36971,40037,40036,40040,40039,6722,36837,30970,4476,4446,4514,4502,12863,40032,40034,647781,36979) AND cl.`id_lang` = 1
ORDER BY c.`level_depth` DESC
0.362 ms 57 Yes /modules/ps_googleanalytics/classes/Wrapper/ProductWrapper.php:109
160
SELECT SQL_NO_CACHE p.*,
ps.*,
pl.*,
sa.out_of_stock,
IFNULL(sa.quantity, 0) as quantity,
(DATEDIFF(
p.`date_add`,
DATE_SUB(
'2026-04-28 00:00:00',
INTERVAL 90 DAY
)
) > 0) as new
FROM een_product p
LEFT JOIN een_product_lang pl
ON pl.id_product = p.id_product
AND pl.id_shop = 1
AND pl.id_lang = 1
LEFT JOIN een_stock_available sa   ON sa.id_product = p.id_product
AND sa.id_product_attribute = 0
AND sa.id_shop = 1 LEFT JOIN een_product_shop ps
ON ps.id_product = p.id_product
AND ps.id_shop = 1
WHERE p.id_product IN (3893,647813,40017,36971,40037,40036,40040,40039,6722,36837,30970,4476,4446,4514,4502,12863,40032,40034,647781,36979)
0.360 ms 20 /classes/ProductAssembler.php:95
101
SELECT SQL_NO_CACHE *
FROM `een_gmcp_feeds` ff
WHERE (ff.id_shop=1)
ORDER BY ff.feed_is_default ASC
0.322 ms 370 Yes /modules/gmerchantcenterpro/models/Feeds.php:62
154
SELECT SQL_NO_CACHE c.`id_category`, cl.`name`
FROM `een_category` c
INNER JOIN een_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `een_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
ORDER BY c.nleft, c.position
0.306 ms 330 Yes /classes/Category.php:724
13
SELECT SQL_NO_CACHE lower(name) as name
FROM `een_hook` h
WHERE (h.active = 1)
0.285 ms 1060 /classes/Hook.php:1366
139
SELECT SQL_NO_CACHE DISTINCT f.id_feature, f.*, fl.*, IF(liflv.`url_name` IS NULL OR liflv.`url_name` = "", NULL, liflv.`url_name`) AS url_name, IF(liflv.`meta_title` IS NULL OR liflv.`meta_title` = "", NULL, liflv.`meta_title`) AS meta_title, lif.indexable FROM `een_feature` f  INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1) LEFT JOIN `een_feature_lang` fl ON (f.`id_feature` = fl.`id_feature` AND fl.`id_lang` = 1) LEFT JOIN `een_layered_indexable_feature` lif ON (f.`id_feature` = lif.`id_feature`) LEFT JOIN `een_layered_indexable_feature_lang_value` liflv ON (f.`id_feature` = liflv.`id_feature` AND liflv.`id_lang` = 1) ORDER BY f.`position` ASC
0.244 ms 29 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:171
96
SHOW COLUMNS FROM een_gmcp_feeds LIKE "feed_is_default"
0.234 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:128
140
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `een_feature_value` v LEFT JOIN `een_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `een_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 29 ORDER BY vl.`value` ASC
0.229 ms 40 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
231
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 40036) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 2 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.229 ms 2 Yes /classes/SpecificPrice.php:576
188
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 647813) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.227 ms 2 Yes /classes/SpecificPrice.php:576
171
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 3893) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.225 ms 2 Yes /classes/SpecificPrice.php:576
221
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 40037) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 2 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.225 ms 2 Yes /classes/SpecificPrice.php:576
199
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 40017) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.223 ms 2 Yes /classes/SpecificPrice.php:576
251
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 40039) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 2 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.223 ms 2 Yes /classes/SpecificPrice.php:576
211
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 36971) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 2 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.221 ms 2 Yes /classes/SpecificPrice.php:576
241
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 40040) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 2 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.220 ms 2 Yes /classes/SpecificPrice.php:576
262
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 6722) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.216 ms 2 Yes /classes/SpecificPrice.php:576
370
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 647781) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.214 ms 2 Yes /classes/SpecificPrice.php:576
305
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 4446) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.209 ms 2 Yes /classes/SpecificPrice.php:576
295
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 4476) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.202 ms 2 Yes /classes/SpecificPrice.php:576
274
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 36837) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.201 ms 2 Yes /classes/SpecificPrice.php:576
381
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 36979) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.200 ms 2 Yes /classes/SpecificPrice.php:576
58
SHOW TABLES LIKE "een_gmcp_1800"
0.200 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:88
284
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 30970) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.196 ms 2 Yes /classes/SpecificPrice.php:576
337
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 12863) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.196 ms 2 Yes /classes/SpecificPrice.php:576
316
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 4514) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.193 ms 2 Yes /classes/SpecificPrice.php:576
326
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 4502) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.192 ms 2 Yes /classes/SpecificPrice.php:576
348
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 40032) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.192 ms 2 Yes /classes/SpecificPrice.php:576
358
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 40034) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.192 ms 2 Yes /classes/SpecificPrice.php:576
256
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 40039 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 40039 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.190 ms 0 /classes/Cart.php:1430
146
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `een_feature_value` v LEFT JOIN `een_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `een_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 10 ORDER BY vl.`value` ASC
0.188 ms 37 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
167
SELECT SQL_NO_CACHE DISTINCT `id_product` FROM `een_specific_price` WHERE `id_product` != 0
0.187 ms 523 /classes/SpecificPrice.php:310
182
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 3893
ORDER BY f.position ASC
0.185 ms 11 Yes /classes/Product.php:6021
181
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 3893 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 3893 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.184 ms 0 /classes/Cart.php:1430
472
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (3893) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.181 ms 1 Yes Yes /classes/Product.php:4524
65
SHOW TABLES LIKE "een_gmcp_1900"
0.177 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:88
151
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `een_feature_value` v LEFT JOIN `een_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `een_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 29 ORDER BY vl.`value` ASC
0.175 ms 40 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
473
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (647813) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.174 ms 1 Yes Yes /classes/Product.php:4524
16
SELECT SQL_NO_CACHE `id_hook`, `name` FROM `een_hook`
0.172 ms 1060 /classes/Hook.php:1326
97
SHOW COLUMNS FROM een_gmcp_discount_association LIKE "channel"
0.170 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:128
257
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 40039
ORDER BY f.position ASC
0.170 ms 2 Yes /classes/Product.php:6021
193
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 647813 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 647813 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.168 ms 0 /classes/Cart.php:1430
236
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 40036 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 40036 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.166 ms 0 /classes/Cart.php:1430
481
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (36837) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.164 ms 1 Yes Yes /classes/Product.php:4524
98
SHOW COLUMNS FROM een_gmcp_tags LIKE "custom_label_set_postion"
0.163 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:128
216
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 36971 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 36971 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.163 ms 0 /classes/Cart.php:1430
204
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 40017 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 40017 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.161 ms 0 /classes/Cart.php:1430
246
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 40040 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 40040 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.161 ms 0 /classes/Cart.php:1430
194
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 647813
ORDER BY f.position ASC
0.160 ms 6 Yes /classes/Product.php:6021
226
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 40037 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 40037 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.160 ms 0 /classes/Cart.php:1430
484
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4446) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.159 ms 1 Yes Yes /classes/Product.php:4524
363
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 40034 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 40034 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.157 ms 0 /classes/Cart.php:1430
474
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (40017) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.157 ms 1 Yes Yes /classes/Product.php:4524
483
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4476) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.155 ms 1 Yes Yes /classes/Product.php:4524
475
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (36971) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.152 ms 1 Yes Yes /classes/Product.php:4524
485
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4514) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.151 ms 1 Yes Yes /classes/Product.php:4524
476
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (40037) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.150 ms 1 Yes Yes /classes/Product.php:4524
479
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (40039) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.149 ms 1 Yes Yes /classes/Product.php:4524
205
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 40017
ORDER BY f.position ASC
0.147 ms 2 Yes /classes/Product.php:6021
268
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6722 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6722 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.146 ms 0 /classes/Cart.php:1430
477
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (40036) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.146 ms 1 Yes Yes /classes/Product.php:4524
488
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (40032) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.146 ms 1 Yes Yes /classes/Product.php:4524
20
SELECT SQL_NO_CACHE m.page, ml.url_rewrite, ml.id_lang
FROM `een_meta` m
LEFT JOIN `een_meta_lang` ml ON (m.id_meta = ml.id_meta AND ml.id_shop = 1 )
ORDER BY LENGTH(ml.url_rewrite) DESC
0.145 ms 66 Yes /classes/Dispatcher.php:654
217
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 36971
ORDER BY f.position ASC
0.145 ms 2 Yes /classes/Product.php:6021
482
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (30970) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.145 ms 1 Yes Yes /classes/Product.php:4524
486
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4502) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.145 ms 1 Yes Yes /classes/Product.php:4524
478
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (40040) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.143 ms 1 Yes Yes /classes/Product.php:4524
342
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 12863 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 12863 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.143 ms 0 /classes/Cart.php:1430
269
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6722
ORDER BY f.position ASC
0.142 ms 7 Yes /classes/Product.php:6021
386
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 36979 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 36979 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.142 ms 0 /classes/Cart.php:1430
480
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6722) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.141 ms 1 Yes Yes /classes/Product.php:4524
491
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (36979) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.141 ms 1 Yes Yes /classes/Product.php:4524
2
SELECT SQL_NO_CACHE gs.*, s.*, gs.name AS group_name, s.name AS shop_name, s.active, su.domain, su.domain_ssl, su.physical_uri, su.virtual_uri
FROM een_shop_group gs
LEFT JOIN een_shop s
ON s.id_shop_group = gs.id_shop_group
LEFT JOIN een_shop_url su
ON s.id_shop = su.id_shop AND su.main = 1
WHERE s.deleted = 0
AND gs.deleted = 0
ORDER BY gs.name, s.name
0.141 ms 1 Yes /classes/shop/Shop.php:715
447
SELECT SQL_NO_CACHE 1 FROM `een_cart_rule` WHERE ((date_to >= "2026-04-28 00:00:00" AND date_to <= "2026-04-28 23:59:59") OR (date_from >= "2026-04-28 00:00:00" AND date_from <= "2026-04-28 23:59:59") OR (date_from < "2026-04-28 00:00:00" AND date_to > "2026-04-28 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
0.141 ms 2 /classes/CartRule.php:357
487
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (12863) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.141 ms 1 Yes Yes /classes/Product.php:4524
490
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (647781) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.141 ms 1 Yes Yes /classes/Product.php:4524
489
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (40034) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.140 ms 1 Yes Yes /classes/Product.php:4524
227
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 40037
ORDER BY f.position ASC
0.140 ms 2 Yes /classes/Product.php:6021
237
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 40036
ORDER BY f.position ASC
0.140 ms 2 Yes /classes/Product.php:6021
247
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 40040
ORDER BY f.position ASC
0.140 ms 2 Yes /classes/Product.php:6021
279
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 36837 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 36837 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.139 ms 0 /classes/Cart.php:1430
289
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 30970 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 30970 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.139 ms 0 /classes/Cart.php:1430
301
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4476
ORDER BY f.position ASC
0.139 ms 9 Yes /classes/Product.php:6021
186
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 647813) AND (b.`id_shop` = 1) LIMIT 1
0.138 ms 1 /src/Adapter/EntityMapper.php:71
375
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 647781 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 647781 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.138 ms 0 /classes/Cart.php:1430
332
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4502
ORDER BY f.position ASC
0.137 ms 7 Yes /classes/Product.php:6021
353
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 40032 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 40032 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.137 ms 0 /classes/Cart.php:1430
376
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 647781
ORDER BY f.position ASC
0.137 ms 5 Yes /classes/Product.php:6021
444
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 36979) AND (b.`id_shop` = 1) LIMIT 1
0.137 ms 1 /src/Adapter/EntityMapper.php:71
448
SELECT SQL_NO_CACHE * FROM `een_cart_rule` cr
LEFT JOIN `een_cart_rule_lang` crl 
ON (cr.`id_cart_rule` = crl.`id_cart_rule` AND crl.`id_lang` = 1) WHERE (cr.`id_customer` = 0) AND NOW() BETWEEN cr.date_from AND cr.date_to
AND cr.`active` = 1
AND free_shipping = 1 AND carrier_restriction = 1
0.137 ms 1 /classes/CartRule.php:423
310
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4446 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4446 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.137 ms 0 /classes/Cart.php:1430
311
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4446
ORDER BY f.position ASC
0.136 ms 6 Yes /classes/Product.php:6021
450
SELECT SQL_NO_CACHE * FROM `een_cart_rule` cr
LEFT JOIN `een_cart_rule_lang` crl 
ON (cr.`id_cart_rule` = crl.`id_cart_rule` AND crl.`id_lang` = 0) WHERE (cr.`id_customer` = 0) AND NOW() BETWEEN cr.date_from AND cr.date_to
AND cr.`active` = 1
AND cr.`quantity` > 0 AND highlight = 1 AND code NOT LIKE "BO_ORDER_%"
0.136 ms 1 /classes/CartRule.php:423
300
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4476 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4476 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.135 ms 0 /classes/Cart.php:1430
321
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4514 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4514 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.135 ms 0 /classes/Cart.php:1430
331
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4502 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4502 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.135 ms 0 /classes/Cart.php:1430
439
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 40034) AND (b.`id_shop` = 1) LIMIT 1
0.135 ms 1 /src/Adapter/EntityMapper.php:71
322
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4514
ORDER BY f.position ASC
0.131 ms 6 Yes /classes/Product.php:6021
442
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 647781
ORDER BY `position`
0.131 ms 11 Yes /classes/Product.php:3545
24
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `een_module` m
LEFT JOIN `een_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
0.130 ms 104 /classes/module/Module.php:346
343
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 12863
ORDER BY f.position ASC
0.130 ms 4 Yes /classes/Product.php:6021
427
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4514) AND (b.`id_shop` = 1) LIMIT 1
0.129 ms 1 /src/Adapter/EntityMapper.php:71
149
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `een_feature_value` v LEFT JOIN `een_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `een_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 20 ORDER BY vl.`value` ASC
0.128 ms 9 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
176
SELECT SQL_NO_CACHE tr.*
FROM `een_tax_rule` tr
JOIN `een_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 21
AND tr.`id_tax_rules_group` = 1
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.128 ms 1 /classes/tax/TaxRulesTaxManager.php:109
387
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 36979
ORDER BY f.position ASC
0.128 ms 1 Yes /classes/Product.php:6021
388
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 3893) AND (b.`id_shop` = 1) LIMIT 1
