Accueil

Meubles

Promos et Ventes Flash

Inspirations

Décorations

Luminaires
Product added to wishlist
Product added to compare.

Ce site utilise des cookies provenant de Google afin de fournir ses services et d'analyser le trafic. Les informations relatives à votre utilisation du site sont partagées avec Google. En cliquant sur "Accepter", vous acceptez l'utilisation des cookies.

Load Time 701.388 ms
Querying Time 226 ms
Queries 660
Memory Peak Usage 25.9 Mb
Included Files 983 files - 13.11 Mb
PrestaShop Cache - Mb
Global vars 0.70 Mb
PrestaShop Version 8.2.0
PHP Version 8.1.34
MySQL Version 11.4.10-MariaDB
Memory Limit 4048M
Max Execution Time 600s
Smarty Cache enabled
Smarty Compilation auto
  Time Cumulated Time Memory Usage Memory Peak Usage
config 0.653 ms 0.653 ms 5.49 Mb 6.9 Mb
__construct 0.004 ms 0.657 ms - Mb 6.9 Mb
init 5.616 ms 6.273 ms 1.19 Mb 6.9 Mb
setMedia 0.618 ms 6.891 ms 0.15 Mb 6.9 Mb
postProcess 0.000 ms 6.891 ms - Mb 6.9 Mb
initHeader 0.001 ms 6.892 ms - Mb 6.9 Mb
initContent 244.112 ms 251.004 ms 11.60 Mb 18.5 Mb
initFooter 0.002 ms 251.006 ms - Mb 18.5 Mb
display 450.382 ms 701.388 ms 6.63 Mb 25.9 Mb
Hook Time Memory Usage
DisplayFooter 418.051 ms 1.01 Mb
displayProductListFunctionalButtons 4.867 ms 0.06 Mb
displayBeforeBodyClosingTag 2.766 ms 0.69 Mb
DisplayBeforeBodyClosingTag 1.354 ms 0.20 Mb
DisplayHeader 1.083 ms 0.20 Mb
displayCountDown 0.778 ms 0.09 Mb
displayNav2 0.705 ms 0.18 Mb
displayNav1 0.453 ms 0.09 Mb
displayMainMenu 0.424 ms 0.17 Mb
displayCategoryElementor 0.370 ms 0.08 Mb
displayFooter 0.327 ms 0.09 Mb
renderWidget 0.318 ms 0.09 Mb
displayCustomerLoginFormAfter 0.276 ms 0.07 Mb
IsJustElementor 0.121 ms 0.02 Mb
ProductSearchProvider 0.097 ms - Mb
ActionFrontControllerSetMedia 0.050 ms 0.01 Mb
OverrideLayoutTemplate 0.015 ms - Mb
DisplayTop 0.008 ms - Mb
ModuleRoutes 0.004 ms - Mb
ActionProductSearchAfter 0.003 ms - Mb
ActionDispatcher 0.003 ms - Mb
Header 0.001 ms - Mb
22 hook(s) 432.073 ms 3.07 Mb
Module Time Memory Usage
ph_simpleblog 2.875 ms 1.98 Mb
iqitthemeeditor 0.331 ms 0.15 Mb
ps_emailalerts 0.061 ms 0.04 Mb
facebookconversiontrackingplus 418.522 ms 1.12 Mb
revsliderprestashop 0.365 ms 0.08 Mb
ps_shoppingcart 0.046 ms 0.02 Mb
ps_googleanalytics 1.522 ms 0.32 Mb
iqitcompare 2.533 ms 0.12 Mb
iqitcontactpage 0.040 ms 0.02 Mb
iqitcookielaw 0.293 ms 0.07 Mb
iqitcountdown 0.843 ms 0.03 Mb
iqitelementor 0.650 ms 0.17 Mb
iqitfreedeliverycount 0.038 ms 0.02 Mb
iqitmegamenu 0.514 ms 0.29 Mb
iqitsizecharts 0.053 ms 0.04 Mb
iqitwishlist 5.494 ms 0.75 Mb
iqitextendedproduct 0.066 ms 0.05 Mb
iqitsociallogin 0.331 ms 0.09 Mb
gmerchantcenterpro 5.520 ms 1.18 Mb
stripe_official 0.231 ms 0.09 Mb
abandonedcart 0.229 ms 0.16 Mb
vivawalletsmartcheckout 0.132 ms - Mb
ps_facetedsearch 0.544 ms 0.14 Mb
iqitlinksmanager 0.743 ms 0.17 Mb
ps_languageselector 0.193 ms 0.13 Mb
ps_currencyselector 0.147 ms 0.06 Mb
iqitsearch 0.094 ms 0.01 Mb
ps_customersignin 0.031 ms 0.02 Mb
ps_emailsubscription 1.284 ms 0.28 Mb
29 module(s) 443.725 ms 7.57 Mb

Stopwatch SQL - 660 queries

# Query Time (ms) Rows Filesort Group By Location
169 
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value IN (159601, 232660, 148))) AND ((fp_1.id_feature_value IN (33201, 86883, 33208))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=2 AND c.nright<=659 GROUP BY p.id_product) p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) LEFT JOIN een_feature_product fp_2 ON (p.id_product = fp_2.id_product) WHERE ((sa.out_of_stock=1) OR (sa.quantity>0)) AND ((fp_1.id_feature_value IN (159601, 232660, 148))) AND ((fp_2.id_feature_value IN (33201, 86883, 33208)))
 17.098 ms 149426176 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
155 