0.128 ms 1 /src/Adapter/EntityMapper.php:71
397
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 36971) AND (b.`id_shop` = 1) LIMIT 1
0.127 ms 1 /src/Adapter/EntityMapper.php:71
406
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 40040) AND (b.`id_shop` = 1) LIMIT 1
0.127 ms 1 /src/Adapter/EntityMapper.php:71
445
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 36979
ORDER BY `position`
0.125 ms 7 Yes /classes/Product.php:3545
258
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6722
AND image_shop.`cover` = 1 LIMIT 1
0.125 ms 6 /classes/Product.php:3570
364
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 40034
ORDER BY f.position ASC
0.124 ms 1 Yes /classes/Product.php:6021
403
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 40036) AND (b.`id_shop` = 1) LIMIT 1
0.124 ms 1 /src/Adapter/EntityMapper.php:71
412
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6722) AND (b.`id_shop` = 1) LIMIT 1
0.124 ms 1 /src/Adapter/EntityMapper.php:71
102
SELECT SQL_NO_CACHE *
FROM `een_gmcp_feeds` ff
WHERE (ff.iso_lang="fr") AND (ff.id_shop=1)
ORDER BY ff.feed_is_default ASC
0.123 ms 370 Yes /modules/gmerchantcenterpro/models/Feeds.php:72
280
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 36837
ORDER BY f.position ASC
0.123 ms 2 Yes /classes/Product.php:6021
290
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 30970
ORDER BY f.position ASC
0.123 ms 2 Yes /classes/Product.php:6021
409
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 40039) AND (b.`id_shop` = 1) LIMIT 1
0.123 ms 1 /src/Adapter/EntityMapper.php:71
1
SELECT SQL_NO_CACHE s.id_shop, CONCAT(su.physical_uri, su.virtual_uri) AS uri, su.domain, su.main
FROM een_shop_url su
LEFT JOIN een_shop s ON (s.id_shop = su.id_shop)
WHERE (su.domain = 'decozzia.com' OR su.domain_ssl = 'decozzia.com')
AND s.active = 1
AND s.deleted = 0
ORDER BY LENGTH(CONCAT(su.physical_uri, su.virtual_uri)) DESC
0.121 ms 1 Yes /classes/shop/Shop.php:1364
394
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 40017) AND (b.`id_shop` = 1) LIMIT 1
0.119 ms 1 /src/Adapter/EntityMapper.php:71
18
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `een_module` m
LEFT JOIN `een_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
0.118 ms 104 /classes/module/Module.php:346
424
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4446) AND (b.`id_shop` = 1) LIMIT 1
0.118 ms 1 /src/Adapter/EntityMapper.php:71
433
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 12863) AND (b.`id_shop` = 1) LIMIT 1
0.118 ms 1 /src/Adapter/EntityMapper.php:71
368
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 647781) AND (b.`id_shop` = 1) LIMIT 1
0.117 ms 1 /src/Adapter/EntityMapper.php:71
392
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 647813
ORDER BY `position`
0.117 ms 11 Yes /classes/Product.php:3545
430
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4502) AND (b.`id_shop` = 1) LIMIT 1
0.117 ms 1 /src/Adapter/EntityMapper.php:71
354
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 40032
ORDER BY f.position ASC
0.116 ms 1 Yes /classes/Product.php:6021
400
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 40037) AND (b.`id_shop` = 1) LIMIT 1
0.116 ms 1 /src/Adapter/EntityMapper.php:71
428
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4514
ORDER BY `position`
0.116 ms 6 Yes /classes/Product.php:3545
421
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4476) AND (b.`id_shop` = 1) LIMIT 1
0.115 ms 1 /src/Adapter/EntityMapper.php:71
138
SELECT SQL_NO_CACHE type, id_value, filter_show_limit, filter_type FROM een_layered_category
WHERE controller = 'prices-drop'
AND id_category = 0
AND id_shop = 1
GROUP BY `type`, id_value ORDER BY position ASC
0.115 ms 40 Yes Yes /modules/ps_facetedsearch/src/Filters/Provider.php:61
415
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 36837) AND (b.`id_shop` = 1) LIMIT 1
0.115 ms 1 /src/Adapter/EntityMapper.php:71
252
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 40039)
0.114 ms 1 /classes/Product.php:3860
436
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 40032) AND (b.`id_shop` = 1) LIMIT 1
0.114 ms 1 /src/Adapter/EntityMapper.php:71
172
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 3893)
0.113 ms 1 /classes/Product.php:3860
418
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 30970) AND (b.`id_shop` = 1) LIMIT 1
0.113 ms 1 /src/Adapter/EntityMapper.php:71
161
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 3893
AND image_shop.`cover` = 1 LIMIT 1
0.110 ms 5 /classes/Product.php:3570
389
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 3893
ORDER BY `position`
0.109 ms 5 Yes /classes/Product.php:3545
410
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 40039
ORDER BY `position`
0.109 ms 8 Yes /classes/Product.php:3545
440
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 40034
ORDER BY `position`
0.108 ms 6 Yes /classes/Product.php:3545
413
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6722
ORDER BY `position`
0.105 ms 6 Yes /classes/Product.php:3545
189
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 647813)
0.104 ms 1 /classes/Product.php:3860
183
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 647813
AND image_shop.`cover` = 1 LIMIT 1
0.103 ms 11 /classes/Product.php:3570
200
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 40017)
0.103 ms 1 /classes/Product.php:3860
407
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 40040
ORDER BY `position`
0.103 ms 8 Yes /classes/Product.php:3545
12
SELECT SQL_NO_CACHE COUNT(DISTINCT l.id_lang) FROM `een_lang` l
JOIN een_lang_shop lang_shop ON (lang_shop.id_lang = l.id_lang AND lang_shop.id_shop = 1)
WHERE l.`active` = 1 LIMIT 1
0.102 ms 1 /classes/Language.php:1216
212
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 36971)
0.102 ms 1 /classes/Product.php:3860
232
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 40036)
0.102 ms 1 /classes/Product.php:3860
449
SELECT SQL_NO_CACHE 1 FROM `een_cart_rule` WHERE ((date_to >= "2026-04-28 00:00:00" AND date_to <= "2026-04-28 23:59:59") OR (date_from >= "2026-04-28 00:00:00" AND date_from <= "2026-04-28 23:59:59") OR (date_from < "2026-04-28 00:00:00" AND date_to > "2026-04-28 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
0.102 ms 2 /classes/CartRule.php:357
7
SELECT SQL_NO_CACHE *
FROM `een_country` a
LEFT JOIN `een_country_lang` `b` ON a.`id_country` = b.`id_country` AND b.`id_lang` = 1
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 8) LIMIT 1
0.101 ms 1 /src/Adapter/EntityMapper.php:71
395
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 40017
ORDER BY `position`
0.101 ms 7 Yes /classes/Product.php:3545
43
SELECT SQL_NO_CACHE *
FROM een_meta m
LEFT JOIN een_meta_lang ml ON m.id_meta = ml.id_meta
WHERE (
m.page = "prices-drop"
OR m.page = "pricesdrop"
)
AND ml.id_lang = 1
AND ml.id_shop = 1 LIMIT 1
0.101 ms 2 /classes/Meta.php:193
222
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 40037)
0.100 ms 1 /classes/Product.php:3860
242
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 40040)
0.100 ms 1 /classes/Product.php:3860
398
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 36971
ORDER BY `position`
0.100 ms 7 Yes /classes/Product.php:3545
451
SELECT SQL_NO_CACHE COUNT(*) FROM `een_orders` o
LEFT JOIN `een_order_cart_rule` ocr ON (ocr.`id_order` = o.`id_order`)
WHERE o.`id_customer` = 0
AND ocr.`deleted` = 0 AND ocr.`id_cart_rule` = 0 LIMIT 1
0.099 ms 1 /classes/order/Order.php:881
238
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 40040
AND image_shop.`cover` = 1 LIMIT 1
0.099 ms 8 /classes/Product.php:3570
416
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 36837
ORDER BY `position`
0.099 ms 5 Yes /classes/Product.php:3545
195
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 40017
AND image_shop.`cover` = 1 LIMIT 1
0.098 ms 7 /classes/Product.php:3570
206
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 36971
AND image_shop.`cover` = 1 LIMIT 1
0.098 ms 7 /classes/Product.php:3570
248
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 40039
AND image_shop.`cover` = 1 LIMIT 1
0.098 ms 8 /classes/Product.php:3570
422
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4476
ORDER BY `position`
0.098 ms 6 Yes /classes/Product.php:3545
425
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4446
ORDER BY `position`
0.097 ms 6 Yes /classes/Product.php:3545
437
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 40032
ORDER BY `position`
0.097 ms 7 Yes /classes/Product.php:3545
401
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 40037
ORDER BY `position`
0.096 ms 6 Yes /classes/Product.php:3545
404
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 40036
ORDER BY `position`
0.096 ms 6 Yes /classes/Product.php:3545
228
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 40036
AND image_shop.`cover` = 1 LIMIT 1
0.096 ms 6 /classes/Product.php:3570
419
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 30970
ORDER BY `position`
0.095 ms 5 Yes /classes/Product.php:3545
434
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 12863
ORDER BY `position`
0.095 ms 6 Yes /classes/Product.php:3545
218
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 40037
AND image_shop.`cover` = 1 LIMIT 1
0.095 ms 6 /classes/Product.php:3570
263
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6722)
0.094 ms 1 /classes/Product.php:3860
371
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 647781)
0.094 ms 1 /classes/Product.php:3860
431
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4502
ORDER BY `position`
0.091 ms 6 Yes /classes/Product.php:3545
153
SELECT SQL_NO_CACHE *
FROM `een_category` a
LEFT JOIN `een_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `een_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 2) AND (b.`id_shop` = 1) LIMIT 1
0.090 ms 1 /src/Adapter/EntityMapper.php:71
285
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 30970)
0.089 ms 1 /classes/Product.php:3860
6
SELECT SQL_NO_CACHE l.*, ls.`id_shop`
FROM `een_lang` l
LEFT JOIN `een_lang_shop` ls ON (l.id_lang = ls.id_lang)
0.089 ms 1 /classes/Language.php:1080
28
SELECT SQL_NO_CACHE *
FROM `een_currency` a
LEFT JOIN `een_currency_lang` `b` ON a.`id_currency` = b.`id_currency` AND b.`id_lang` = 1
LEFT JOIN `een_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
0.088 ms 1 /src/Adapter/EntityMapper.php:71
365
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 647781
AND image_shop.`cover` = 1 LIMIT 1
0.087 ms 11 /classes/Product.php:3570
452
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "iqitlinksmanager" LIMIT 1
0.087 ms 1 /classes/module/Module.php:2659
9
SELECT SQL_NO_CACHE *
FROM `een_lang` a
LEFT JOIN `een_lang_shop` `c` ON a.`id_lang` = c.`id_lang` AND c.`id_shop` = 1
WHERE (a.`id_lang` = 1) LIMIT 1
0.086 ms 1 /src/Adapter/EntityMapper.php:71
296
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4476)
0.086 ms 1 /classes/Product.php:3860
306
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4446)
0.085 ms 1 /classes/Product.php:3860
323
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4502
AND image_shop.`cover` = 1 LIMIT 1
0.085 ms 6 /classes/Product.php:3570
338
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 12863)
0.085 ms 1 /classes/Product.php:3860
377
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 36979
AND image_shop.`cover` = 1 LIMIT 1
0.085 ms 7 /classes/Product.php:3570
179
SELECT SQL_NO_CACHE tr.*
FROM `een_tax_rule` tr
JOIN `een_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 21
AND tr.`id_tax_rules_group` = 0
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.085 ms 0 /classes/tax/TaxRulesTaxManager.php:109
275
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 36837)
0.085 ms 1 /classes/Product.php:3860
382
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 36979)
0.084 ms 1 /classes/Product.php:3860
514
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "blockwishlist" LIMIT 1
0.083 ms 1 /classes/module/Module.php:2659
5
SELECT SQL_NO_CACHE su.physical_uri, su.virtual_uri, su.domain, su.domain_ssl
FROM een_shop s
LEFT JOIN een_shop_url su ON (s.id_shop = su.id_shop)
WHERE s.id_shop = 1
AND s.active = 1 AND s.deleted = 0 AND su.main = 1 LIMIT 1
0.083 ms 1 /classes/shop/Shop.php:218
317
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4514)
0.083 ms 1 /classes/Product.php:3860
327
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4502)
0.083 ms 1 /classes/Product.php:3860
349
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 40032)
0.083 ms 1 /classes/Product.php:3860
359
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 40034)
0.083 ms 1 /classes/Product.php:3860
302
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4446
AND image_shop.`cover` = 1 LIMIT 1
0.082 ms 6 /classes/Product.php:3570
11
SELECT SQL_NO_CACHE domain, domain_ssl
FROM een_shop_url
WHERE main = 1
AND id_shop = 1 LIMIT 1
0.081 ms 1 /classes/shop/ShopUrl.php:182
291
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4476
AND image_shop.`cover` = 1 LIMIT 1
0.081 ms 6 /classes/Product.php:3570
270
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 36837
AND image_shop.`cover` = 1 LIMIT 1
0.080 ms 5 /classes/Product.php:3570
281
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 30970
AND image_shop.`cover` = 1 LIMIT 1
0.080 ms 5 /classes/Product.php:3570
333
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 12863
AND image_shop.`cover` = 1 LIMIT 1
0.080 ms 6 /classes/Product.php:3570
355
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 40034
AND image_shop.`cover` = 1 LIMIT 1
0.080 ms 6 /classes/Product.php:3570
344
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 40032
AND image_shop.`cover` = 1 LIMIT 1
0.079 ms 7 /classes/Product.php:3570
165
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 0 LIMIT 1
0.079 ms 1 /classes/SpecificPrice.php:426
312
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4514
AND image_shop.`cover` = 1 LIMIT 1
0.079 ms 6 /classes/Product.php:3570
454
SELECT SQL_NO_CACHE COUNT(DISTINCT c.id_currency) FROM `een_currency` c
LEFT JOIN een_currency_shop cs ON (cs.id_currency = c.id_currency AND cs.id_shop = 1)
WHERE c.`active` = 1 AND c.`deleted` = 0 LIMIT 1
0.079 ms 1 /classes/Currency.php:1136
446
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 36979
0.078 ms 1 /classes/Product.php:2902
180
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 3893) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.076 ms 1 /classes/stock/StockAvailable.php:453
0
SELECT SQL_NO_CACHE * FROM een_memcached_servers
0.075 ms 1 /classes/cache/CacheMemcached.php:263
25
SELECT SQL_NO_CACHE * FROM `een_currency` c ORDER BY `iso_code` ASC
0.075 ms 1 Yes /classes/Currency.php:709
166
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE `id_product` != 0 LIMIT 1
0.073 ms 523 /classes/SpecificPrice.php:297
164
SELECT SQL_NO_CACHE `name`
FROM `een_manufacturer`
WHERE `id_manufacturer` = 1646
AND `active` = 1 LIMIT 1
0.072 ms 1 /classes/Manufacturer.php:316
8
SELECT SQL_NO_CACHE *
FROM `een_shop_group` a
WHERE (a.`id_shop_group` = 1) LIMIT 1
0.071 ms 1 /src/Adapter/EntityMapper.php:71
17
SELECT SQL_NO_CACHE value FROM `een_configuration` WHERE `name` = "PS_MULTISHOP_FEATURE_ACTIVE" LIMIT 1
0.070 ms 1 /classes/shop/Shop.php:1183
4
SELECT SQL_NO_CACHE *
FROM `een_shop` a
WHERE (a.`id_shop` = 1) LIMIT 1
0.070 ms 1 /src/Adapter/EntityMapper.php:71
36
SELECT SQL_NO_CACHE *
FROM `een_group` a
LEFT JOIN `een_group_shop` `c` ON a.`id_group` = c.`id_group` AND c.`id_shop` = 1
WHERE (a.`id_group` = 1) LIMIT 1
0.069 ms 1 /src/Adapter/EntityMapper.php:71
265
SELECT SQL_NO_CACHE tr.*
FROM `een_tax_rule` tr
JOIN `een_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 21
AND tr.`id_tax_rules_group` = 8
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.068 ms 0 /classes/tax/TaxRulesTaxManager.php:109
31
SELECT SQL_NO_CACHE *
FROM `een_country` a
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 21) LIMIT 1
0.067 ms 1 /src/Adapter/EntityMapper.php:71
168
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE `from` BETWEEN '2026-04-28 00:00:00' AND '2026-04-28 23:59:59' LIMIT 1
0.067 ms 1 /classes/SpecificPrice.php:377
463
SELECT SQL_NO_CACHE SUM(`quantity`)
FROM `een_cart_product`
WHERE `id_cart` = 0 LIMIT 1
0.067 ms 1 /classes/Cart.php:1303
245
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 40040) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.066 ms 1 /classes/stock/StockAvailable.php:453
15
SELECT SQL_NO_CACHE `name`, `alias` FROM `een_hook_alias`
0.066 ms 87 /classes/Hook.php:287
46
SELECT SQL_NO_CACHE * FROM `een_image_type` WHERE 1 AND `products` = 1  ORDER BY `width` DESC, `height` DESC, `name`ASC
0.065 ms 8 Yes /classes/ImageType.php:109
162
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 1010 LIMIT 1
0.065 ms 1 /classes/Category.php:1378
192
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 647813) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.065 ms 1 /classes/stock/StockAvailable.php:453
203
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 40017) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.065 ms 1 /classes/stock/StockAvailable.php:453
173
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 3893 AND id_shop=1 LIMIT 1
0.064 ms 1 /classes/Product.php:6876
362
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 40034) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.064 ms 1 /classes/stock/StockAvailable.php:453
26
SELECT SQL_NO_CACHE `id_lang` FROM `een_lang`
WHERE `locale` = 'fr-fr'
OR `language_code` = 'fr-fr' LIMIT 1
0.063 ms 1 /classes/Language.php:883
235
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 40036) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.063 ms 1 /classes/stock/StockAvailable.php:453
215
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 36971) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.063 ms 1 /classes/stock/StockAvailable.php:453
255
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 40039) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.063 ms 1 /classes/stock/StockAvailable.php:453
19
SELECT SQL_NO_CACHE name, alias FROM `een_hook_alias`
0.062 ms 87 /classes/Hook.php:339
53
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "pm_advancedpack" LIMIT 1
0.062 ms 0 /classes/module/Module.php:2659
225
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 40037) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.062 ms 1 /classes/stock/StockAvailable.php:453
177
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 3893 AND `id_group` = 1 LIMIT 1
0.061 ms 0 /classes/GroupReduction.php:156
187
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 647813
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.061 ms 0 /classes/SpecificPrice.php:259
201
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 40017 AND id_shop=1 LIMIT 1
0.061 ms 1 /classes/Product.php:6876
223
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 40037 AND id_shop=1 LIMIT 1
0.061 ms 1 /classes/Product.php:6876
207
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 369 LIMIT 1
0.060 ms 1 /classes/Category.php:1378
259
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 367 LIMIT 1
0.060 ms 1 /classes/Category.php:1378
30
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'US' LIMIT 1
0.060 ms 1 /classes/Country.php:194
27
SELECT SQL_NO_CACHE c.id_currency
FROM `een_currency` c
WHERE (iso_code = 'EUR') LIMIT 1
0.059 ms 1 /classes/Currency.php:893
414
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 6722
0.059 ms 1 /classes/Product.php:2902
41
CREATE TABLE IF NOT EXISTS `een_revolut_payment_orders` (
`id` INT NOT NULL AUTO_INCREMENT,
`id_order` INT NULL ,
`id_cart` INT NULL ,
`id_revolut_order` VARCHAR(250) NOT NULL ,
`public_id` VARCHAR(250) NOT NULL ,
`save_card` TINYINT NOT NULL DEFAULT "0" ,
PRIMARY KEY (`id`),
UNIQUE (`id_revolut_order`),
UNIQUE (`id_order`)
) ENGINE = InnoDB;
0.059 ms 1 /modules/revolutpayment/revolutpayment.php:320
184
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 253 LIMIT 1
0.059 ms 1 /classes/Category.php:1378
453
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 78 AND `id_shop` = 1 LIMIT 1
0.059 ms 1 /classes/module/Module.php:2132
455
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "ps_languageselector" LIMIT 1
0.059 ms 1 /classes/module/Module.php:2659
492
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "supercheckout" LIMIT 1
0.058 ms 0 /classes/module/Module.php:2659
219
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 369 LIMIT 1
0.058 ms 1 /classes/Product.php:5659
229
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 369 LIMIT 1
0.058 ms 1 /classes/Product.php:5659
33
SELECT SQL_NO_CACHE *
FROM `een_currency` a
LEFT JOIN `een_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
0.057 ms 1 /src/Adapter/EntityMapper.php:71
105
SELECT SQL_NO_CACHE *
FROM `een_country` a
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 8) LIMIT 1
0.057 ms 1 /src/Adapter/EntityMapper.php:71
190
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 647813 AND id_shop=1 LIMIT 1
0.057 ms 1 /classes/Product.php:6876
209
SELECT SQL_NO_CACHE `name`
FROM `een_manufacturer`
WHERE `id_manufacturer` = 1635
AND `active` = 1 LIMIT 1
0.057 ms 1 /classes/Manufacturer.php:316
213
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 36971 AND id_shop=1 LIMIT 1
0.057 ms 1 /classes/Product.php:6876
233
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 40036 AND id_shop=1 LIMIT 1
0.057 ms 1 /classes/Product.php:6876
239
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 369 LIMIT 1
0.057 ms 1 /classes/Product.php:5659
249
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 369 LIMIT 1
0.057 ms 1 /classes/Product.php:5659
10
SELECT SQL_NO_CACHE id_shop
FROM `een_lang_shop`
WHERE `id_lang` = 1
AND id_shop = 1 LIMIT 1
0.056 ms 1 /classes/ObjectModel.php:1729
59
CREATE TABLE IF NOT EXISTS `een_gmcp_reporting` (`id_reporting` int(11) NOT NULL AUTO_INCREMENT,`iso_feed` LONGTEXT NOT NULL,    `reporting_content` LONGTEXT NOT NULL,`id_shop` int(11) NOT NULL,`date_add` datetime NOT NULL,`date_upd` datetime NOT NULL,PRIMARY KEY (`id_reporting`)) ENGINE=' . _MYSQL_ENGINE_ . ' DEFAULT CHARSET=utf8;
0.056 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
196
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 1022 LIMIT 1
0.056 ms 1 /classes/Category.php:1378
429
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 4514
0.056 ms 1 /classes/Product.php:2902
443
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 647781
0.056 ms 1 /classes/Product.php:2902
243
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 40040 AND id_shop=1 LIMIT 1
0.056 ms 1 /classes/Product.php:6876
163
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1010 LIMIT 1
0.055 ms 1 /classes/Product.php:5659
169
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE `to` BETWEEN '2026-04-28 00:00:00' AND '2026-04-28 23:59:59' LIMIT 1
0.055 ms 1 /classes/SpecificPrice.php:381
253
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 40039 AND id_shop=1 LIMIT 1
0.055 ms 1 /classes/Product.php:6876
408
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 40040
0.055 ms 1 /classes/Product.php:2902
426
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 4446
0.055 ms 1 /classes/Product.php:2902
464
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "iqitmegamenu" LIMIT 1
0.055 ms 1 /classes/module/Module.php:2659
516
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "ps_emailsubscription" LIMIT 1
0.055 ms 1 /classes/module/Module.php:2659
49
SELECT SQL_NO_CACHE *
FROM `een_country` a
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 17) LIMIT 1
0.054 ms 1 /src/Adapter/EntityMapper.php:71
466
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "iqitproductsnav" LIMIT 1
0.054 ms 1 /classes/module/Module.php:2659
468
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "ps_facetedsearch" LIMIT 1
0.054 ms 1 /classes/module/Module.php:2659
411
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 40039
0.054 ms 1 /classes/Product.php:2902
441
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 40034
0.054 ms 1 /classes/Product.php:2902
198
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 40017
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.053 ms 0 /classes/SpecificPrice.php:259
224
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 40037 AND `id_group` = 1 LIMIT 1
0.053 ms 0 /classes/GroupReduction.php:156
230
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 40036
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.053 ms 0 /classes/SpecificPrice.php:259
240
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 40040
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.053 ms 0 /classes/SpecificPrice.php:259
250
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 40039
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.053 ms 0 /classes/SpecificPrice.php:259
420
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 30970
0.053 ms 1 /classes/Product.php:2902
435
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 12863
0.052 ms 1 /classes/Product.php:2902
32
SELECT SQL_NO_CACHE *
FROM `een_country_lang`
WHERE `id_country` = 21
0.052 ms 1 /src/Adapter/EntityMapper.php:79
29
SELECT SQL_NO_CACHE `id_lang` FROM `een_lang`
WHERE `locale` = 'fr-fr'
OR `language_code` = 'fr-fr' LIMIT 1
0.051 ms 1 /classes/Language.php:883
37
SELECT SQL_NO_CACHE *
FROM `een_group_lang`
WHERE `id_group` = 1
0.051 ms 1 /src/Adapter/EntityMapper.php:79
100
SELECT SQL_NO_CACHE id_feed
FROM `een_gmcp_feeds` ff
WHERE (ff.id_shop=1) LIMIT 1
0.051 ms 370 /modules/gmerchantcenterpro/models/Feeds.php:53
185
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 253 LIMIT 1
0.051 ms 1 /classes/Product.php:5659
220
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 40037
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.051 ms 0 /classes/SpecificPrice.php:259
267
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 6722) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.051 ms 1 /classes/stock/StockAvailable.php:453
107
SELECT SQL_NO_CACHE c.id_currency
FROM `een_currency` c
WHERE (deleted = 0) AND (iso_code = 'EUR') LIMIT 1
0.051 ms 1 /classes/Currency.php:893
378
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 435 LIMIT 1
0.051 ms 1 /classes/Category.php:1378
518
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "iqitsociallogin" LIMIT 1
0.051 ms 1 /classes/module/Module.php:2659
208
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 369 LIMIT 1
0.050 ms 1 /classes/Product.php:5659
391
SELECT SQL_NO_CACHE state FROM een_feature_flag WHERE name = 'multiple_image_format' LIMIT 1
0.050 ms 1 /classes/FeatureFlag.php:105
393
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 647813
0.050 ms 1 /classes/Product.php:2902
103
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'FR' LIMIT 1
0.050 ms 1 /classes/Country.php:194
44
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "ps_legalcompliance" LIMIT 1
0.049 ms 0 /classes/module/Module.php:2659
136
SELECT SQL_NO_CACHE id_order
FROM `een_orders` o
WHERE (o.id_cart=0) LIMIT 1
0.049 ms 1 /modules/gmerchantcenterpro/lib/dao/moduleDao.php:450
170
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 3893
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.049 ms 0 /classes/SpecificPrice.php:259
197
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1022 LIMIT 1
0.049 ms 1 /classes/Product.php:5659
234
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 40036 AND `id_group` = 1 LIMIT 1
0.049 ms 0 /classes/GroupReduction.php:156
417
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 36837
0.049 ms 1 /classes/Product.php:2902
39
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "facebookproductsfeed" LIMIT 1
0.049 ms 0 /classes/module/Module.php:2659
210
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 36971
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.049 ms 0 /classes/SpecificPrice.php:259
34
SELECT SQL_NO_CACHE *
FROM `een_currency_lang`
WHERE `id_currency` = 1
0.048 ms 1 /src/Adapter/EntityMapper.php:79
254
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 40039 AND `id_group` = 1 LIMIT 1
0.048 ms 0 /classes/GroupReduction.php:156
515
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 3 AND `id_shop` = 1 LIMIT 1
0.048 ms 0 /classes/module/Module.php:2132
23
SELECT SQL_NO_CACHE * FROM `een_hook_module_exceptions`
WHERE `id_shop` IN (1)
0.048 ms 1 /classes/module/Module.php:2041
178
SELECT SQL_NO_CACHE `reduction`
FROM `een_group`
WHERE `id_group` = 1 LIMIT 1
0.048 ms 1 /classes/Group.php:154
244
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 40040 AND `id_group` = 1 LIMIT 1
0.048 ms 0 /classes/GroupReduction.php:156
264
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 6722 AND id_shop=1 LIMIT 1
0.048 ms 1 /classes/Product.php:6876
390
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 3893
0.048 ms 1 /classes/Product.php:2902
470
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "iqitcountdown" LIMIT 1
0.048 ms 1 /classes/module/Module.php:2659
520
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "iqitcookielaw" LIMIT 1
0.048 ms 1 /classes/module/Module.php:2659
115
SELECT SQL_NO_CACHE c.id_currency
FROM `een_currency` c
WHERE (deleted = 0) AND (iso_code = 'XOF') LIMIT 1
0.047 ms 1 /classes/Currency.php:893
122
SELECT SQL_NO_CACHE *
FROM `een_country` a
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 19) LIMIT 1
0.047 ms 1 /src/Adapter/EntityMapper.php:71
191
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 647813 AND `id_group` = 1 LIMIT 1
0.047 ms 0 /classes/GroupReduction.php:156
202
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 40017 AND `id_group` = 1 LIMIT 1
0.047 ms 0 /classes/GroupReduction.php:156
214
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 36971 AND `id_group` = 1 LIMIT 1
0.047 ms 0 /classes/GroupReduction.php:156
276
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 36837 AND id_shop=1 LIMIT 1
0.047 ms 1 /classes/Product.php:6876
313
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 1043 LIMIT 1
0.047 ms 1 /classes/Category.php:1378
372
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 647781 AND id_shop=1 LIMIT 1
0.047 ms 1 /classes/Product.php:6876
396
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 40017
0.047 ms 1 /classes/Product.php:2902
399
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 36971
0.047 ms 1 /classes/Product.php:2902
405
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 40036
0.047 ms 1 /classes/Product.php:2902
522
SELECT SQL_NO_CACHE data
FROM `een_ganalytics_data`
WHERE id_cart = 0
AND id_shop = 1 LIMIT 1
0.047 ms 0 /modules/ps_googleanalytics/classes/Repository/GanalyticsDataRepository.php:43
21
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "ets_superspeed" LIMIT 1
0.046 ms 0 /classes/module/Module.php:2659
47
SELECT SQL_NO_CACHE format
FROM `een_address_format`
WHERE `id_country` = 17 LIMIT 1
0.046 ms 1 /classes/AddressFormat.php:656
137
SELECT SQL_NO_CACHE `name`
FROM `een_hook`
WHERE `id_hook` = 1013 LIMIT 1
0.046 ms 1 /classes/Hook.php:244
366
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 1029 LIMIT 1
0.046 ms 1 /classes/Category.php:1378
402
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 40037
0.046 ms 1 /classes/Product.php:2902
423
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 4476
0.046 ms 1 /classes/Product.php:2902
432
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 4502
0.046 ms 1 /classes/Product.php:2902
438
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 40032
0.046 ms 1 /classes/Product.php:2902
456
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 6 AND `id_shop` = 1 LIMIT 1
0.046 ms 1 /classes/module/Module.php:2132
461
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "iqitcompare" LIMIT 1
0.046 ms 1 /classes/module/Module.php:2659
467
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 81 AND `id_shop` = 1 LIMIT 1
0.046 ms 1 /classes/module/Module.php:2132
126
SELECT SQL_NO_CACHE *
FROM `een_country` a
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 4) LIMIT 1
0.045 ms 1 /src/Adapter/EntityMapper.php:71
134
SELECT SQL_NO_CACHE *
FROM `een_country` a
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 186) LIMIT 1
0.045 ms 1 /src/Adapter/EntityMapper.php:71
35
SELECT SQL_NO_CACHE id_shop
FROM `een_currency_shop`
WHERE `id_currency` = 1
AND id_shop = 1 LIMIT 1
0.045 ms 1 /classes/ObjectModel.php:1729
109
SELECT SQL_NO_CACHE c.id_currency
FROM `een_currency` c
WHERE (deleted = 0) AND (iso_code = 'TND') LIMIT 1
0.045 ms 1 /classes/Currency.php:893
334
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 742 LIMIT 1
0.045 ms 1 /classes/Category.php:1378
271
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 1020 LIMIT 1
0.044 ms 1 /classes/Category.php:1378
341
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 12863) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.044 ms 1 /classes/stock/StockAvailable.php:453
465
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 79 AND `id_shop` = 1 LIMIT 1
0.044 ms 1 /classes/module/Module.php:2132
50
SELECT SQL_NO_CACHE *
FROM `een_country_lang`
WHERE `id_country` = 17
0.044 ms 1 /src/Adapter/EntityMapper.php:79
117
SELECT SQL_NO_CACHE c.id_currency
FROM `een_currency` c
WHERE (deleted = 0) AND (iso_code = 'MGA') LIMIT 1
0.044 ms 1 /classes/Currency.php:893
278
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 36837) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.044 ms 1 /classes/stock/StockAvailable.php:453
292
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 1038 LIMIT 1
0.044 ms 1 /classes/Category.php:1378
339
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 12863 AND id_shop=1 LIMIT 1
0.044 ms 1 /classes/Product.php:6876
374
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 647781) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.044 ms 1 /classes/stock/StockAvailable.php:453
52
SELECT SQL_NO_CACHE * FROM een_revslider_sliders
0.043 ms 1 /modules/revsliderprestashop/includes/revslider_db.class.php:214
303
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1038 LIMIT 1
0.043 ms 1 /classes/Product.php:5659
104
SELECT SQL_NO_CACHE `name`
FROM `een_country_lang`
WHERE `id_lang` = 1
AND `id_country` = 8 LIMIT 1
0.043 ms 1 /classes/Country.php:252
106
SELECT SQL_NO_CACHE *
FROM `een_country_lang`
WHERE `id_country` = 8
0.043 ms 1 /src/Adapter/EntityMapper.php:79
111
SELECT SQL_NO_CACHE c.id_currency
FROM `een_currency` c
WHERE (deleted = 0) AND (iso_code = 'DZD') LIMIT 1
0.043 ms 1 /classes/Currency.php:893
113
SELECT SQL_NO_CACHE c.id_currency
FROM `een_currency` c
WHERE (deleted = 0) AND (iso_code = 'XAF') LIMIT 1
0.043 ms 1 /classes/Currency.php:893
119
SELECT SQL_NO_CACHE c.id_currency
FROM `een_currency` c
WHERE (deleted = 0) AND (iso_code = 'MAD') LIMIT 1
0.043 ms 1 /classes/Currency.php:893
130
SELECT SQL_NO_CACHE *
FROM `een_country` a
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 3) LIMIT 1
0.043 ms 1 /src/Adapter/EntityMapper.php:71
282
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1010 LIMIT 1
0.043 ms 1 /classes/Product.php:5659
286
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 30970 AND id_shop=1 LIMIT 1
0.043 ms 1 /classes/Product.php:6876
307
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 4446 AND id_shop=1 LIMIT 1
0.043 ms 1 /classes/Product.php:6876
324
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1043 LIMIT 1
0.043 ms 1 /classes/Product.php:5659
345
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 1012 LIMIT 1
0.043 ms 1 /classes/Category.php:1378
369
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 647781
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.043 ms 0 /classes/SpecificPrice.php:259
379
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 435 LIMIT 1
0.043 ms 1 /classes/Product.php:5659
51
SELECT SQL_NO_CACHE id_required_field, object_name, field_name
FROM een_required_field
0.042 ms 1 /classes/ObjectModel.php:1592
108
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'FR' LIMIT 1
0.042 ms 1 /classes/Country.php:194
131
SELECT SQL_NO_CACHE *
FROM `een_country_lang`
WHERE `id_country` = 3
0.042 ms 1 /src/Adapter/EntityMapper.php:79
288
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 30970) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.042 ms 1 /classes/stock/StockAvailable.php:453
299
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 4476) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.042 ms 1 /classes/stock/StockAvailable.php:453
309
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 4446) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.042 ms 1 /classes/stock/StockAvailable.php:453
318
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 4514 AND id_shop=1 LIMIT 1
0.042 ms 1 /classes/Product.php:6876
328
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 4502 AND id_shop=1 LIMIT 1
0.042 ms 1 /classes/Product.php:6876
356
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1012 LIMIT 1
0.042 ms 1 /classes/Product.php:5659
383
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 36979 AND id_shop=1 LIMIT 1
0.042 ms 1 /classes/Product.php:6876
385
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 36979) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.042 ms 1 /classes/stock/StockAvailable.php:453
457
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "ps_currencyselector" LIMIT 1
0.042 ms 1 /classes/module/Module.php:2659
56
SELECT SQL_NO_CACHE * FROM `een_image_type`
0.041 ms 8 /classes/ImageType.php:161
116
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'FR' LIMIT 1
0.041 ms 1 /classes/Country.php:194
123
SELECT SQL_NO_CACHE *
FROM `een_country_lang`
WHERE `id_country` = 19
0.041 ms 1 /src/Adapter/EntityMapper.php:79
124
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'CA' LIMIT 1
0.041 ms 1 /classes/Country.php:194
297
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 4476 AND id_shop=1 LIMIT 1
0.041 ms 1 /classes/Product.php:6876
320
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 4514) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.041 ms 1 /classes/stock/StockAvailable.php:453
350
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 40032 AND id_shop=1 LIMIT 1
0.041 ms 1 /classes/Product.php:6876
352
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 40032) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.041 ms 1 /classes/stock/StockAvailable.php:453
360
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 40034 AND id_shop=1 LIMIT 1
0.041 ms 1 /classes/Product.php:6876
469
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 24 AND `id_shop` = 1 LIMIT 1
0.041 ms 1 /classes/module/Module.php:2132
471
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 74 AND `id_shop` = 1 LIMIT 1
0.041 ms 1 /classes/module/Module.php:2132
493
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.041 ms 0 /classes/module/Module.php:2132
517
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 19 AND `id_shop` = 1 LIMIT 1
0.041 ms 0 /classes/module/Module.php:2132
110
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'FR' LIMIT 1
0.040 ms 1 /classes/Country.php:194
128
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'BE' LIMIT 1
0.040 ms 1 /classes/Country.php:194
132
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'SA' LIMIT 1
0.040 ms 1 /classes/Country.php:194
135
SELECT SQL_NO_CACHE *
FROM `een_country_lang`
WHERE `id_country` = 186
0.040 ms 1 /src/Adapter/EntityMapper.php:79
330
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 4502) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.040 ms 1 /classes/stock/StockAvailable.php:453
38
SELECT SQL_NO_CACHE id_shop
FROM `een_group_shop`
WHERE `id_group` = 1
AND id_shop = 1 LIMIT 1
0.040 ms 1 /classes/ObjectModel.php:1729
127
SELECT SQL_NO_CACHE *
FROM `een_country_lang`
WHERE `id_country` = 4
0.040 ms 1 /src/Adapter/EntityMapper.php:79
519
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 93 AND `id_shop` = 1 LIMIT 1
0.040 ms 1 /classes/module/Module.php:2132
133
SELECT SQL_NO_CACHE `name`
FROM `een_country_lang`