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value IN (159601, 232660, 148))) AND ((fp_1.id_feature_value IN (33201, 86883, 33208))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=2 AND c.nright<=659 GROUP BY p.id_product) p LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value IN (159601, 232660, 148))) AND ((fp_1.id_feature_value IN (33201, 86883, 33208))) AND p.date_add>'2026-02-04 00:00:00'
 16.993 ms 74713088 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
168 
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value IN (159601, 232660, 148))) AND ((fp_1.id_feature_value IN (33201, 86883, 33208))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=2 AND c.nright<=659 GROUP BY p.id_product) p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_stock_available sa_1 ON (p.id_product = sa_1.id_product AND IFNULL(pac.id_product_attribute, 0) = sa_1.id_product_attribute AND sa_1.id_shop = 1  AND sa_1.id_shop_group = 0 ) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) LEFT JOIN een_feature_product fp_2 ON (p.id_product = fp_2.id_product) WHERE ((sa.quantity<=0 AND sa_1.out_of_stock IN (0, 2))) AND ((fp_1.id_feature_value IN (159601, 232660, 148))) AND ((fp_2.id_feature_value IN (33201, 86883, 33208)))
 16.734 ms 149426176 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
152 
SELECT SQL_NO_CACHE p.id_product FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value IN (159601, 232660, 148))) AND ((fp_1.id_feature_value IN (33201, 86883, 33208))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=2 AND c.nright<=659 GROUP BY p.id_product) p INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) GROUP BY p.id_product ORDER BY p.position ASC, p.id_product DESC
 16.555 ms 18678272 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
158 
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (33201, 86883, 33208))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=2 AND c.nright<=659 GROUP BY p.id_product) p INNER JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=10)) AND ((fp_1.id_feature_value IN (33201, 86883, 33208))) GROUP BY fp.id_feature_value
 16.477 ms 18678272 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
160 
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value IN (159601, 232660, 148))) AND ((fp_1.id_feature_value IN (33201, 86883, 33208))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=2 AND c.nright<=659 GROUP BY p.id_product) p INNER JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) LEFT JOIN een_feature_product fp_2 ON (p.id_product = fp_2.id_product) WHERE ((fp.id_feature=13)) AND ((fp_1.id_feature_value IN (159601, 232660, 148))) AND ((fp_2.id_feature_value IN (33201, 86883, 33208))) GROUP BY fp.id_feature_value
 16.266 ms 74713088 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
170 
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value IN (159601, 232660, 148))) AND ((fp_1.id_feature_value IN (33201, 86883, 33208))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=2 AND c.nright<=659 GROUP BY p.id_product) p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) LEFT JOIN een_feature_product fp_2 ON (p.id_product = fp_2.id_product) WHERE ((sa.quantity>0)) AND ((fp_1.id_feature_value IN (159601, 232660, 148))) AND ((fp_2.id_feature_value IN (33201, 86883, 33208)))
 16.217 ms 149426176 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
163 
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (159601, 232660, 148))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=2 AND c.nright<=659 GROUP BY p.id_product) p INNER JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=29)) AND ((fp_1.id_feature_value IN (159601, 232660, 148))) GROUP BY fp.id_feature_value
 15.674 ms 18678272 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
154 