WHERE `id_lang` = 1
AND `id_country` = 186 LIMIT 1
0.039 ms 1 /classes/Country.php:252
112
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'FR' LIMIT 1
0.039 ms 1 /classes/Country.php:194
118
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'FR' LIMIT 1
0.039 ms 1 /classes/Country.php:194
314
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1043 LIMIT 1
0.038 ms 1 /classes/Product.php:5659
462
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 70 AND `id_shop` = 1 LIMIT 1
0.038 ms 1 /classes/module/Module.php:2132
114
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'FR' LIMIT 1
0.038 ms 1 /classes/Country.php:194
120
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'CH' LIMIT 1
0.038 ms 1 /classes/Country.php:194
260
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 367 LIMIT 1
0.038 ms 1 /classes/Product.php:5659
508
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "attributewizardpro" LIMIT 1
0.038 ms 0 /classes/module/Module.php:2659
521
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 72 AND `id_shop` = 1 LIMIT 1
0.038 ms 1 /classes/module/Module.php:2132
266
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 6722 AND `id_group` = 1 LIMIT 1
0.037 ms 0 /classes/GroupReduction.php:156
40
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.037 ms 0 /classes/module/Module.php:2132
261
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 6722
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.037 ms 0 /classes/SpecificPrice.php:259
336
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 12863
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.037 ms 0 /classes/SpecificPrice.php:259
458
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 7 AND `id_shop` = 1 LIMIT 1
0.036 ms 1 /classes/module/Module.php:2132
459
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "iqitwishlist" LIMIT 1
0.036 ms 1 /classes/module/Module.php:2659
121
SELECT SQL_NO_CACHE `name`
FROM `een_country_lang`
WHERE `id_lang` = 1
AND `id_country` = 19 LIMIT 1
0.035 ms 1 /classes/Country.php:252
335
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 742 LIMIT 1
0.035 ms 1 /classes/Product.php:5659
367
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1029 LIMIT 1
0.035 ms 1 /classes/Product.php:5659
494
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "onepagecheckout" LIMIT 1
0.035 ms 0 /classes/module/Module.php:2659
380
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 36979
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.035 ms 0 /classes/SpecificPrice.php:259
45
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.034 ms 0 /classes/module/Module.php:2132
125
SELECT SQL_NO_CACHE `name`
FROM `een_country_lang`
WHERE `id_lang` = 1
AND `id_country` = 4 LIMIT 1
0.034 ms 1 /classes/Country.php:252
346
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1012 LIMIT 1
0.034 ms 1 /classes/Product.php:5659
460
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 87 AND `id_shop` = 1 LIMIT 1
0.034 ms 1 /classes/module/Module.php:2132
504
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "pwpaysoncheckout" LIMIT 1
0.034 ms 0 /classes/module/Module.php:2659
22
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.034 ms 0 /classes/module/Module.php:2132
129
SELECT SQL_NO_CACHE `name`
FROM `een_country_lang`
WHERE `id_lang` = 1
AND `id_country` = 3 LIMIT 1
0.034 ms 1 /classes/Country.php:252
272
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1020 LIMIT 1
0.034 ms 1 /classes/Product.php:5659
283
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 30970
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.034 ms 0 /classes/SpecificPrice.php:259
315
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 4514
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.034 ms 0 /classes/SpecificPrice.php:259
48
SELECT SQL_NO_CACHE `need_identification_number`
FROM `een_country`
WHERE `id_country` = 17 LIMIT 1
0.033 ms 1 /classes/Country.php:405
54
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "gsnippetsreviews" LIMIT 1
0.033 ms 0 /classes/module/Module.php:2659
277
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 36837 AND `id_group` = 1 LIMIT 1
0.033 ms 0 /classes/GroupReduction.php:156
294
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 4476
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.033 ms 0 /classes/SpecificPrice.php:259
325
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 4502
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.033 ms 0 /classes/SpecificPrice.php:259
357
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 40034
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.033 ms 0 /classes/SpecificPrice.php:259
495
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.033 ms 0 /classes/module/Module.php:2132
273
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 36837
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.033 ms 0 /classes/SpecificPrice.php:259
293
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1038 LIMIT 1
0.033 ms 1 /classes/Product.php:5659
304
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 4446
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.033 ms 0 /classes/SpecificPrice.php:259
373
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 647781 AND `id_group` = 1 LIMIT 1
0.033 ms 0 /classes/GroupReduction.php:156
66
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_last_product_not_ordered` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `last_product_ordered` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
0.032 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
287
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 30970 AND `id_group` = 1 LIMIT 1
0.032 ms 0 /classes/GroupReduction.php:156
298
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 4476 AND `id_group` = 1 LIMIT 1
0.032 ms 0 /classes/GroupReduction.php:156
308
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 4446 AND `id_group` = 1 LIMIT 1
0.032 ms 0 /classes/GroupReduction.php:156
340
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 12863 AND `id_group` = 1 LIMIT 1
0.032 ms 0 /classes/GroupReduction.php:156
347
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 40032
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.032 ms 0 /classes/SpecificPrice.php:259
361
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 40034 AND `id_group` = 1 LIMIT 1
0.032 ms 0 /classes/GroupReduction.php:156
60
CREATE TABLE IF NOT EXISTS `een_gmcp_feeds` (`id_feed` int(11) NOT NULL AUTO_INCREMENT,`iso_lang` LONGTEXT NOT NULL,`iso_country` LONGTEXT NOT NULL,`iso_currency` LONGTEXT NOT NULL, `taxonomy` LONGTEXT NOT NULL, `id_shop` int(11) NOT NULL,`date_add` datetime NOT NULL,`date_upd` datetime NOT NULL,PRIMARY KEY (`id_feed`)) ENGINE=' . _MYSQL_ENGINE_ . ' DEFAULT CHARSET=utf8;
0.031 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
319
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 4514 AND `id_group` = 1 LIMIT 1
0.031 ms 0 /classes/GroupReduction.php:156
329
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 4502 AND `id_group` = 1 LIMIT 1
0.031 ms 0 /classes/GroupReduction.php:156
384
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 36979 AND `id_group` = 1 LIMIT 1
0.031 ms 0 /classes/GroupReduction.php:156
496
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "onepagecheckoutps" LIMIT 1
0.031 ms 0 /classes/module/Module.php:2659
497
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.031 ms 0 /classes/module/Module.php:2132
509
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.031 ms 0 /classes/module/Module.php:2132
351
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 40032 AND `id_group` = 1 LIMIT 1
0.030 ms 0 /classes/GroupReduction.php:156
498
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "steasycheckout" LIMIT 1
0.030 ms 0 /classes/module/Module.php:2659
499
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.030 ms 0 /classes/module/Module.php:2132
501
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.030 ms 0 /classes/module/Module.php:2132
503
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.030 ms 0 /classes/module/Module.php:2132
505
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.030 ms 0 /classes/module/Module.php:2132
513
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.030 ms 0 /classes/module/Module.php:2132
42
CREATE TABLE IF NOT EXISTS `een_revolut_cards` (
`id` INT NOT NULL AUTO_INCREMENT,
`customer_id` INT NOT NULL ,
`card_number` VARCHAR(25) NOT NULL,
`expire_month` INT NOT NULL ,
`expire_year` INT NOT NULL ,
PRIMARY KEY (`id`)
) ENGINE=InnoDB;
0.029 ms 1 /modules/revolutpayment/revolutpayment.php:331
502
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "idxropc" LIMIT 1
0.029 ms 0 /classes/module/Module.php:2659
507
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.029 ms 0 /classes/module/Module.php:2132
510
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "cdesigner" LIMIT 1
0.029 ms 0 /classes/module/Module.php:2659
511
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.029 ms 0 /classes/module/Module.php:2132
512
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "configurator" LIMIT 1
0.029 ms 0 /classes/module/Module.php:2659
506
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "easycheckout" LIMIT 1
0.029 ms 0 /classes/module/Module.php:2659
88
CREATE TABLE IF NOT EXISTS `een_gmcp_reporting` (`id_reporting` int(11) NOT NULL AUTO_INCREMENT,`iso_feed` LONGTEXT NOT NULL,    `reporting_content` LONGTEXT NOT NULL,`id_shop` int(11) NOT NULL,`date_add` datetime NOT NULL,`date_upd` datetime NOT NULL,PRIMARY KEY (`id_reporting`)) ENGINE=' . _MYSQL_ENGINE_ . ' DEFAULT CHARSET=utf8;
0.028 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
500
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "thecheckout" LIMIT 1
0.028 ms 0 /classes/module/Module.php:2659
55
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "gremarketing" LIMIT 1
0.027 ms 0 /classes/module/Module.php:2659
69
CREATE TABLE IF NOT EXISTS `een_gmcp_tags` (`id_tag` int(11) NOT NULL AUTO_INCREMENT, `id_shop` int(11) NOT NULL DEFAULT "1", `name` char(255) NOT NULL, `type` char(255) NOT NULL, `active` TINYINT NOT NULL, `position` INT NOT NULL, `end_date` DATE, PRIMARY KEY (`id_tag`)) ENGINE=MyISAM DEFAULT CHARSET=utf8 AUTO_INCREMENT=1 ;
0.027 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
61
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_price_range` (`id_tag` int(11) NOT NULL, `price_min` CHAR(255) NOT NULL, `price_max` CHAR(255), `id_product` CHAR(255), UNIQUE KEY `tag_price_range` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
0.026 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
70
CREATE TABLE IF NOT EXISTS `een_gmcp_taxonomy` (`id_taxonomy` int(11) NOT NULL AUTO_INCREMENT, `value` text NOT NULL, `lang` varchar(5) NOT NULL, PRIMARY KEY (`id_taxonomy`), KEY `lang` (`lang`), FULLTEXT KEY `ft_index` (`value`)) ENGINE=MyISAM DEFAULT CHARSET=utf8 AUTO_INCREMENT=1;
0.026 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
62
CREATE TABLE IF NOT EXISTS `een_gmcp_tmp_rules`(`id` int(11) NOT NULL AUTO_INCREMENT, `id_shop` int(11) NOT NULL DEFAULT "1",`type` char(255) NOT NULL, `exclusion_values` longtext NOT NULL, PRIMARY KEY (`id`)) ENGINE=InnoDB DEFAULT CHARSET=utf8 AUTO_INCREMENT=1;
0.025 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
68
CREATE TABLE IF NOT EXISTS `een_gmcp_discount_association` (`id_association` int(11) NOT NULL AUTO_INCREMENT, `id_discount` int(11) NOT NULL, `id_product` int(11) NOT NULL, `channel` CHAR(120) NOT NULL DEFAULT "SHOPPING_ADS", PRIMARY KEY (`id_association`) ) ENGINE=MyISAM DEFAULT CHARSET=utf8;
0.025 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
89
CREATE TABLE IF NOT EXISTS `een_gmcp_feeds` (`id_feed` int(11) NOT NULL AUTO_INCREMENT,`iso_lang` LONGTEXT NOT NULL,`iso_country` LONGTEXT NOT NULL,`iso_currency` LONGTEXT NOT NULL, `taxonomy` LONGTEXT NOT NULL, `id_shop` int(11) NOT NULL,`date_add` datetime NOT NULL,`date_upd` datetime NOT NULL,PRIMARY KEY (`id_feed`)) ENGINE=' . _MYSQL_ENGINE_ . ' DEFAULT CHARSET=utf8;
0.024 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
63
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_last_product_ordered` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `last_product_ordered` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
0.023 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
67
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_last_product_not_ordered` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `last_product_ordered` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
0.023 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
72
CREATE TABLE IF NOT EXISTS `een_gmcp_taxonomy_categories` (`id_category` int(11) NOT NULL, `id_shop` int(3) NOT NULL DEFAULT "1", `txt_taxonomy` text NOT NULL, `lang` char(5) NOT NULL, KEY `id_category` (`id_category`,`lang`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
0.023 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
84
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_best_sale` (`id_tag` int(11) NOT NULL, `amount` CHAR(255) NOT NULL, `unit` CHAR(255) ,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255),  `id_shop` int(11) NOT NULL,  UNIQUE KEY `tag_best_sales` (`id_tag`, `id_product`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
0.023 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
90
CREATE TABLE IF NOT EXISTS `een_gmcp_advanced_exclusion` (`id` int(11) NOT NULL AUTO_INCREMENT, `status` int(11) NOT NULL DEFAULT "1", `id_shop` int(11) NOT NULL DEFAULT "1", `name` char(255) NOT NULL, `type` char(255) NOT NULL, `exclusion_value` longtext NOT NULL, PRIMARY KEY (`id`)) ENGINE=InnoDB DEFAULT CHARSET=utf8 AUTO_INCREMENT=1;
0.023 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
71
CREATE TABLE IF NOT EXISTS `een_gmcp_categories` (`id_category` int(11) NOT NULL, `id_shop` int(11) NOT NULL DEFAULT "1",  UNIQUE KEY `id_category` (`id_category`, `id_shop`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
0.023 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
74
CREATE TABLE IF NOT EXISTS `een_gmcp_tags` (`id_tag` int(11) NOT NULL AUTO_INCREMENT, `id_shop` int(11) NOT NULL DEFAULT "1", `name` char(255) NOT NULL, `type` char(255) NOT NULL, `active` TINYINT NOT NULL, `position` INT NOT NULL, `end_date` DATE, PRIMARY KEY (`id_tag`)) ENGINE=MyISAM DEFAULT CHARSET=utf8 AUTO_INCREMENT=1 ;
0.023 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
77
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_products` (`id_tag` int(11) NOT NULL, `id_product` int(11) NOT NULL, product_name VARCHAR (255) NOT NULL, UNIQUE KEY `tag_product` (`id_tag`,`id_product`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
0.023 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
80
CREATE TABLE IF NOT EXISTS `een_gmcp_discount_association` (`id_association` int(11) NOT NULL AUTO_INCREMENT, `id_discount` int(11) NOT NULL, `id_product` int(11) NOT NULL, `channel` CHAR(120) NOT NULL DEFAULT "SHOPPING_ADS", PRIMARY KEY (`id_association`) ) ENGINE=MyISAM DEFAULT CHARSET=utf8;
0.023 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
81
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_features` (`id_tag` int(11) NOT NULL, `id_feature` int(11) NOT NULL, `id_shop` int(11) NOT NULL,  UNIQUE KEY `tag_feature` (`id_tag`, `id_feature`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
0.022 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
83
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_new_product` (`id_tag` int(11) NOT NULL,  `from_date` DATETIME, `id_product` int,  `id_shop` int(11) NOT NULL,  UNIQUE KEY `tag_new_product` (`id_tag`, `id_product`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
0.022 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
92
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_price_range` (`id_tag` int(11) NOT NULL, `price_min` CHAR(255) NOT NULL, `price_max` CHAR(255), `id_product` CHAR(255), UNIQUE KEY `tag_price_range` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
0.022 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
57
BEGIN
0.022 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:81
64
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_promotion` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `promotion` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
0.022 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
73
CREATE TABLE IF NOT EXISTS `een_gmcp_brands` (`id_brands` int(11) NOT NULL, `id_shop` int(11) NOT NULL DEFAULT "1",  UNIQUE KEY `id_brands` (`id_brands`, `id_shop`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
0.022 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
75
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_brands` (`id_tag` int(11) NOT NULL, `id_brand` int(11) NOT NULL, UNIQUE KEY `tag_brand` (`id_tag`,`id_brand`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
0.022 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
78
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_suppliers` (`id_tag` int(11) NOT NULL, `id_supplier` int(11) NOT NULL, UNIQUE KEY `tag_supplier` (`id_tag`,`id_supplier`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
0.022 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
79
CREATE TABLE IF NOT EXISTS `een_gmcp_features_by_cat` (`id_cat` int(11) NOT NULL DEFAULT '0', `id_shop` int(3) NOT NULL DEFAULT "1", `values` text NOT NULL, PRIMARY KEY (`id_cat`, `id_shop`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
0.022 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
82
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_categories` (`id_tag` int(11) NOT NULL, `id_category` int(11) NOT NULL, `id_shop` int(11) NOT NULL,  UNIQUE KEY `tag_feature` (`id_tag`, `id_category`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
0.022 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
85
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_last_product_ordered` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `last_product_ordered` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
0.022 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
93
CREATE TABLE IF NOT EXISTS `een_gmcp_tmp_rules`(`id` int(11) NOT NULL AUTO_INCREMENT, `id_shop` int(11) NOT NULL DEFAULT "1",`type` char(255) NOT NULL, `exclusion_values` longtext NOT NULL, PRIMARY KEY (`id`)) ENGINE=InnoDB DEFAULT CHARSET=utf8 AUTO_INCREMENT=1;
0.022 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
76
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_cats` (`id_tag` int(11) NOT NULL, `id_category` int(11) NOT NULL, UNIQUE KEY `tag_cat` (`id_tag`,`id_category`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
0.021 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
86
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_last_product_not_ordered` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `last_product_ordered` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
0.021 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
87
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_promotion` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `promotion` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
0.021 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
91
CREATE TABLE IF NOT EXISTS `een_gmcp_product_excluded` (`id_rule` int(11) NOT NULL DEFAULT "0",`id_product` int(11) NOT NULL DEFAULT "0", `id_product_attribute` int(11)) ENGINE=InnoDB DEFAULT CHARSET=utf8 AUTO_INCREMENT=1;
0.021 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
99
COMMIT
0.020 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:155
94
COMMIT
0.016 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:107
95
BEGIN
0.015 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:121

Doubles

27 queries
SELECT `id_module` FROM `een_module_shop` WHERE `id_module` = XX AND `id_shop` = XX LIMIT XX
20 queries
SELECT image_shop.`id_image`
                    FROM `een_image` i
                     INNER JOIN een_image_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
                    WHERE i.`id_product` = XX
                    AND image_shop.`cover` = XX LIMIT XX
20 queries
SELECT name FROM een_category_lang WHERE id_shop = XX AND id_lang = XX AND id_category = XX LIMIT XX
20 queries
				SELECT `priority`, `id_specific_price_priority`
				FROM `een_specific_price_priority`
				WHERE `id_product` = XX
				ORDER BY `id_specific_price_priority` DESC LIMIT XX
20 queries
			SELECT *, ( IF (`id_shop` = XX, XX, XX) +  IF (`id_country` = XX, XX, XX) +  IF (`id_currency` = XX, XX, XX) +  IF (`id_group` = XX, XX, XX) +  IF (`id_customer` = XX, XX, XX)) AS `score`
				FROM `een_specific_price`
				WHERE
                `id_shop` IN (XX, XX) AND
                `id_currency` IN (XX, XX) AND
                `id_country` IN (XX, XX) AND
                `id_group` IN (XX, XX) AND `id_product` IN (XX, XX) AND `id_customer` = XX AND `id_product_attribute` = XX AND `id_cart` = XX  AND (`from` = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' >= `from`) AND (`to` = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' <= `to`)
				AND IF(`from_quantity` > XX, `from_quantity`, XX) <= XX ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT XX
20 queries
SELECT product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,XX) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = XX)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = XX)
WHERE (p.`id_product` = XX)
20 queries
                            SELECT `id_tax_rules_group`
                            FROM `een_product_shop`
                            WHERE `id_product` = XX AND id_shop=XX LIMIT XX
20 queries
			SELECT `reduction`
			FROM `een_product_group_reduction_cache`
			WHERE `id_product` = XX AND `id_group` = XX LIMIT XX
20 queries
SELECT SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
20 queries
SELECT
            COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), XX) as deep_quantity,
            COALESCE(SUM(first_level_quantity), XX) as quantity
          FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, XX as pack_quantity
          FROM `een_cart_product` cp
            WHERE cp.`id_product_attribute` = XX
            
            AND cp.`id_cart` = XX AND cp.`id_product` = XX UNION SELECT XX as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
          FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
            WHERE cp.`id_product_attribute` = XX
            
            AND cp.`id_cart` = XX AND p.`id_product_item` = XX AND (pr.`pack_stock_type` IN (XX,XX) OR (
            pr.`pack_stock_type` = XX
            AND XX = XX
        ))) as q LIMIT XX
20 queries
                SELECT name, value, pf.id_feature, f.position, fvl.id_feature_value
                FROM een_feature_product pf
                LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = XX)
                LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = XX)
                LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = XX)
                 INNER JOIN een_feature_shop feature_shop
        ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = XX)
                WHERE pf.id_product = XX
                ORDER BY f.position ASC
20 queries
SELECT *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = XX
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = XX
WHERE (a.`id_product` = XX) AND (b.`id_shop` = XX) LIMIT XX
20 queries
            SELECT image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
            FROM `een_image` i
             INNER JOIN een_image_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
            LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = XX)
            WHERE i.`id_product` = XX
            ORDER BY `position`
20 queries
SELECT `id_product_attribute`
            FROM `een_product_attribute`
            WHERE `id_product` = XX
20 queries
SELECT pa.`id_product`, a.`color`, pac.`id_product_attribute`, XX qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
            FROM `een_product_attribute` pa
             INNER JOIN een_product_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX)
            JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
            JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
            JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = XX)
            JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
            WHERE pa.`id_product` IN (XX) AND ag.`is_color_group` = XX
            GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
            
            ORDER BY a.`position` ASC;
12 queries
			SELECT cl.`link_rewrite`
			FROM `een_category_lang` cl
			WHERE `id_lang` = XX
			 AND cl.id_shop = XX 
			AND cl.`id_category` = XX LIMIT XX
7 queries
SELECT *
FROM `een_country` a
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = XX
WHERE (a.`id_country` = XX) LIMIT XX
7 queries
SELECT *
							FROM `een_country_lang`
							WHERE `id_country` = XX
7 queries
			SELECT `id_country`
			FROM `een_country`
			WHERE `iso_code` = 'FR' LIMIT XX
5 queries
							SELECT `name`
							FROM `een_country_lang`
							WHERE `id_lang` = XX
							AND `id_country` = XX LIMIT XX
5 queries
SELECT fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, pl.name FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, XX) = sa.id_product_attribute AND sa.id_shop = XX  AND sa.id_shop_group = XX ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_product_lang pl ON (p.id_product = pl.id_product AND pl.id_shop = XX AND pl.id_lang = XX) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = XX AND ps.active = TRUE) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=XX) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_specific_price sp ON (
                    sp.id_product = p.id_product AND 
                    sp.id_shop IN (XX, XX) AND 
                    sp.id_currency IN (XX, XX) AND 
                    sp.id_country IN (XX, XX) AND 
                    sp.id_group IN (XX, XX) AND 
                    sp.from_quantity = XX AND
                    sp.reduction > XX AND
                    sp.id_customer = XX AND
                    sp.id_cart = XX AND 
                    (sp.from = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' >= sp.from) AND 
                    (sp.to = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' <= sp.to) 
                ) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (XX, XX, XX, XX, XX, XX, XX))) AND ps.id_shop='XX' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='XX' AND sp.reduction>XX GROUP BY p.id_product) p INNER JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_XX ON (p.id_product = fp_XX.id_product) WHERE ((fp.id_feature=XX)) AND ((fp_XX.id_feature_value IN (XX, XX, XX, XX, XX, XX, XX))) GROUP BY fp.id_feature_value
4 queries
SELECT v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `een_feature_value` v LEFT JOIN `een_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = XX) LEFT JOIN `een_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = XX) WHERE v.`id_feature` = XX ORDER BY vl.`value` ASC
3 queries
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_last_product_not_ordered` (`id_tag` int(XX) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(XX), UNIQUE KEY `last_product_ordered` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utfXX;
3 queries
				SELECT tr.*
				FROM `een_tax_rule` tr
				JOIN `een_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
				WHERE trg.`active` = XX
				AND tr.`id_country` = XX
				AND tr.`id_tax_rules_group` = XX
				AND tr.`id_state` IN (XX, XX)
				AND ('XX' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
					OR (tr.`zipcode_to` = XX AND tr.`zipcode_from` IN(XX, 'XX')))
				ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
2 queries
                SELECT m.`id_module`, m.`name`, ms.`id_module`as `mshop`
                FROM `een_module` m
                LEFT JOIN `een_module_shop` ms
                ON m.`id_module` = ms.`id_module`
                AND ms.`id_shop` = XX
2 queries
SELECT `id_lang` FROM `een_lang`
                    WHERE `locale` = 'fr-fr'
                    OR `language_code` = 'fr-fr' LIMIT XX
2 queries
BEGIN
2 queries
SHOW TABLES LIKE "een_gmcp_XX"
2 queries
CREATE TABLE IF NOT EXISTS `een_gmcp_reporting` (`id_reporting` int(XX) NOT NULL AUTO_INCREMENT,`iso_feed` LONGTEXT NOT NULL,    `reporting_content` LONGTEXT NOT NULL,`id_shop` int(XX) NOT NULL,`date_add` datetime NOT NULL,`date_upd` datetime NOT NULL,PRIMARY KEY (`id_reporting`)) ENGINE=' . _MYSQL_ENGINE_ . ' DEFAULT CHARSET=utfXX;
2 queries
CREATE TABLE IF NOT EXISTS `een_gmcp_feeds` (`id_feed` int(XX) NOT NULL AUTO_INCREMENT,`iso_lang` LONGTEXT NOT NULL,`iso_country` LONGTEXT NOT NULL,`iso_currency` LONGTEXT NOT NULL, `taxonomy` LONGTEXT NOT NULL, `id_shop` int(XX) NOT NULL,`date_add` datetime NOT NULL,`date_upd` datetime NOT NULL,PRIMARY KEY (`id_feed`)) ENGINE=' . _MYSQL_ENGINE_ . ' DEFAULT CHARSET=utfXX;
2 queries
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_price_range` (`id_tag` int(XX) NOT NULL, `price_min` CHAR(XX) NOT NULL, `price_max` CHAR(XX), `id_product` CHAR(XX), UNIQUE KEY `tag_price_range` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utfXX;
2 queries
CREATE TABLE IF NOT EXISTS `een_gmcp_tmp_rules`(`id` int(XX) NOT NULL AUTO_INCREMENT, `id_shop` int(XX) NOT NULL DEFAULT "XX",`type` char(XX) NOT NULL, `exclusion_values` longtext NOT NULL, PRIMARY KEY (`id`)) ENGINE=InnoDB DEFAULT CHARSET=utfXX AUTO_INCREMENT=XX;
2 queries
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_last_product_ordered` (`id_tag` int(XX) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(XX), UNIQUE KEY `last_product_ordered` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utfXX;
2 queries
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_promotion` (`id_tag` int(XX) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(XX), UNIQUE KEY `promotion` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utfXX;
2 queries
CREATE TABLE IF NOT EXISTS `een_gmcp_discount_association` (`id_association` int(XX) NOT NULL AUTO_INCREMENT, `id_discount` int(XX) NOT NULL, `id_product` int(XX) NOT NULL, `channel` CHAR(XX) NOT NULL DEFAULT "SHOPPING_ADS", PRIMARY KEY (`id_association`) ) ENGINE=MyISAM DEFAULT CHARSET=utfXX;
2 queries
CREATE TABLE IF NOT EXISTS `een_gmcp_tags` (`id_tag` int(XX) NOT NULL AUTO_INCREMENT, `id_shop` int(XX) NOT NULL DEFAULT "XX", `name` char(XX) NOT NULL, `type` char(XX) NOT NULL, `active` TINYINT NOT NULL, `position` INT NOT NULL, `end_date` DATE, PRIMARY KEY (`id_tag`)) ENGINE=MyISAM DEFAULT CHARSET=utfXX AUTO_INCREMENT=XX ;
2 queries
COMMIT
2 queries
				SELECT `name`
				FROM `een_manufacturer`
				WHERE `id_manufacturer` = XX
				AND `active` = XX LIMIT XX
2 queries
SELECT XX FROM `een_cart_rule` WHERE ((date_to >= "XX-XX-XX XX:XX:XX" AND date_to <= "XX-XX-XX XX:XX:XX") OR (date_from >= "XX-XX-XX XX:XX:XX" AND date_from <= "XX-XX-XX XX:XX:XX") OR (date_from < "XX-XX-XX XX:XX:XX" AND date_to > "XX-XX-XX XX:XX:XX")) AND `id_customer` IN (XX,XX) LIMIT XX

Tables stress

75 product
75 product_shop
56 product_attribute
50 feature_product
41 cart_product
40 image
40 image_shop
40 product_attribute_shop
39 specific_price
38 stock_available
36 product_attribute_combination
35 product_lang
35 category_lang
34 module
30 module_shop
24 feature_value_lang
21 country
21 feature
21 feature_shop
21 feature_lang
20 specific_price_priority
20 product_group_reduction_cache
20 pack
20 image_lang
20 attribute
20 attribute_lang
20 attribute_group
18 category
16 category_product
15 category_group
13 country_lang
13 product_sale
12 currency
8 country_shop
7 hook
5 lang
4 shop_url
4 shop
4 lang_shop
4 currency_shop
4 gmcp_feeds
4 feature_value
4 layered_indexable_feature_value_lang_value
4 cart_rule
3 hook_alias
3 category_shop
3 tax_rule
3 tax_rules_group
2 shop_group
2 configuration
2 hook_module
2 meta
2 meta_lang
2 currency_lang
2 group
2 group_shop
2 image_type
2 orders
2 manufacturer
2 cart_rule_lang
1 memcached_servers
1 configuration_lang
1 module_group
1 hook_module_exceptions
1 group_lang
1 address_format
1 required_field
1 revslider_sliders
1 gmcp_discount_association
1 gmcp_tags
1 layered_category
1 layered_indexable_feature
1 layered_indexable_feature_lang_value
1 layered_price_index
1 feature_flag
1 order_cart_rule
1 ganalytics_data

ObjectModel instances

Name Instances Source
Product 24 /classes/Link.php:113 (__construct) [id: 647813]
/classes/Link.php:113 (__construct) [id: 647781]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 3893]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 647813]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 40017]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 36971]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 40037]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 40036]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 40040]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 40039]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6722]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 36837]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 30970]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4476]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4446]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4514]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4502]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 12863]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 40032]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 40034]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 647781]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 36979]
/classes/Link.php:113 (__construct) [id: 647813]
/classes/Link.php:113 (__construct) [id: 647781]
Country 15 /config/config.inc.php:148 (__construct) [id: 8]
/classes/controller/FrontController.php:946 (__construct) [id: 21]
/classes/AddressFormat.php:404 (__construct) [id: 17]
/classes/controller/FrontController.php:1779 (__construct) [id: 17]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 8]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 8]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 8]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 8]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 8]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 8]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 8]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 19]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 4]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 3]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 186]
Language 13 /config/config.inc.php:213 (__construct) [id: 1]
/classes/Tools.php:560 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
Currency 9 /src/Adapter/Currency/CurrencyDataProvider.php:101 (__construct) [id: 1]
/classes/Tools.php:690 (getCurrencyInstance) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:213 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:213 (__construct) [id: 0]
/modules/gmerchantcenterpro/lib/moduleTools.php:213 (__construct) [id: 0]
/modules/gmerchantcenterpro/lib/moduleTools.php:213 (__construct) [id: 0]
/modules/gmerchantcenterpro/lib/moduleTools.php:213 (__construct) [id: 0]
/modules/gmerchantcenterpro/lib/moduleTools.php:213 (__construct) [id: 0]
/modules/gmerchantcenterpro/lib/moduleTools.php:213 (__construct) [id: 0]
Address 4 /classes/shop/Shop.php:486 (__construct) [id: ]
/classes/Product.php:3694 (initialize) [id: ]
/classes/Product.php:3804 (__construct) [id: ]
/classes/Product.php:5964 (__construct) [id: ]
Cart 2 /classes/controller/FrontController.php:467 (__construct) [id: ]
/classes/controller/FrontController.php:541 (__construct) [id: ]
Shop 1 /config/config.inc.php:119 (initialize) [id: 1]
ShopGroup 1 /classes/shop/Shop.php:561 (__construct) [id: 1]
Customer 1 /config/config.inc.php:266 (__construct) [id: ]
Group 1 /classes/Cart.php:249 (getCurrent) [id: 1]
Gender 1 /classes/controller/FrontController.php:1702 (__construct) [id: 0]
Risk 1 /classes/controller/FrontController.php:1705 (__construct) [id: ]
AddressFormat 1 /classes/controller/FrontController.php:1773 (generateAddress) [id: ]
State 1 /classes/controller/FrontController.php:1778 (__construct) [id: 0]
Category 1 /modules/ps_facetedsearch/src/Filters/Block.php:157 (__construct) [id: 2]

Included Files

# Filename
0 /index.php
1 /config/config.inc.php
2 /config/defines.inc.php
3 /config/autoload.php
4 /vendor/autoload.php
5 /vendor/composer/autoload_real.php
6 /vendor/composer/platform_check.php
7 /vendor/composer/ClassLoader.php
8 /vendor/composer/include_paths.php
9 /vendor/composer/autoload_static.php
10 /vendor/symfony/polyfill-php72/bootstrap.php
11 /vendor/symfony/polyfill-mbstring/bootstrap.php
12 /vendor/symfony/polyfill-mbstring/bootstrap80.php
13 /vendor/symfony/polyfill-intl-normalizer/bootstrap.php
14 /vendor/symfony/polyfill-intl-normalizer/bootstrap80.php
15 /vendor/symfony/polyfill-intl-idn/bootstrap.php
16 /vendor/symfony/deprecation-contracts/function.php
17 /vendor/ralouphie/getallheaders/src/getallheaders.php
18 /vendor/symfony/polyfill-ctype/bootstrap.php
19 /vendor/symfony/polyfill-ctype/bootstrap80.php
20 /vendor/symfony/polyfill-php80/bootstrap.php
21 /vendor/guzzlehttp/promises/src/functions_include.php
22 /vendor/guzzlehttp/promises/src/functions.php
23 /vendor/guzzlehttp/guzzle/src/functions_include.php
24 /vendor/guzzlehttp/guzzle/src/functions.php
25 /vendor/symfony/polyfill-iconv/bootstrap.php
26 /vendor/ezyang/htmlpurifier/library/HTMLPurifier.composer.php
27 /vendor/jakeasmith/http_build_url/src/http_build_url.php
28 /vendor/lcobucci/jwt/compat/class-aliases.php
29 /vendor/lcobucci/jwt/src/Token.php
30 /vendor/lcobucci/jwt/src/Signature.php
31 /vendor/lcobucci/jwt/compat/json-exception-polyfill.php
32 /vendor/lcobucci/jwt/compat/lcobucci-clock-polyfill.php
33 /vendor/swiftmailer/swiftmailer/lib/swift_required.php
34 /vendor/swiftmailer/swiftmailer/lib/classes/Swift.php
35 /vendor/symfony/polyfill-intl-icu/bootstrap.php
36 /vendor/symfony/polyfill-php73/bootstrap.php
37 /vendor/symfony/polyfill-php81/bootstrap.php
38 /vendor/api-platform/core/src/deprecation.php
39 /vendor/api-platform/core/src/Api/FilterInterface.php
40 /vendor/api-platform/core/src/Api/ResourceClassResolverInterface.php
41 /vendor/api-platform/core/src/deprecated_interfaces.php
42 /vendor/api-platform/core/src/Metadata/Property/Factory/PropertyNameCollectionFactoryInterface.php
43 /vendor/api-platform/core/src/Metadata/Resource/Factory/ResourceNameCollectionFactoryInterface.php
44 /vendor/api-platform/core/src/Metadata/Extractor/ResourceExtractorInterface.php
45 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/DateFilterInterface.php
46 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/ExistsFilterInterface.php
47 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/OrderFilterInterface.php
48 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/RangeFilterInterface.php
49 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/SearchFilterInterface.php
50 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationCollectionExtensionInterface.php
51 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationItemExtensionInterface.php
52 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultCollectionExtensionInterface.php
53 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultItemExtensionInterface.php
54 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Filter/FilterInterface.php
55 /vendor/api-platform/core/src/Doctrine/Orm/QueryAwareInterface.php
56 /vendor/api-platform/core/src/Doctrine/Orm/Util/QueryNameGeneratorInterface.php
57 /vendor/api-platform/core/src/Elasticsearch/Metadata/Document/Factory/DocumentMetadataFactoryInterface.php
58 /vendor/api-platform/core/src/Symfony/Validator/ValidationGroupsGeneratorInterface.php