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value IN (159601, 232660, 148))) AND ((fp_1.id_feature_value IN (33201, 86883, 33208))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=2 AND c.nright<=659 GROUP BY p.id_product) p LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) LEFT JOIN een_feature_product fp_2 ON (p.id_product = fp_2.id_product) WHERE ((p.on_sale=1)) AND ((fp_1.id_feature_value IN (159601, 232660, 148))) AND ((fp_2.id_feature_value IN (33201, 86883, 33208)))
 15.531 ms 74713088 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
167 
SELECT SQL_NO_CACHE cp.id_category, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value IN (159601, 232660, 148))) AND ((fp_1.id_feature_value IN (33201, 86883, 33208))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=2 AND c.nright<=659 GROUP BY p.id_product) p INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value IN (159601, 232660, 148))) AND ((fp_1.id_feature_value IN (33201, 86883, 33208))) AND cg.id_group='1' AND c.level_depth<=2 AND c.nleft>2 AND c.nright<659 GROUP BY cp.id_category
 15.521 ms 74713088 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
156 
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value IN (159601, 232660, 148))) AND ((fp_1.id_feature_value IN (33201, 86883, 33208))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=2 AND c.nright<=659 GROUP BY p.id_product) p LEFT JOIN een_specific_price sp ON (
sp.id_product = p.id_product AND 
sp.id_shop IN (0, 1) AND 
sp.id_currency IN (0, 1) AND 
sp.id_country IN (0, 21) AND 
sp.id_group IN (0, 1) AND 
sp.from_quantity = 1 AND
sp.reduction > 0 AND
sp.id_customer = 0 AND
sp.id_cart = 0 AND 
(sp.from = '0000-00-00 00:00:00' OR '2026-05-04 18:46:05' >= sp.from) AND 
(sp.to = '0000-00-00 00:00:00' OR '2026-05-04 18:46:05' <= sp.to) 
) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) LEFT JOIN een_feature_product fp_2 ON (p.id_product = fp_2.id_product) WHERE ((sp.reduction>0)) AND ((fp_1.id_feature_value IN (159601, 232660, 148))) AND ((fp_2.id_feature_value IN (33201, 86883, 33208)))
 1.593 ms 16864 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
171 
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value IN (159601, 232660, 148))) AND ((fp_1.id_feature_value IN (33201, 86883, 33208))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=2 AND c.nright<=659 GROUP BY p.id_product) p INNER JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) LEFT JOIN een_feature_product fp_2 ON (p.id_product = fp_2.id_product) WHERE ((fp.id_feature=17)) AND ((fp_1.id_feature_value IN (159601, 232660, 148))) AND ((fp_2.id_feature_value IN (33201, 86883, 33208))) GROUP BY fp.id_feature_value
 1.506 ms 18144 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
157 
SELECT SQL_NO_CACHE psi.price_min, MIN(price_min) as min, MAX(price_max) as max FROM een_product p INNER JOIN een_layered_price_index psi ON (psi.id_product = p.id_product AND psi.id_shop = 1 AND psi.id_currency = 1 AND psi.id_country = 21) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value IN (159601, 232660, 148))) AND ((fp_1.id_feature_value IN (33201, 86883, 33208))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=2 AND c.nright<=659
 1.363 ms 6112 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
3 
SELECT SQL_NO_CACHE c.`name`, cl.`id_lang`, IF(cl.`id_lang` IS NULL, c.`value`, cl.`value`) AS value, c.id_shop_group, c.id_shop
FROM `een_configuration` c
LEFT JOIN `een_configuration_lang` cl ON (c.`id_configuration` = cl.`id_configuration`)
 1.093 ms 1696 /classes/Configuration.php:180
161 