59 /vendor/api-platform/core/src/Symfony/Validator/Exception/ConstraintViolationListAwareExceptionInterface.php
60 /vendor/api-platform/core/src/Exception/ExceptionInterface.php
61 /vendor/api-platform/core/src/Core/Bridge/Symfony/Validator/Metadata/Property/Restriction/PropertySchemaRestrictionMetadataInterface.php
62 /vendor/api-platform/core/src/State/Pagination/PaginatorInterface.php
63 /vendor/api-platform/core/src/State/Pagination/PartialPaginatorInterface.php
64 /vendor/api-platform/core/src/Documentation/DocumentationInterface.php
65 /vendor/api-platform/core/src/JsonLd/AnonymousContextBuilderInterface.php
66 /vendor/api-platform/core/src/JsonLd/ContextBuilderInterface.php
67 /vendor/api-platform/core/src/Core/JsonSchema/SchemaFactoryInterface.php
68 /vendor/api-platform/core/src/JsonSchema/TypeFactoryInterface.php
69 /vendor/api-platform/core/src/OpenApi/Factory/OpenApiFactoryInterface.php
70 /vendor/api-platform/core/src/PathResolver/OperationPathResolverInterface.php
71 /vendor/api-platform/core/src/Symfony/Security/ResourceAccessCheckerInterface.php
72 /vendor/api-platform/core/src/Serializer/Filter/FilterInterface.php
73 /vendor/api-platform/core/src/Serializer/SerializerContextBuilderInterface.php
74 /vendor/api-platform/core/src/Validator/ValidatorInterface.php
75 /vendor/api-platform/core/src/Api/UrlGeneratorInterface.php
76 /vendor/api-platform/core/src/GraphQl/ExecutorInterface.php
77 /vendor/api-platform/core/src/GraphQl/Error/ErrorHandlerInterface.php
78 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ValidateStageInterface.php
79 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ReadStageInterface.php
80 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityPostDenormalizeStageInterface.php
81 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityStageInterface.php
82 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/WriteStageInterface.php
83 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SerializeStageInterface.php
84 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/DeserializeStageInterface.php
85 /vendor/api-platform/core/src/GraphQl/Resolver/QueryItemResolverInterface.php
86 /vendor/api-platform/core/src/GraphQl/Resolver/QueryCollectionResolverInterface.php
87 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Factory/ResolverFactoryInterface.php
88 /vendor/api-platform/core/src/GraphQl/Resolver/MutationResolverInterface.php
89 /vendor/api-platform/core/src/Core/GraphQl/Subscription/MercureSubscriptionIriGeneratorInterface.php
90 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionIdentifierGeneratorInterface.php
91 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionManagerInterface.php
92 /vendor/api-platform/core/src/Core/GraphQl/Serializer/SerializerContextBuilderInterface.php
93 /vendor/api-platform/core/src/GraphQl/Type/TypesFactoryInterface.php
94 /vendor/api-platform/core/src/GraphQl/Type/Definition/TypeInterface.php
95 /vendor/api-platform/core/src/GraphQl/Type/TypesContainerInterface.php
96 /vendor/psr/container/src/ContainerInterface.php
97 /vendor/api-platform/core/src/Operation/PathSegmentNameGeneratorInterface.php
98 /vendor/ircmaxell/password-compat/lib/password.php
99 /vendor/martinlindhe/php-mb-helpers/src/mb_helpers.php
100 /vendor/prestashop/laminas-code-lts/polyfill/ReflectionEnumPolyfill.php
101 /src/Core/Version.php
102 /config/alias.php
103 /vendor/prestashop/autoload/src/PrestashopAutoload.php
104 /vendor/prestashop/autoload/src/LegacyClassLoader.php
105 /vendor/symfony/symfony/src/Symfony/Component/Filesystem/Filesystem.php
106 /vendor/prestashop/autoload/src/Autoloader.php
107 /config/bootstrap.php
108 /src/Core/ContainerBuilder.php
109 /src/Core/Foundation/IoC/Container.php
110 /src/Adapter/ServiceLocator.php
111 /var/cache/prod/appParameters.php
114 /var/cache/prod/class_index.php
115 /classes/controller/Controller.php
117 /classes/ObjectModel.php
118 /src/Core/Foundation/Database/EntityInterface.php
120 /classes/db/Db.php
122 /classes/Hook.php
124 /classes/module/Module.php
125 /src/Core/Module/Legacy/ModuleInterface.php
127 /classes/Tools.php
128 /classes/Context.php
129 /classes/shop/Shop.php
130 /src/Core/Security/PasswordGenerator.php
131 /classes/db/DbPDO.php
132 /classes/AddressFormat.php
133 /classes/cache/Cache.php
134 /classes/cache/CacheMemcached.php
135 /config/db_slave_server.inc.php
136 /src/Core/Security/Hashing.php
137 /classes/Configuration.php
138 /classes/Validate.php
139 /src/Adapter/EntityMapper.php
140 /classes/db/DbQuery.php
141 /src/Core/Addon/Theme/ThemeManagerBuilder.php
142 /vendor/psr/log/Psr/Log/NullLogger.php
143 /vendor/psr/log/Psr/Log/AbstractLogger.php
144 /vendor/psr/log/Psr/Log/LoggerInterface.php
145 /src/Adapter/Configuration.php
146 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ParameterBag.php
147 /src/Core/Domain/Configuration/ShopConfigurationInterface.php
148 /src/Core/ConfigurationInterface.php
149 /src/Core/Addon/Theme/ThemeRepository.php
150 /src/Core/Addon/AddonRepositoryInterface.php
151 /src/Core/Domain/Shop/ValueObject/ShopConstraint.php
152 /src/Core/Addon/Theme/Theme.php
153 /src/Core/Addon/AddonInterface.php
154 /src/Core/Util/ArrayFinder.php
155 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccess.php
156 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorBuilder.php
157 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessor.php
158 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorInterface.php
159 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPath.php
160 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPathInterface.php
161 /config/defines_uri.inc.php
162 /classes/Language.php
163 /src/Core/Language/LanguageInterface.php
164 /classes/Country.php
165 /classes/PrestaShopCollection.php
166 /classes/shop/ShopGroup.php
167 /classes/Cookie.php
168 /classes/PhpEncryption.php
169 /classes/PhpEncryptionEngine.php
170 /vendor/defuse/php-encryption/src/Key.php
171 /vendor/defuse/php-encryption/src/Encoding.php
172 /vendor/defuse/php-encryption/src/Core.php
173 /vendor/defuse/php-encryption/src/Crypto.php
174 /vendor/defuse/php-encryption/src/KeyOrPassword.php
175 /vendor/defuse/php-encryption/src/RuntimeTests.php
176 /vendor/defuse/php-encryption/src/DerivedKeys.php
177 /vendor/defuse/php-encryption/src/Exception/WrongKeyOrModifiedCiphertextException.php
178 /vendor/defuse/php-encryption/src/Exception/CryptoException.php
179 /src/Core/Session/SessionHandler.php
180 /src/Core/Session/SessionHandlerInterface.php
181 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Session.php
182 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBag.php
183 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBagInterface.php
184 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagInterface.php
185 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBag.php
186 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBagInterface.php
187 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagProxy.php
188 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionInterface.php
189 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/PhpBridgeSessionStorage.php
190 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/NativeSessionStorage.php
191 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/MetadataBag.php
192 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/StrictSessionHandler.php
193 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/AbstractSessionHandler.php
194 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/SessionHandlerProxy.php
195 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/AbstractProxy.php
196 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/SessionStorageInterface.php
197 /config/smarty.config.inc.php
198 /vendor/smarty/smarty/libs/Smarty.class.php
199 /vendor/smarty/smarty/libs/functions.php
200 /vendor/smarty/smarty/libs/Autoloader.php
201 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_data.php
202 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_extension_handler.php
203 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php
204 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php
205 /vendor/smarty/smarty/libs/sysplugins/smarty_resource.php
206 /vendor/smarty/smarty/libs/sysplugins/smarty_variable.php
207 /vendor/smarty/smarty/libs/sysplugins/smarty_template_source.php
208 /vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php
209 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_resource_file.php
210 /config/smartyfront.config.inc.php
211 /classes/Smarty/SmartyResourceModule.php
212 /vendor/smarty/smarty/libs/sysplugins/smarty_resource_custom.php
213 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerresource.php
214 /classes/Smarty/SmartyResourceParent.php
215 /classes/Smarty/SmartyLazyRegister.php
216 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerplugin.php
217 /vendor/smarty/smarty/libs/plugins/modifier.truncate.php
218 /classes/Customer.php
219 /classes/Group.php
220 /override/classes/Link.php
221 /classes/Link.php
222 /classes/shop/ShopUrl.php
223 /override/classes/Dispatcher.php
224 /classes/Dispatcher.php
225 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Request.php
226 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeader.php
227 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeaderItem.php
228 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/FileBag.php
229 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderBag.php
230 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderUtils.php
231 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ServerBag.php
232 /src/Adapter/SymfonyContainer.php
233 /vendor/mobiledetect/mobiledetectlib/Mobile_Detect.php
234 /modules/ph_simpleblog/ph_simpleblog.php
235 /modules/ph_simpleblog/assets/phpthumb/ThumbLib.inc.php
236 /modules/ph_simpleblog/assets/phpthumb/PhpThumb.inc.php
237 /modules/ph_simpleblog/assets/phpthumb/ThumbBase.inc.php
238 /modules/ph_simpleblog/assets/phpthumb/GdThumb.inc.php
239 /modules/ph_simpleblog/vendor/autoload.php
240 /modules/ph_simpleblog/vendor/composer/autoload_real.php
241 /modules/ph_simpleblog/vendor/composer/platform_check.php
242 /modules/ph_simpleblog/vendor/composer/autoload_static.php
243 /modules/ph_simpleblog/models/SimpleBlogCategory.php
244 /modules/ph_simpleblog/models/SimpleBlogPost.php
245 /modules/ph_simpleblog/models/SimpleBlogPostType.php
246 /modules/ph_simpleblog/models/SimpleBlogPostImage.php
247 /modules/ph_simpleblog/models/SimpleBlogTag.php
248 /modules/ph_simpleblog/models/SimpleBlogComment.php
249 /modules/ph_simpleblog/models/SimpleBlogPostAuthor.php
250 /modules/ph_simpleblog/classes/SimpleBlogHelper.php
251 /modules/ph_simpleblog/classes/BlogPostsFinder.php
252 /modules/ph_simpleblog/controllers/front/default_list.php
253 /classes/controller/ModuleFrontController.php
254 /override/classes/controller/FrontController.php
255 /classes/controller/FrontController.php
256 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_createdata.php
257 /vendor/smarty/smarty/libs/sysplugins/smarty_data.php
258 /classes/Translate.php
259 /modules/ph_simpleblog/translations/fr.php
260 /src/PrestaShopBundle/Translation/TranslatorComponent.php
261 /vendor/symfony/symfony/src/Symfony/Component/Translation/Translator.php
262 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorInterface.php
263 /vendor/symfony/contracts/Translation/LocaleAwareInterface.php
264 /vendor/symfony/contracts/Translation/TranslatorInterface.php
265 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorBagInterface.php
266 /src/PrestaShopBundle/Translation/PrestaShopTranslatorTrait.php
267 /src/PrestaShopBundle/Translation/TranslatorLanguageTrait.php
268 /src/PrestaShopBundle/Translation/TranslatorInterface.php
269 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatter.php
270 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatter.php
271 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatterInterface.php
272 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatterInterface.php
273 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/ChoiceMessageFormatterInterface.php
274 /vendor/symfony/symfony/src/Symfony/Component/Translation/IdentityTranslator.php
275 /vendor/symfony/contracts/Translation/TranslatorTrait.php
276 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactory.php
277 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactoryInterface.php
278 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCache.php
279 /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerConfigCache.php
280 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheInterface.php
281 /var/cache/prod/translations/catalogue.fr-FR.NXhscRe.php
282 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogue.php
283 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogueInterface.php
284 /vendor/symfony/symfony/src/Symfony/Component/Translation/MetadataAwareInterface.php
285 /controllers/front/listing/PricesDropController.php
286 /classes/controller/ProductListingFrontController.php
287 /classes/controller/ProductPresentingFrontController.php
288 /src/Adapter/Presenter/Object/ObjectPresenter.php
289 /src/Adapter/Presenter/PresenterInterface.php
290 /src/Adapter/Presenter/Cart/CartPresenter.php
291 /src/Adapter/Image/ImageRetriever.php
292 /classes/tax/TaxConfiguration.php
293 /classes/Smarty/TemplateFinder.php
294 /classes/assets/StylesheetManager.php
295 /classes/assets/AbstractAssetManager.php
296 /src/Adapter/Assets/AssetUrlGeneratorTrait.php
297 /classes/assets/JavascriptManager.php
298 /classes/assets/CccReducer.php
299 /modules/iqitthemeeditor/iqitthemeeditor.php
300 /modules/iqitthemeeditor/src/IqitSmartyModifiers.php
301 /modules/iqitthemeeditor/translations/fr.php
302 /src/Adapter/ContainerBuilder.php
303 /src/Adapter/Environment.php
304 /src/Core/EnvironmentInterface.php
305 /vendor/symfony/symfony/src/Symfony/Component/Cache/DoctrineProvider.php
306 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/CacheProvider.php
307 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Cache.php
308 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/FlushableCache.php
309 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/ClearableCache.php
310 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiOperationCache.php
311 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiGetCache.php
312 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiDeleteCache.php
313 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiPutCache.php
314 /vendor/symfony/symfony/src/Symfony/Component/Cache/PruneableInterface.php
315 /vendor/symfony/symfony/src/Symfony/Component/Cache/ResettableInterface.php
316 /vendor/symfony/contracts/Service/ResetInterface.php
317 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/ArrayAdapter.php
318 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ArrayTrait.php
319 /vendor/psr/log/Psr/Log/LoggerAwareTrait.php
320 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AdapterInterface.php
321 /vendor/symfony/symfony/src/Symfony/Component/Cache/CacheItem.php
322 /vendor/symfony/contracts/Cache/ItemInterface.php
323 /vendor/psr/cache/src/CacheItemInterface.php
324 /vendor/psr/cache/src/CacheItemPoolInterface.php
325 /vendor/symfony/contracts/Cache/CacheInterface.php
326 /vendor/psr/log/Psr/Log/LoggerAwareInterface.php
327 /vendor/doctrine/orm/lib/Doctrine/ORM/Tools/Setup.php
328 /vendor/doctrine/deprecations/lib/Doctrine/Deprecations/Deprecation.php
329 /vendor/doctrine/orm/lib/Doctrine/ORM/Configuration.php
330 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Configuration.php
331 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/CacheAdapter.php
332 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/DoctrineProvider.php
333 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationReader.php
334 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Reader.php
335 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationRegistry.php
336 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/DoctrineAnnotations.php
337 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Annotation.php
338 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Entity.php
339 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embeddable.php
340 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embedded.php
341 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/MappedSuperclass.php
342 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/InheritanceType.php
343 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorColumn.php
344 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorMap.php
345 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Id.php
346 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/GeneratedValue.php
347 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Version.php
348 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumn.php
349 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumns.php
350 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Column.php
351 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToOne.php
352 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToMany.php
353 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToOne.php
354 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToMany.php
355 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Table.php
356 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/UniqueConstraint.php
357 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Index.php
358 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinTable.php
359 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SequenceGenerator.php
360 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/CustomIdGenerator.php
361 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ChangeTrackingPolicy.php
362 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OrderBy.php
363 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQueries.php
364 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQuery.php
365 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/HasLifecycleCallbacks.php
366 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PrePersist.php
367 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostPersist.php
368 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreUpdate.php
369 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostUpdate.php
370 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreRemove.php
371 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostRemove.php
372 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostLoad.php
373 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreFlush.php
374 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/FieldResult.php
375 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ColumnResult.php
376 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityResult.php
377 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQuery.php
378 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQueries.php
379 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMapping.php
380 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMappings.php
381 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverride.php
382 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverrides.php
383 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverride.php
384 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverrides.php
385 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityListeners.php
386 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Cache.php
387 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/SimpleAnnotationReader.php
388 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocParser.php
389 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocLexer.php
390 /vendor/doctrine/lexer/lib/Doctrine/Common/Lexer/AbstractLexer.php
391 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Target.php
392 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/AnnotationDriver.php