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value IN (159601, 232660, 148))) AND ((fp_1.id_feature_value IN (33201, 86883, 33208))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=2 AND c.nright<=659 GROUP BY p.id_product) p INNER JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) LEFT JOIN een_feature_product fp_2 ON (p.id_product = fp_2.id_product) WHERE ((fp.id_feature=20)) AND ((fp_1.id_feature_value IN (159601, 232660, 148))) AND ((fp_2.id_feature_value IN (33201, 86883, 33208))) GROUP BY fp.id_feature_value
 1.080 ms 8832 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
642 
SELECT SQL_NO_CACHE id_category, id_parent, level_depth, name, is_root_category, active FROM een_category LEFT JOIN een_category_lang AS cl USING (id_category) LEFT JOIN een_category_shop AS cs USING (id_category) WHERE cs.id_shop = 1 AND cl.id_lang = 1 ORDER BY `een_category`.`id_parent` ASC, `een_category`.`id_category` ASC
 0.767 ms 329 Yes /modules/facebookconversiontrackingplus/facebookconversiontrackingplus.php:2945
188 
SELECT SQL_NO_CACHE `id_hook`, `name`
FROM `een_hook`
UNION
SELECT `id_hook`, ha.`alias` as name
FROM `een_hook_alias` ha
INNER JOIN `een_hook` h ON ha.name = h.name
 0.594 ms 0 /classes/Hook.php:1326
14 
SELECT SQL_NO_CACHE h.`name` as hook, m.`id_module`, h.`id_hook`, m.`name` as module
FROM `een_module` m
INNER JOIN een_module_shop module_shop
ON (module_shop.id_module = m.id_module AND module_shop.id_shop = 1 AND module_shop.enable_device & 1)
INNER JOIN `een_hook_module` `hm` ON hm.`id_module` = m.`id_module`
INNER JOIN `een_hook` `h` ON hm.`id_hook` = h.`id_hook`
LEFT JOIN `een_module_group` `mg` ON mg.`id_module` = m.`id_module`
WHERE (h.`name` != "paymentOptions") AND (hm.`id_shop` = 1) AND (mg.id_shop = 1 AND  mg.`id_group` IN (1))
GROUP BY hm.id_hook, hm.id_module
ORDER BY hm.`position`
 0.583 ms 310 Yes Yes /classes/Hook.php:1267
165 
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value IN (159601, 232660, 148))) AND ((fp_1.id_feature_value IN (33201, 86883, 33208))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=2 AND c.nright<=659 GROUP BY p.id_product) p INNER JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) LEFT JOIN een_feature_product fp_2 ON (p.id_product = fp_2.id_product) WHERE ((fp.id_feature=34)) AND ((fp_1.id_feature_value IN (159601, 232660, 148))) AND ((fp_2.id_feature_value IN (33201, 86883, 33208))) GROUP BY fp.id_feature_value
 0.545 ms 896 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
189 
SELECT SQL_NO_CACHE h.id_hook, h.name as h_name, title, description, h.position, hm.position as hm_position, m.id_module, m.name, m.active
FROM `een_hook_module` hm
STRAIGHT_JOIN `een_hook` h ON (h.id_hook = hm.id_hook AND hm.id_shop = 1)
STRAIGHT_JOIN `een_module` as m ON (m.id_module = hm.id_module)
ORDER BY hm.position
 0.539 ms 487 /classes/Hook.php:456
173 
SELECT SQL_NO_CACHE p.*,
ps.*,
pl.*,
sa.out_of_stock,
IFNULL(sa.quantity, 0) as quantity,
(DATEDIFF(
p.`date_add`,
DATE_SUB(
'2026-05-04 00:00:00',
INTERVAL 90 DAY
)
) > 0) as new
FROM een_product p
LEFT JOIN een_product_lang pl
ON pl.id_product = p.id_product
AND pl.id_shop = 1
AND pl.id_lang = 1
LEFT JOIN een_stock_available sa   ON sa.id_product = p.id_product
AND sa.id_product_attribute = 0
AND sa.id_shop = 1 LEFT JOIN een_product_shop ps
ON ps.id_product = p.id_product
AND ps.id_shop = 1
WHERE p.id_product IN (40039,40018,36978,30970,30658,30571,13137,4319,641723,615879,615819,609519,607485,598594,589384,580689,579017,567844,565075,552215,547001,545729,545554,544260,542487,542329,13135,13136,604308)
 0.533 ms 29 /classes/ProductAssembler.php:95
659 
SELECT SQL_NO_CACHE cp.`id_category`, cp.`id_product`, cl.`name` FROM `een_category_product` cp
LEFT JOIN `een_category` c ON (c.id_category = cp.id_category)
LEFT JOIN `een_category_lang` cl ON (cp.`id_category` = cl.`id_category` AND cl.id_shop = 1 )
INNER JOIN een_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
WHERE cp.`id_product` IN (40039,40018,36978,30970,30658,30571,13137,4319,641723,615879,615819,609519,607485,598594,589384,580689,579017,567844,565075,552215,547001,545729,545554,544260,542487,542329,13135,13136,604308) AND cl.`id_lang` = 1
ORDER BY c.`level_depth` DESC
 0.490 ms 71 Yes /modules/ps_googleanalytics/classes/Wrapper/ProductWrapper.php:109
42 
SELECT SQL_NO_CACHE c.*, cl.`id_lang`, cl.`name`, cl.`description`, cl.`additional_description`, cl.`link_rewrite`, cl.`meta_title`, cl.`meta_keywords`, cl.`meta_description`
FROM `een_category` c
INNER JOIN een_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `een_category_lang` cl ON (c.`id_category` = cl.`id_category` AND `id_lang` = 1  AND cl.id_shop = 1 )
LEFT JOIN `een_category_group` cg ON (cg.`id_category` = c.`id_category`)
WHERE `id_parent` = 2
AND `active` = 1
AND cg.`id_group` =1
GROUP BY c.`id_category`
ORDER BY `level_depth` ASC, category_shop.`position` ASC
 0.381 ms 12 Yes Yes /classes/Category.php:924
166 
SELECT SQL_NO_CACHE c.`id_category`, cl.`name`
FROM `een_category` c
INNER JOIN een_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `een_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
ORDER BY c.nleft, c.position
 0.348 ms 330 Yes /classes/Category.php:724
108 
SELECT SQL_NO_CACHE *
FROM `een_gmcp_feeds` ff
WHERE (ff.id_shop=1)
ORDER BY ff.feed_is_default ASC
 0.304 ms 370 Yes /modules/gmerchantcenterpro/models/Feeds.php:62
521 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 598594) AND (b.`id_shop` = 1) LIMIT 1
 0.294 ms 1 /src/Adapter/EntityMapper.php:71
13 
SELECT SQL_NO_CACHE lower(name) as name
FROM `een_hook` h
WHERE (h.active = 1)
 0.253 ms 1060 /classes/Hook.php:1366
65 
SHOW TABLES LIKE "een_gmcp_1800"
 0.224 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:88
148 
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `een_feature_value` v LEFT JOIN `een_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `een_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 10 ORDER BY vl.`value` ASC
 0.224 ms 37 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
159 
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `een_feature_value` v LEFT JOIN `een_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `een_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 10 ORDER BY vl.`value` ASC
 0.223 ms 37 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
164 
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `een_feature_value` v LEFT JOIN `een_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `een_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 29 ORDER BY vl.`value` ASC
 0.218 ms 40 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
596 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (40039) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.210 ms 1 Yes Yes /classes/Product.php:4524
103 
SHOW COLUMNS FROM een_gmcp_feeds LIKE "feed_is_default"
 0.209 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:128
641 
SELECT SQL_NO_CACHE product_id as id_product, COUNT(product_id) AS sales
FROM `een_order_detail`
WHERE product_id IN (
SELECT id_product
FROM `een_category_product`
LEFT JOIN een_product USING (id_product)
WHERE id_category = 2
AND active = 1
)
GROUP BY product_id
ORDER BY sales DESC LIMIT 5
 0.206 ms 36 Yes /modules/facebookconversiontrackingplus/facebookconversiontrackingplus.php:2918
72 
SHOW TABLES LIKE "een_gmcp_1900"
 0.205 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:88
419 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 545554 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 545554 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.204 ms 0 /classes/Cart.php:1430
149 
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `een_feature_value` v LEFT JOIN `een_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `een_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 29 ORDER BY vl.`value` ASC