393 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/CompatibilityAnnotationDriver.php
394 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/MappingDriver.php
395 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/ColocatedMappingDriver.php
396 /var/cache/prod/FrontContainer.php
397 /src/Adapter/Container/LegacyContainer.php
398 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Container.php
399 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/RewindableGenerator.php
400 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/ServiceLocator.php
401 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ServiceLocator.php
402 /vendor/symfony/contracts/Service/ServiceLocatorTrait.php
403 /vendor/psr/container/src/ContainerExceptionInterface.php
404 /vendor/psr/container/src/NotFoundExceptionInterface.php
405 /vendor/symfony/contracts/Service/ServiceProviderInterface.php
406 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ResettableContainerInterface.php
407 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ContainerInterface.php
408 /src/Adapter/Container/LegacyContainerInterface.php
409 /modules/ps_categorytree/vendor/autoload.php
410 /modules/ps_categorytree/vendor/composer/autoload_real.php
411 /modules/ps_categorytree/vendor/composer/platform_check.php
412 /modules/ps_categorytree/vendor/composer/autoload_static.php
413 /modules/ps_facetedsearch/vendor/autoload.php
414 /modules/ps_facetedsearch/vendor/composer/autoload_real.php
415 /modules/ps_facetedsearch/vendor/composer/platform_check.php
416 /modules/ps_facetedsearch/vendor/composer/autoload_static.php
417 /modules/contactform/vendor/autoload.php
418 /modules/contactform/vendor/composer/autoload_real.php
419 /modules/contactform/vendor/composer/platform_check.php
420 /modules/contactform/vendor/composer/autoload_static.php
421 /modules/ps_sharebuttons/vendor/autoload.php
422 /modules/ps_sharebuttons/vendor/composer/autoload_real.php
423 /modules/ps_sharebuttons/vendor/composer/platform_check.php
424 /modules/ps_sharebuttons/vendor/composer/autoload_static.php
425 /modules/gsitemap/vendor/autoload.php
426 /modules/gsitemap/vendor/composer/autoload_real.php
427 /modules/gsitemap/vendor/composer/platform_check.php
428 /modules/gsitemap/vendor/composer/autoload_static.php
429 /modules/ps_crossselling/vendor/autoload.php
430 /modules/ps_crossselling/vendor/composer/autoload_real.php
431 /modules/ps_crossselling/vendor/composer/platform_check.php
432 /modules/ps_crossselling/vendor/composer/autoload_static.php
433 /modules/ps_themecusto/vendor/autoload.php
434 /modules/ps_themecusto/vendor/composer/autoload_real.php
435 /modules/ps_themecusto/vendor/composer/platform_check.php
436 /modules/ps_themecusto/vendor/composer/autoload_static.php
437 /modules/ps_supplierlist/vendor/autoload.php
438 /modules/ps_supplierlist/vendor/composer/autoload_real.php
439 /modules/ps_supplierlist/vendor/composer/platform_check.php
440 /modules/ps_supplierlist/vendor/composer/autoload_static.php
441 /modules/ps_googleanalytics/vendor/autoload.php
442 /modules/ps_googleanalytics/vendor/composer/autoload_real.php
443 /modules/ps_googleanalytics/vendor/composer/platform_check.php
444 /modules/ps_googleanalytics/vendor/composer/autoload_static.php
445 /modules/statssearch/vendor/autoload.php
446 /modules/statssearch/vendor/composer/autoload_real.php
447 /modules/statssearch/vendor/composer/platform_check.php
448 /modules/statssearch/vendor/composer/autoload_static.php
449 /modules/ps_faviconnotificationbo/vendor/autoload.php
450 /modules/ps_faviconnotificationbo/vendor/composer/autoload_real.php
451 /modules/ps_faviconnotificationbo/vendor/composer/platform_check.php
452 /modules/ps_faviconnotificationbo/vendor/composer/autoload_static.php
453 /modules/ps_categoryproducts/vendor/autoload.php
454 /modules/ps_categoryproducts/vendor/composer/autoload_real.php
455 /modules/ps_categoryproducts/vendor/composer/platform_check.php
456 /modules/ps_categoryproducts/vendor/composer/autoload_static.php
457 /modules/ps_wirepayment/vendor/autoload.php
458 /modules/ps_wirepayment/vendor/composer/autoload_real.php
459 /modules/ps_wirepayment/vendor/composer/platform_check.php
460 /modules/ps_wirepayment/vendor/composer/autoload_static.php
461 /modules/statsregistrations/vendor/autoload.php
462 /modules/statsregistrations/vendor/composer/autoload_real.php
463 /modules/statsregistrations/vendor/composer/platform_check.php
464 /modules/statsregistrations/vendor/composer/autoload_static.php
465 /modules/ps_distributionapiclient/vendor/autoload.php
466 /modules/ps_distributionapiclient/vendor/composer/autoload_real.php
467 /modules/ps_distributionapiclient/vendor/composer/platform_check.php
468 /modules/ps_distributionapiclient/vendor/composer/autoload_static.php
469 /modules/ps_distributionapiclient/vendor/symfony/polyfill-intl-grapheme/bootstrap.php
470 /modules/ps_distributionapiclient/vendor/symfony/string/Resources/functions.php
471 /modules/ps_emailalerts/vendor/autoload.php
472 /modules/ps_emailalerts/vendor/composer/autoload_real.php
473 /modules/ps_emailalerts/vendor/composer/platform_check.php
474 /modules/ps_emailalerts/vendor/composer/autoload_static.php
475 /modules/ps_brandlist/vendor/autoload.php
476 /modules/ps_brandlist/vendor/composer/autoload_real.php
477 /modules/ps_brandlist/vendor/composer/platform_check.php
478 /modules/ps_brandlist/vendor/composer/autoload_static.php
479 /modules/ps_viewedproduct/vendor/autoload.php
480 /modules/ps_viewedproduct/vendor/composer/autoload_real.php
481 /modules/ps_viewedproduct/vendor/composer/platform_check.php
482 /modules/ps_viewedproduct/vendor/composer/autoload_static.php
483 /modules/iqitsociallogin/vendor/autoload.php
484 /modules/iqitsociallogin/vendor/composer/autoload_real.php
485 /modules/iqitsociallogin/vendor/composer/platform_check.php
486 /modules/iqitsociallogin/vendor/composer/autoload_static.php
487 /modules/gmerchantcenterpro/vendor/autoload.php
488 /modules/gmerchantcenterpro/vendor/composer/autoload_real.php
489 /modules/gmerchantcenterpro/vendor/composer/platform_check.php
490 /modules/gmerchantcenterpro/vendor/composer/autoload_static.php
491 /modules/wizardai/vendor/autoload.php
492 /modules/wizardai/vendor/composer/autoload_real.php
493 /modules/wizardai/vendor/composer/platform_check.php
494 /modules/wizardai/vendor/composer/autoload_static.php
495 /modules/wizardai/vendor/clue/stream-filter/src/functions_include.php
496 /modules/wizardai/vendor/clue/stream-filter/src/functions.php
497 /modules/wizardai/vendor/guzzlehttp/psr7/src/functions_include.php
498 /modules/wizardai/vendor/guzzlehttp/psr7/src/functions.php
499 /modules/wizardai/vendor/php-http/message/src/filters.php
500 /modules/wizardai/vendor/symfony/polyfill-apcu/bootstrap.php
501 /modules/stripe_official/vendor/autoload.php
502 /modules/stripe_official/vendor/composer/autoload_real.php
503 /modules/stripe_official/vendor/composer/platform_check.php
504 /modules/stripe_official/vendor/composer/autoload_static.php
505 /modules/vivawalletsmartcheckout/vendor/autoload.php
506 /modules/vivawalletsmartcheckout/vendor/composer/autoload_real.php
507 /modules/vivawalletsmartcheckout/vendor/composer/autoload_static.php
508 /modules/autoupgrade/vendor/autoload.php
509 /modules/autoupgrade/vendor/composer/autoload_real.php
510 /modules/autoupgrade/vendor/composer/autoload_static.php
511 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment.php
512 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Client.php
513 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer.php
514 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/QueueConsumer.php
515 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/File.php
516 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/ForkCurl.php
517 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/LibCurl.php
518 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/Socket.php
519 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Version.php
520 /src/Core/Localization/Locale/Repository.php
521 /src/Core/Localization/Locale/RepositoryInterface.php
522 /src/Core/Localization/CLDR/LocaleRepository.php
523 /src/Core/Localization/CLDR/LocaleDataSource.php
524 /src/Core/Localization/CLDR/DataLayer/LocaleCache.php
525 /src/Core/Data/Layer/AbstractDataLayer.php
526 /src/Core/Localization/CLDR/LocaleDataLayerInterface.php
527 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/FilesystemAdapter.php
528 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AbstractAdapter.php
529 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractAdapterTrait.php
530 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractTrait.php
531 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ContractsTrait.php
532 /vendor/symfony/contracts/Cache/CacheTrait.php
533 /vendor/psr/cache/src/InvalidArgumentException.php
534 /vendor/psr/cache/src/CacheException.php
535 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemTrait.php
536 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemCommonTrait.php
537 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/DefaultMarshaller.php
538 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/MarshallerInterface.php
539 /src/Core/Localization/CLDR/DataLayer/LocaleReference.php
540 /src/Core/Localization/CLDR/Reader.php
541 /src/Core/Localization/CLDR/ReaderInterface.php
542 /src/Core/Localization/Currency/Repository.php
543 /src/Core/Localization/Currency/RepositoryInterface.php
544 /src/Core/Localization/Currency/CurrencyDataSource.php
545 /src/Core/Localization/Currency/DataSourceInterface.php
546 /src/Core/Localization/Currency/DataLayer/CurrencyCache.php
547 /src/Core/Localization/Currency/CurrencyDataLayerInterface.php
548 /src/Core/Localization/Currency/DataLayer/CurrencyDatabase.php
549 /src/Adapter/Currency/CurrencyDataProvider.php
550 /src/Core/Currency/CurrencyDataProviderInterface.php
551 /src/Adapter/LegacyContext.php
552 /src/Adapter/Tools.php
553 /src/Core/Localization/Currency/DataLayer/CurrencyReference.php
554 /src/Core/Localization/Currency/DataLayer/CurrencyInstalled.php
555 /vendor/prestashop/decimal/src/Operation/Rounding.php
556 /src/Core/Localization/Locale.php
557 /src/Core/Localization/LocaleInterface.php
558 /src/Core/Localization/Specification/Price.php
559 /src/Core/Localization/Specification/Number.php
560 /src/Core/Localization/Specification/NumberInterface.php
561 /src/Core/Localization/Specification/Factory.php
562 /src/Core/Localization/CLDR/LocaleData.php
563 /src/Core/Localization/CLDR/NumberSymbolsData.php
564 /src/Core/Localization/CLDR/CurrencyData.php
565 /src/Core/Localization/CLDR/Locale.php
566 /src/Core/Localization/CLDR/LocaleInterface.php
567 /src/Core/Localization/Specification/NumberSymbolList.php
568 /classes/Currency.php
569 /src/Core/Localization/Currency/LocalizedCurrencyId.php
570 /classes/webservice/WebserviceRequest.php
571 /src/Core/Localization/Currency/CurrencyData.php
572 /src/Core/Localization/Currency/CurrencyCollection.php
573 /src/Core/Localization/Currency.php
574 /src/Core/Localization/CurrencyInterface.php
575 /src/Core/Localization/Specification/NumberCollection.php
576 /src/Core/Localization/Number/Formatter.php
577 /classes/Cart.php
578 /src/Adapter/AddressFactory.php
579 /override/classes/CartRule.php
580 /classes/CartRule.php
581 /classes/Product.php
582 /src/Core/Domain/Product/ValueObject/RedirectType.php
583 /src/Core/Util/DateTime/DateTime.php
584 /src/Core/Domain/Product/Stock/ValueObject/OutOfStockType.php
585 /src/Core/Domain/Product/Pack/ValueObject/PackStockType.php
586 /src/Core/Domain/Product/ValueObject/ProductType.php
587 /src/Core/Domain/Product/ValueObject/Reference.php
588 /src/Core/Domain/Product/ValueObject/Ean13.php
589 /src/Core/Domain/Product/ValueObject/Isbn.php
590 /src/Core/Domain/Product/ValueObject/Upc.php
591 /src/Core/Domain/Product/ProductSettings.php
592 /src/Core/Domain/Shop/ValueObject/ShopId.php
593 /src/Core/Domain/Shop/ValueObject/ShopIdInterface.php
594 /modules/ps_emailalerts/ps_emailalerts.php
595 /modules/ps_emailalerts/MailAlert.php
596 /src/PrestaShopBundle/Translation/DomainNormalizer.php
597 /modules/facebookconversiontrackingplus/facebookconversiontrackingplus.php
598 /modules/facebookconversiontrackingplus/classes/autoload.php
599 /modules/facebookconversiontrackingplus/translations/fr.php
600 /modules/facebookconversiontrackingplus/classes/ConversionApi.php
601 /modules/facebookconversiontrackingplus/classes/PixelTools.php
602 /modules/facebookconversiontrackingplus/classes/IpGeolocation.php
603 /src/Core/Security/OpenSsl/OpenSSL.php
604 /src/Core/Security/OpenSsl/OpenSSLInterface.php
605 /modules/facebookconversiontrackingplus/classes/SmartForm.php
606 /override/classes/Media.php
607 /classes/Media.php
608 /modules/revolutpayment/revolutpayment.php
609 /modules/revolutpayment/classes/RevolutApi.php
610 /modules/revolutpayment/classes/RevolutDatabaseHelper.php
611 /modules/revolutpayment/classes/RevolutPRBSettingsHelper.php
612 /modules/revolutpayment/classes/RevolutApplePayOnBoardingHelper.php
613 /modules/revolutpayment/classes/RevolutModuleHelper.php
614 /classes/PaymentModule.php
615 /modules/revolutpayment/translations/fr.php
616 /src/Adapter/Presenter/Cart/CartLazyArray.php
617 /src/Adapter/Presenter/AbstractLazyArray.php
618 /src/Adapter/Product/PriceFormatter.php
619 /src/Core/Util/Inflector.php
620 /vendor/doctrine/inflector/lib/Doctrine/Inflector/InflectorFactory.php
621 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Language.php
622 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/InflectorFactory.php
623 /vendor/doctrine/inflector/lib/Doctrine/Inflector/GenericLanguageInflectorFactory.php
624 /vendor/doctrine/inflector/lib/Doctrine/Inflector/LanguageInflectorFactory.php
625 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Rules.php
626 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Ruleset.php
627 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformations.php
628 /vendor/doctrine/inflector/lib/Doctrine/Inflector/WordInflector.php
629 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Inflectible.php
630 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformation.php
631 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Pattern.php
632 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Patterns.php
633 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Uninflected.php
634 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitutions.php
635 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitution.php
636 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Word.php
637 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Inflector.php
638 /vendor/doctrine/inflector/lib/Doctrine/Inflector/CachedWordInflector.php
639 /vendor/doctrine/inflector/lib/Doctrine/Inflector/RulesetInflector.php
640 /classes/Gender.php
641 /classes/Risk.php
642 /classes/Meta.php
643 /modules/revsliderprestashop/revsliderprestashop.php
644 /modules/revsliderprestashop/rev-loader.php
645 /modules/revsliderprestashop/includes/revslider_db.class.php
646 /modules/revsliderprestashop/includes/data.class.php
647 /modules/revsliderprestashop/includes/functions.class.php
648 /modules/revsliderprestashop/includes/em-integration.class.php
649 /modules/revsliderprestashop/includes/cssparser.class.php
650 /modules/revsliderprestashop/includes/woocommerce.class.php
651 /modules/revsliderprestashop/includes/wpml.class.php
652 /modules/revsliderprestashop/includes/colorpicker.class.php
653 /modules/revsliderprestashop/includes/navigation.class.php
654 /modules/revsliderprestashop/includes/object-library.class.php
655 /modules/revsliderprestashop/admin/includes/loadbalancer.class.php
656 /modules/revsliderprestashop/admin/includes/plugin-update.class.php
657 /modules/revsliderprestashop/includes/extension.class.php
658 /modules/revsliderprestashop/includes/favorite.class.php
659 /modules/revsliderprestashop/includes/aq-resizer.class.php
660 /modules/revsliderprestashop/includes/external-sources.class.php
661 /modules/revsliderprestashop/includes/page-template.class.php
662 /modules/revsliderprestashop/includes/slider.class.php
663 /modules/revsliderprestashop/includes/slide.class.php
664 /modules/revsliderprestashop/includes/output.class.php
665 /modules/revsliderprestashop/public/revslider-front.class.php
666 /modules/revsliderprestashop/includes/backwards.php
667 /modules/revsliderprestashop/admin/includes/class-pclzip.php
668 /modules/revsliderprestashop/admin/includes/license.class.php
669 /modules/revsliderprestashop/admin/includes/addons.class.php
670 /modules/revsliderprestashop/admin/includes/template.class.php
671 /modules/revsliderprestashop/admin/includes/functions-admin.class.php
672 /modules/revsliderprestashop/admin/includes/folder.class.php
673 /modules/revsliderprestashop/admin/includes/import.class.php
674 /modules/revsliderprestashop/admin/includes/export.class.php
675 /modules/revsliderprestashop/admin/includes/export-html.class.php
676 /modules/revsliderprestashop/admin/includes/newsletter.class.php
677 /modules/revsliderprestashop/admin/revslider-admin.class.php
678 /modules/revsliderprestashop/includes/update.class.php
679 /modules/revsliderprestashop/includes/resize-imag.php
680 /modules/revsliderprestashop/translations/fr.php
681 /classes/Address.php
682 /classes/ImageType.php
683 /classes/State.php
684 /src/Core/Security/PasswordPolicyConfiguration.php
685 /src/Core/Configuration/DataConfigurationInterface.php
686 /src/Core/Filter/FrontEndObject/MainFilter.php
687 /src/Core/Filter/FilterInterface.php
688 /src/Core/Filter/FrontEndObject/CartFilter.php
689 /src/Core/Filter/HashMapWhitelistFilter.php
690 /src/Core/Filter/CollectionFilter.php
691 /src/Core/Filter/FrontEndObject/ProductFilter.php
692 /src/Core/Filter/FrontEndObject/EmbeddedAttributesFilter.php
693 /src/Core/Filter/FrontEndObject/CustomerFilter.php
694 /src/Core/Filter/FrontEndObject/ShopFilter.php
695 /src/Core/Filter/FrontEndObject/ConfigurationFilter.php
696 /modules/ps_shoppingcart/ps_shoppingcart.php
697 /src/Core/Module/WidgetInterface.php
698 /modules/ps_googleanalytics/ps_googleanalytics.php
699 /modules/ps_googleanalytics/classes/Hook/HookDisplayHeader.php
700 /modules/ps_googleanalytics/classes/Hook/HookInterface.php
701 /vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php
702 /var/cache/prod/smarty/compile/warehouse/ee/78/8a/ee788a7ffa4b95e0a488ef6dc4b9f3c8b40ce111_2.file.ps_googleanalytics.tpl.php
703 /vendor/smarty/smarty/libs/plugins/modifier.escape.php
704 /modules/iqitcompare/iqitcompare.php
705 /modules/iqitcompare/translations/fr.php
706 /modules/iqitcontactpage/iqitcontactpage.php
707 /modules/iqitcontactpage/translations/fr.php
708 /modules/iqitcookielaw/iqitcookielaw.php
709 /modules/iqitcookielaw/translations/fr.php
710 /modules/iqitcountdown/iqitcountdown.php
711 /modules/iqitcountdown/translations/fr.php
712 /modules/iqitelementor/iqitelementor.php
713 /modules/iqitelementor/src/IqitElementorLanding.php
714 /modules/iqitelementor/src/IqitElementorTemplate.php
715 /modules/iqitelementor/src/IqitElementorProduct.php
716 /modules/iqitelementor/src/IqitElementorCategory.php
717 /modules/iqitelementor/src/IqitElementorContent.php
718 /modules/iqitelementor/src/iqitElementorWpHelper.php
719 /modules/iqitelementor/includes/plugin-elementor.php
720 /modules/iqitelementor/src/widgets/IqitElementorWidget_Brands.php
721 /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsList.php
722 /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsListTabs.php
723 /modules/iqitelementor/src/widgets/IqitElementorWidget_Modules.php
724 /modules/iqitelementor/src/widgets/IqitElementorWidget_CustomTpl.php
725 /modules/iqitelementor/src/widgets/IqitElementorWidget_Menu.php
726 /modules/iqitelementor/src/widgets/IqitElementorWidget_RevolutionSlider.php
727 /modules/iqitelementor/src/widgets/IqitElementorWidget_Newsletter.php
728 /modules/iqitelementor/src/widgets/IqitElementorWidget_Blog.php
729 /modules/iqitelementor/src/widgets/IqitElementorWidget_Search.php
730 /modules/iqitelementor/src/widgets/IqitElementorWidget_Links.php
731 /modules/iqitelementor/src/widgets/IqitElementorWidget_ContactForm.php
732 /modules/iqitelementor/translations/fr.php
733 /modules/iqitfreedeliverycount/iqitfreedeliverycount.php
734 /modules/iqitfreedeliverycount/translations/fr.php
735 /modules/iqitmegamenu/iqitmegamenu.php
736 /modules/iqitmegamenu/models/IqitMenuTab.php
737 /modules/iqitmegamenu/models/IqitMenuHtml.php
738 /modules/iqitmegamenu/models/IqitMenuLinks.php
739 /modules/iqitmegamenu/translations/fr.php
740 /modules/iqitsizecharts/iqitsizecharts.php
741 /modules/iqitsizecharts/src/IqitSizeCharts.php
742 /modules/iqitsizecharts/translations/fr.php
743 /modules/iqitwishlist/iqitwishlist.php
744 /modules/iqitwishlist/src/IqitWishlistProduct.php
745 /modules/iqitwishlist/translations/fr.php
746 /modules/iqitextendedproduct/iqitextendedproduct.php
747 /modules/iqitextendedproduct/src/IqitThreeSixty.php
748 /modules/iqitextendedproduct/src/IqitProductVideo.php
749 /modules/iqitextendedproduct/translations/fr.php
750 /classes/assets/PrestashopAssetsLibraries.php
751 /modules/iqitsociallogin/iqitsociallogin.php
752 /modules/iqitsociallogin/translations/fr.php
753 /modules/gmerchantcenterpro/gmerchantcenterpro.php
754 /modules/gmerchantcenterpro/translations/fr.php
755 /modules/gmerchantcenterpro/lib/moduleTools.php
756 /modules/gmerchantcenterpro/conf/moduleConfiguration.php
757 /modules/gmerchantcenterpro/lib/moduleUpdate.php
758 /modules/gmerchantcenterpro/lib/install/installController.php
759 /modules/gmerchantcenterpro/lib/install/installSql.php
760 /modules/gmerchantcenterpro/lib/install/installInterface.php
761 /modules/gmerchantcenterpro/models/Feeds.php
762 /modules/gmerchantcenterpro/lib/hook/hookController.php
763 /modules/gmerchantcenterpro/lib/hook/hookDisplay.php
764 /modules/gmerchantcenterpro/lib/hook/hookBase.php
765 /modules/gmerchantcenterpro/lib/dao/moduleDao.php
766 /var/cache/prod/smarty/compile/warehouse/f7/5f/75/f75f75b788ebecd0995da205f357ac74693f8076_2.file.header.tpl.php
767 /modules/stripe_official/stripe_official.php
768 /modules/stripe_official/vendor/stripe/stripe-php/lib/Event.php
769 /modules/stripe_official/vendor/stripe/stripe-php/lib/ApiResource.php
770 /modules/stripe_official/vendor/stripe/stripe-php/lib/StripeObject.php
771 /modules/stripe_official/vendor/stripe/stripe-php/lib/ApiOperations/Request.php
772 /modules/stripe_official/classes/services/PrestashopTranslationService.php
773 /src/Adapter/Localization/LegacyTranslator.php
774 /modules/stripe_official/smarty/plugins/modifier.stripelreplace.php
775 /modules/stripe_official/vendor/stripe/stripe-php/lib/Stripe.php
776 /modules/stripe_official/vendor/stripe/stripe-php/lib/Util/ApiVersion.php
777 /modules/wizardai/vendor/prestashop/module-lib-service-container/src/DependencyInjection/ServiceContainer.php
778 /modules/stripe_official/classes/services/StripeDisplayHeaderService.php
779 /modules/abandonedcart/abandonedcart.php
780 /modules/abandonedcart/classes/abandonedcart_core.php
781 /modules/abandonedcart/translations/fr.php
782 /var/cache/prod/smarty/compile/warehouse/7f/09/a0/7f09a045a9b3f592faaac1a3835665419330db11_2.file.abandonedcart_front.tpl.php
783 /modules/vivawalletsmartcheckout/vivawalletsmartcheckout.php
784 /modules/vivawalletsmartcheckout/src/Helpers/Config.php
785 /modules/vivawalletsmartcheckout/config/app.php
786 /modules/vivawalletsmartcheckout/src/Helpers/General.php
787 /modules/vivawalletsmartcheckout/translations/fr.php
788 /modules/vivawalletsmartcheckout/vendor/vivawallet/vivawallet-php/lib/Application.php
789 /src/Core/Product/Search/ProductSearchContext.php
790 /src/Core/Product/Search/ProductSearchQuery.php
791 /src/Core/Product/Search/SortOrder.php
792 /modules/ps_facetedsearch/ps_facetedsearch.php
793 /modules/ps_facetedsearch/src/HookDispatcher.php
794 /modules/ps_facetedsearch/src/Hook/Attribute.php
795 /modules/ps_facetedsearch/src/Hook/AbstractHook.php
796 /modules/ps_facetedsearch/src/Hook/AttributeGroup.php
797 /modules/ps_facetedsearch/src/Hook/Category.php
798 /modules/ps_facetedsearch/src/Hook/Configuration.php
799 /modules/ps_facetedsearch/src/Hook/Design.php
800 /modules/ps_facetedsearch/src/Hook/Feature.php
801 /modules/ps_facetedsearch/src/Form/Feature/FormModifier.php
802 /modules/ps_facetedsearch/src/Form/Feature/FormDataProvider.php
803 /modules/ps_facetedsearch/src/Hook/FeatureValue.php
804 /modules/ps_facetedsearch/src/Form/FeatureValue/FormModifier.php
805 /modules/ps_facetedsearch/src/Form/FeatureValue/FormDataProvider.php
806 /modules/ps_facetedsearch/src/Hook/Product.php
807 /modules/ps_facetedsearch/src/Hook/ProductSearch.php
808 /modules/ps_facetedsearch/src/Hook/SpecificPrice.php
809 /modules/ps_facetedsearch/src/Filters/Provider.php
810 /modules/ps_facetedsearch/src/URLSerializer.php
811 /modules/ps_facetedsearch/src/Filters/DataAccessor.php
812 /modules/ps_facetedsearch/src/Product/SearchProvider.php
813 /src/Core/Product/Search/FacetsRendererInterface.php
814 /src/Core/Product/Search/ProductSearchProviderInterface.php
815 /modules/ps_facetedsearch/src/Filters/Converter.php
816 /modules/ps_facetedsearch/src/Product/SearchFactory.php
817 /src/Core/Product/Search/ProductSearchResult.php
818 /modules/ps_facetedsearch/src/Product/Search.php
819 /modules/ps_facetedsearch/src/Adapter/MySQL.php
820 /modules/ps_facetedsearch/src/Adapter/AbstractAdapter.php
821 /modules/ps_facetedsearch/src/Adapter/InterfaceAdapter.php
822 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ArrayCollection.php
823 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Collection.php
824 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ReadableCollection.php
825 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Selectable.php
826 /modules/ps_facetedsearch/src/Filters/Products.php
827 /classes/stock/StockAvailable.php
828 /modules/ps_facetedsearch/src/Filters/Block.php
829 /classes/Category.php
830 /modules/ps_facetedsearch/src/Definition/Availability.php
831 /src/Core/Product/Search/Facet.php
832 /src/Core/Product/Search/Filter.php
833 /vendor/prestashop/decimal/src/DecimalNumber.php
834 /vendor/prestashop/decimal/src/Builder.php
835 /src/Core/Product/Search/FacetCollection.php
836 /classes/ProductAssembler.php
837 /classes/Combination.php
838 /classes/tax/Tax.php
839 /classes/Manufacturer.php
840 /classes/SpecificPrice.php
841 /classes/tax/TaxManagerFactory.php
842 /classes/tax/TaxRulesTaxManager.php
843 /classes/tax/TaxManagerInterface.php
844 /classes/tax/TaxCalculator.php
845 /classes/GroupReduction.php
846 /src/Core/Localization/CLDR/ComputingPrecision.php
847 /src/Core/Localization/CLDR/ComputingPrecisionInterface.php
848 /classes/Pack.php
849 /override/classes/order/Order.php
850 /classes/order/Order.php
851 /classes/Feature.php
852 /classes/ProductPresenterFactory.php
853 /src/Adapter/Presenter/Product/ProductListingPresenter.php
854 /src/Adapter/Presenter/Product/ProductPresenter.php
855 /src/Adapter/Product/ProductColorsRetriever.php
856 /src/Adapter/HookManager.php
857 /src/Core/Product/ProductPresentationSettings.php
858 /src/Adapter/Presenter/Product/ProductListingLazyArray.php
859 /src/Adapter/Presenter/Product/ProductLazyArray.php
860 /classes/Image.php
861 /src/Core/Image/ImageFormatConfiguration.php
862 /src/Core/Image/ImageFormatConfigurationInterface.php
863 /classes/FeatureFlag.php
864 /src/Core/FeatureFlag/FeatureFlagSettings.php
865 /vendor/prestashop/decimal/src/Operation/Multiplication.php
866 /vendor/prestashop/decimal/src/Operation/Addition.php
867 /var/cache/prod/smarty/compile/warehouse/d4/1d/65/d41d65d76b9471b5d365fe06cf1737c89a53af9f_2.module.ps_facetedsearchviewstemplatesfrontcatalogfacets.tpl.php
868 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_block.php
869 /vendor/smarty/smarty/libs/plugins/modifier.count.php
870 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php
871 /var/cache/prod/smarty/compile/warehouse/fb/ea/98/fbea98a84e509d7477392fb3e2519b1e908ae1d0_2.module.ps_facetedsearchviewstemplatesfrontcatalogfacetsdropdown.tpl.php
872 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_foreach.php
873 /var/cache/prod/smarty/compile/warehouse/2e/80/73/2e807335546cfa2360c36327ac89dd2fcb054379_2.module.ps_facetedsearchviewstemplatesfrontcatalogactivefilters.tpl.php
874 /src/Core/Product/Search/Pagination.php
875 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/ed/b5/3f/edb53f222ce1fd2513bbdc5d9fc4357d962657b5_2.file.prices-drop.tpl.php
876 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/90/cf/46/90cf4679dc49439c314d4747bbab91e7cd883211_2.file.product-list.tpl.php
877 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/20/1d/59/201d594b12ddb0579e97d2d00a38f32349d7f8e2_2.file.layout-full-width.tpl.php
878 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/9f/c0/0d/9fc00de9dab18af4bad561c5978e37a5cf7ba8dc_2.file.layout-both-columns.tpl.php
879 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/cb/45/38/cb4538e80db186323bd2c849a93c3a874eb9fa44_2.file.helpers.tpl.php
880 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_tplfunction.php
881 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/a3/5d/99/a35d9996c0259409d557b9de6f17182667bd08c0_2.file.head.tpl.php
882 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/d8/66/63/d8666378896e3199131756b2a049789ce82f9145_2.file.head-jsonld.tpl.php
883 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/8e/7c/ff/8e7cff5cfb78f6670e25ee2a2964eb6ccbe1b9d5_2.file.product-list-jsonld.tpl.php
884 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/b5/08/e2/b508e285f88ade9f85c8711af34aa86844c85366_2.file.pagination-seo.tpl.php
885 /vendor/smarty/smarty/libs/plugins/modifier.replace.php
886 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/52/ed/5b/52ed5bf4088d07f918e31ad1872568dff1a15122_2.file.stylesheets.tpl.php
887 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/2a/77/40/2a7740ed942475bcc06c5e40d5346b6b574f1441_2.file.javascript.tpl.php
888 /classes/ProductDownload.php
889 /src/Core/Cart/Calculator.php
890 /src/Core/Cart/CartRowCollection.php
891 /src/Core/Cart/Fees.php
892 /src/Core/Cart/AmountImmutable.php
893 /src/Core/Cart/CartRuleCollection.php
894 /src/Core/Cart/CartRuleCalculator.php
895 /src/Adapter/Product/PriceCalculator.php
896 /src/Core/Cart/CartRow.php
897 /vendor/symfony/symfony/src/Symfony/Component/Translation/PluralizationRules.php
898 /src/Core/Util/String/StringModifier.php
899 /src/Core/Util/String/StringModifierInterface.php
900 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/05/ac/4e/05ac4e59da39afc94ba29fd4c5bed100b6b3da19_2.file.product-activation.tpl.php
901 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/05/4d/41/054d41abc5a541ea4fd30d63caa94ec106d2993b_2.file.header.tpl.php
902 /modules/iqitlinksmanager/iqitlinksmanager.php
903 /modules/iqitlinksmanager/src/IqitLinkBlockRepository.php
904 /modules/iqitlinksmanager/src/IqitLinkBlock.php
905 /modules/iqitlinksmanager/src/IqitLinkBlockPresenter.php
906 /modules/iqitlinksmanager/translations/fr.php
907 /vendor/smarty/smarty/libs/sysplugins/smarty_template_cached.php
908 /vendor/smarty/smarty/libs/sysplugins/smarty_cacheresource.php
909 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_cacheresource_file.php
910 /var/cache/prod/smarty/cache/iqitlinksmanager/1/1/1/21/displayNav1/warehouse/a9/f2/c1/a9f2c1869604c8c628073c46891a26fcf1453e27.iqitlinksmanagerviewstemplateshookiqitlinksmanager.tpl.php
911 /modules/ps_languageselector/ps_languageselector.php
912 /modules/ps_currencyselector/ps_currencyselector.php
913 /var/cache/prod/smarty/compile/warehouse/73/27/77/73277702161b17505d668b28b8368941cf42c568_2.module.iqitwishlistviewstemplateshookdisplaynav.tpl.php
914 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/03/c2/a5/03c2a55aa51a9b7d61e7f129a111606f12475287_2.file.header-3.tpl.php
915 /modules/iqitsearch/iqitsearch.php
916 /modules/iqitsearch/translations/fr.php
917 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_gettemplatevars.php
918 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/d9/9b/94/d99b947421dcff226f28b1d6cb674c91f17399db_2.module.iqitsearchviewstemplateshookiqitsearchbtn.tpl.php
919 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/46/29/db/4629dbb3c4efa13c090c633dc2e46e5f2b42bed3_2.module.iqitsearchviewstemplateshooksearchbar.tpl.php
920 /modules/ps_customersignin/ps_customersignin.php
921 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/72/be/19/72be192e406191c1cad554abe284e159adeb4234_2.module.ps_customersigninps_customersigninbtn.tpl.php
922 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/b4/a4/76/b4a476e0a8201677b298f7c0f8ca1ac698e1bac3_2.module.ps_shoppingcartps_shoppingcartbtn.tpl.php
923 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/35/65/5e/35655e6409b6198f29dd6e732ef9598dec599880_2.module.ps_shoppingcartps_shoppingcart.tpl.php
924 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/f6/e9/f2/f6e9f2b1680a466582d2199d038efe2cfa3a83f7_2.module.ps_shoppingcartps_shoppingcartcontent.tpl.php
925 /var/cache/prod/smarty/cache/iqitmegamenu/index/1/1/1/21/warehouse/70/ca/47/70ca47640f8f16a0dd1dc3b1fce177bbeed38257.iqitmegamenuviewstemplateshookhorizontal.tpl.php
926 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/ce/2d/19/ce2d19cd13f5f27943d104183b745be20e3618a6_2.file.mobile-header-1.tpl.php
927 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/7a/30/38/7a3038780284d52e9fcd7a66e51e5b86a166106b_2.module.iqitsearchviewstemplateshooksearchbarmobile.tpl.php
928 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/be/ee/e6/beeee6f3d87613010f8af1cabc4c4562f8cf600a_2.module.ps_customersigninps_customersigninmobile.tpl.php
929 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/d4/e1/57/d4e1571b6b210795247564db06deb17061778b51_2.module.ps_shoppingcartps_shoppingcartmqty.tpl.php
930 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/28/b8/a6/28b8a6fb36f22bef1e0b5c53910267c19ceae859_2.file.breadcrumb.tpl.php
931 /modules/iqitproductsnav/iqitproductsnav.php
932 /modules/iqitproductsnav/translations/fr.php
933 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/f1/e6/1e/f1e61e7ca59d67ddb45735d3ba11885aabdcd7c1_2.file.notifications.tpl.php
934 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/8f/2c/f2/8f2cf264e8ef24eff54cdc3881bd1071ff6abcc5_2.file.products-top.tpl.php
935 /vendor/smarty/smarty/libs/plugins/modifier.regex_replace.php
936 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/ca/43/26/ca432646d2c581a6631dbab0f8a0ded19562cc5d_2.file.sort-orders.tpl.php
937 /var/cache/prod/smarty/compile/warehouse/81/a1/04/81a1040ed0eeab6f58198f9907167c7fced628c5_2.module.ps_facetedsearchps_facetedsearch.tpl.php
938 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/52/57/07/52570740bcdee3193f952d35d0d11ce53ff537f4_2.file.products.tpl.php
939 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/45/91/09/4591095b1d399add495fc541674f2fceb9d0f0e3_2.file.product.tpl.php
940 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/cb/91/6c/cb916c508b6fcc743788f1d7f95631e94668cb9d_2.file.product-miniature-1.tpl.php
941 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/31/03/a9/3103a9a485af7d714612ac0c47dbcfbc05c4fd95_2.file.product-miniature-thumb.tpl.php
942 /var/cache/prod/smarty/compile/warehouse/e9/21/d5/e921d51c062189725606e51308456f33ad945843_2.module.iqitwishlistviewstemplateshookproductminiature.tpl.php
943 /var/cache/prod/smarty/compile/warehouse/90/53/a0/9053a0dd520a39bef75969a0e9efeeae750df91b_2.module.iqitcompareviewstemplateshookproductminiature.tpl.php
944 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_capture.php
945 /var/cache/prod/smarty/compile/warehouse/55/c7/a8/55c7a89f423f7f64b1b84881dcb668e4d788f013_2.module.iqitcountdownviewstemplateshookproduct.tpl.php
946 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/6c/98/2d/6c982d5090ff11db9654f1a7f6945865bc19603f_2.file.product-miniature-btn.tpl.php
947 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/8f/7a/83/8f7a832567456fbcc9b33e35ba7ca0da997b29d7_2.file.pagination.tpl.php
948 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/b1/d3/1b/b1d31b2d2e40bf3996d3350fd9793c705dd5bee6_2.file.products-bottom.tpl.php
949 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/99/9e/63/999e637a129f69005ecaa1ec5a360060ed703447_2.file.footer.tpl.php
950 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/7b/ea/10/7bea10cca96ef6b28b8f036ef026a7c11e3bde56_2.file.footer-1.tpl.php
951 /var/cache/prod/smarty/cache/iqitlinksmanager/1/1/1/21/displayFooter/warehouse/a9/f2/c1/a9f2c1869604c8c628073c46891a26fcf1453e27.iqitlinksmanagerviewstemplateshookiqitlinksmanager.tpl.php
952 /var/cache/prod/smarty/compile/warehouse/47/ac/57/47ac57039d904771d1de42366e1791900bdd2c2f_2.file.pixelheader.tpl.php
953 /vendor/smarty/smarty/libs/plugins/shared.mb_str_replace.php
954 /var/cache/prod/smarty/compile/warehouse/d5/a3/51/d5a351153329745771ab994e1aac2c50a2871ed1_2.file.pages_viewed.tpl.php
955 /var/cache/prod/smarty/compile/warehouse/e8/03/5a/e8035a8d1c12c085b510041163fece5592f47256_2.file.addtocart17.tpl.php
956 /var/cache/prod/smarty/compile/warehouse/77/34/89/773489e70d2bbbc33a3532f583f69463b9e8d34b_2.file.wishlist-iqitwishlist.tpl.php
957 /var/cache/prod/smarty/compile/warehouse/0b/1e/ae/0b1eae8b95d210de6545ab4d36ef1e0da4a2995c_2.file.newsletter.tpl.php
958 /var/cache/prod/smarty/compile/warehouse/bb/a9/2e/bba92e35e07193f35df4d88c25fef9c1ee267db4_2.file.page_time_event.tpl.php
959 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/2f/e6/59/2fe659ce5c8a3b849eecceed2fd2484c04ba6f2b_2.file.social-links.tpl.php
960 /modules/ps_emailsubscription/ps_emailsubscription.php
961 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/ca/11/75/ca1175f42cce659c415ef88a938d72e6064791dd_2.file.footer-copyrights-1.tpl.php
962 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/b2/b4/18/b2b418437d59a5c40ab3bf79b4a0534fdfc59e9d_2.file.password-policy-template.tpl.php
963 /classes/form/CustomerLoginForm.php
964 /classes/form/AbstractForm.php
965 /classes/form/FormInterface.php
966 /src/Core/Foundation/Templating/RenderableInterface.php
967 /classes/form/CustomerLoginFormatter.php
968 /classes/form/FormFormatterInterface.php
969 /classes/ValidateConstraintTranslator.php
970 /src/Core/Util/InternationalizedDomainNameConverter.php
971 /src/Core/Foundation/Templating/RenderableProxy.php
972 /var/cache/prod/smarty/compile/warehouse/52/f1/b8/52f1b8b385d74962f57df5c0ac1b0e91d62e4760_2.module.iqitwishlistviewstemplateshookdisplaymodal.tpl.php
973 /classes/form/FormField.php
974 /var/cache/prod/smarty/compile/warehouse/30/f5/ac/30f5acd1c8eb485e903c518c39df62f6dab88d7e_2.file.login-form.tpl.php
975 /var/cache/prod/smarty/compile/warehouse/21/f2/27/21f227e16d661dac3c649c0ff89b74dcf6812c75_2.file.form-errors.tpl.php
976 /var/cache/prod/smarty/compile/08/dc/b1/08dcb1adde6be40af6fcc0544d63eb4badcd22a6_2.file.form-fields.tpl.php
977 /var/cache/prod/smarty/compile/21/f2/27/21f227e16d661dac3c649c0ff89b74dcf6812c75_2.file.form-errors.tpl.php
978 /var/cache/prod/smarty/cache/iqitsociallogin/1/1/1/21/warehouse/7b/d5/c3/7bd5c305fe941e7514c4da4c50a911312eb62349.iqitsocialloginviewstemplateshookauthentication.tpl.php
979 /var/cache/prod/smarty/compile/warehouse/d4/a2/00/d4a200912ea9e133f46cf39b7eadc37ea7dd3d2f_2.module.iqitcompareviewstemplateshookdisplaymodal.tpl.php
980 /var/cache/prod/smarty/cache/iqitcookielaw/1/1/1/21/warehouse/6c/9a/c7/6c9ac7fc236180074d341c4bb3247222ad3545d0.iqitcookielawviewstemplateshookiqitcookielaw.tpl.php
981 /modules/ps_googleanalytics/classes/Hook/HookDisplayBeforeBodyClosingTag.php
982 /modules/ps_googleanalytics/classes/Handler/GanalyticsJsHandler.php
983 /modules/ps_googleanalytics/classes/Handler/GanalyticsDataHandler.php
984 /modules/ps_googleanalytics/classes/Repository/GanalyticsDataRepository.php
985 /modules/ps_googleanalytics/classes/Wrapper/ProductWrapper.php
986 /modules/ps_googleanalytics/classes/GoogleAnalyticsTools.php
987 /var/cache/prod/smarty/compile/warehouse/5c/93/46/5c93465cfee83ad9edb76aeff8896d92c35ee986_2.file.ga_tag.tpl.php