 0.202 ms 40 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
172 
REPLACE INTO een_layered_filter_block (hash, data) VALUES ("b4683c742914bd7e84f84f0bfb3e3a25", "a:1:{s:7:\"filters\";a:7:{i:0;a:7:{s:9:\"type_lite\";s:6:\"extras\";s:4:\"type\";s:6:\"extras\";s:6:\"id_key\";i:0;s:4:\"name\";s:10:\"Selections\";s:6:\"values\";a:3:{s:4:\"sale\";a:2:{s:4:\"name\";s:8:\"En promo\";s:3:\"nbr\";i:0;}s:3:\"new\";a:2:{s:4:\"name\";s:15:\"Nouveau produit\";s:3:\"nbr\";i:0;}s:8:\"discount\";a:2:{s:4:\"name\";s:8:\"En promo\";s:3:\"nbr\";i:9;}}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";s:1:\"0\";}i:1;a:12:{s:9:\"type_lite\";s:5:\"price\";s:4:\"type\";s:5:\"price\";s:6:\"id_key\";i:0;s:4:\"name\";s:4:\"Prix\";s:3:\"max\";d:0;s:3:\"min\";d:0;s:4:\"unit\";s:3:\"€\";s:14:\"specifications\";a:11:{s:6:\"symbol\";a:11:{i:0;s:1:\",\";i:1;s:3:\" \";i:2;s:1:\";\";i:3;s:1:\"%\";i:4;s:1:\"-\";i:5;s:1:\"+\";i:6;s:1:\"E\";i:7;s:2:\"×\";i:8;s:3:\"‰\";i:9;s:3:\"∞\";i:10;s:3:\"NaN\";}s:12:\"currencyCode\";s:3:\"EUR\";s:14:\"currencySymbol\";s:3:\"€\";s:13:\"numberSymbols\";a:11:{i:0;s:1:\",\";i:1;s:3:\" \";i:2;s:1:\";\";i:3;s:1:\"%\";i:4;s:1:\"-\";i:5;s:1:\"+\";i:6;s:1:\"E\";i:7;s:2:\"×\";i:8;s:3:\"‰\";i:9;s:3:\"∞\";i:10;s:3:\"NaN\";}s:15:\"positivePattern\";s:12:\"#,##0.00 ¤\";s:15:\"negativePattern\";s:13:\"-#,##0.00 ¤\";s:17:\"maxFractionDigits\";i:2;s:17:\"minFractionDigits\";i:2;s:12:\"groupingUsed\";b:1;s:16:\"primaryGroupSize\";i:3;s:18:\"secondaryGroupSize\";i:3;}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:3;s:3:\"nbr\";i:29;s:5:\"value\";N;}i:2;a:9:{s:9:\"type_lite\";s:10:\"id_feature\";s:4:\"type\";s:10:\"id_feature\";s:6:\"id_key\";s:2:\"10\";s:6:\"values\";a:10:{i:67745;a:4:{s:3:\"nbr\";s:1:\"1\";s:4:\"name\";s:9:\"Aluminium\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:151;a:4:{s:3:\"nbr\";s:2:\"37\";s:4:\"name\";s:11:\"Bois massif\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:146;a:4:{s:3:\"nbr\";s:2:\"44\";s:4:\"name\";s:17:\"Dérivés du bois\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:150;a:4:{s:3:\"nbr\";s:1:\"8\";s:4:\"name\";s:6:\"Métal\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:81988;a:4:{s:3:\"nbr\";s:1:\"9\";s:4:\"name\";s:10:\"Pin massif\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:751261;a:4:{s:3:\"nbr\";s:1:\"1\";s:4:\"name\";s:62:\"Plateau : marbre coulé poli Structure / pied : métal brossé\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:159601;a:5:{s:3:\"nbr\";s:1:\"7\";s:4:\"name\";s:6:\"Simili\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:7:\"checked\";b:1;}i:143;a:4:{s:3:\"nbr\";s:2:\"12\";s:4:\"name\";s:5:\"Tissu\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:232660;a:5:{s:3:\"nbr\";s:2:\"16\";s:4:\"name\";s:7:\"Velours\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:7:\"checked\";b:1;}i:148;a:5:{s:3:\"nbr\";s:1:\"6\";s:4:\"name\";s:5:\"Verre\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:7:\"checked\";b:1;}}s:4:\"name\";s:8:\"Matière\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";s:1:\"0\";}i:3;a:9:{s:9:\"type_lite\";s:10:\"id_feature\";s:4:\"type\";s:10:\"id_feature\";s:6:\"id_key\";s:2:\"20\";s:6:\"values\";a:1:{i:526;a:4:{s:3:\"nbr\";s:1:\"3\";s:4:\"name\";s:13:\"Rectangulaire\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}}s:4:\"name\";s:5:\"Forme\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";s:1:\"0\";}i:4;a:9:{s:9:\"type_lite\";s:10:\"id_feature\";s:4:\"type\";s:10:\"id_feature\";s:6:\"id_key\";s:2:\"29\";s:6:\"values\";a:11:{i:55029;a:4:{s:3:\"nbr\";s:1:\"1\";s:4:\"name\";s:11:\"Anthracite \";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:33207;a:4:{s:3:\"nbr\";s:1:\"1\";s:4:\"name\";s:5:\"Beige\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:33201;a:5:{s:3:\"nbr\";s:2:\"14\";s:4:\"name\";s:5:\"Blanc\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:7:\"checked\";b:1;}i:33206;a:4:{s:3:\"nbr\";s:1:\"8\";s:4:\"name\";s:4:\"Bleu\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:86884;a:4:{s:3:\"nbr\";s:1:\"6\";s:4:\"name\";s:6:\"Crème\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:33210;a:4:{s:3:\"nbr\";s:1:\"7\";s:4:\"name\";s:5:\"Jaune\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:33204;a:4:{s:3:\"nbr\";s:2:\"68\";s:4:\"name\";s:4:\"Noir\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:33205;a:4:{s:3:\"nbr\";s:1:\"3\";s:4:\"name\";s:4:\"Rose\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:33209;a:4:{s:3:\"nbr\";s:1:\"5\";s:4:\"name\";s:5:\"Rouge\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:86883;a:5:{s:3:\"nbr\";s:1:\"3\";s:4:\"name\";s:6:\"Taupe \";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:7:\"checked\";b:1;}i:33208;a:5:{s:3:\"nbr\";s:2:\"12\";s:4:\"name\";s:4:\"Vert\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:7:\"checked\";b:1;}}s:4:\"name\";s:7:\"Couleur\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";s:1:\"0\";}i:5;a:7:{s:9:\"type_lite\";s:8:\"category\";s:4:\"type\";s:8:\"category\";s:6:\"id_key\";i:0;s:4:\"name\";s:11:\"Catégories\";s:6:\"values\";a:2:{i:1000;a:2:{s:4:\"name\";s:7:\"Meubles\";s:3:\"nbr\";s:1:\"1\";}i:5757;a:2:{s:4:\"name\";s:10:\"Luminaires\";s:3:\"nbr\";s:1:\"1\";}}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";s:1:\"0\";}i:6;a:7:{s:9:\"type_lite\";s:12:\"availability\";s:4:\"type\";s:12:\"availability\";s:6:\"id_key\";i:0;s:4:\"name\";s:14:\"Disponibilité\";s:6:\"values\";a:2:{i:2;a:2:{s:4:\"name\";s:8:\"En stock\";s:3:\"nbr\";i:28;}i:0;a:2:{s:4:\"name\";s:14:\"Non disponible\";s:3:\"nbr\";i:1;}}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";s:1:\"0\";}}}")
 0.200 ms 1 /modules/ps_facetedsearch/src/Filters/Block.php:211
597 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (40018) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.199 ms 1 Yes Yes /classes/Product.php:4524
147 
SELECT SQL_NO_CACHE DISTINCT f.id_feature, f.*, fl.*, IF(liflv.`url_name` IS NULL OR liflv.`url_name` = "", NULL, liflv.`url_name`) AS url_name, IF(liflv.`meta_title` IS NULL OR liflv.`meta_title` = "", NULL, liflv.`meta_title`) AS meta_title, lif.indexable FROM `een_feature` f  INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1) LEFT JOIN `een_feature_lang` fl ON (f.`id_feature` = fl.`id_feature` AND fl.`id_lang` = 1) LEFT JOIN `een_layered_indexable_feature` lif ON (f.`id_feature` = lif.`id_feature`) LEFT JOIN `een_layered_indexable_feature_lang_value` liflv ON (f.`id_feature` = liflv.`id_feature` AND liflv.`id_lang` = 1) ORDER BY f.`position` ASC
 0.196 ms 29 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:171
605 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (615879) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.194 ms 1 Yes Yes /classes/Product.php:4524
104 
SHOW COLUMNS FROM een_gmcp_discount_association LIKE "channel"
 0.193 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:128
603 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4319) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.193 ms 1 Yes Yes /classes/Product.php:4524
288 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 641723 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 641723 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.188 ms 0 /classes/Cart.php:1430
410 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 545729 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 545729 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.188 ms 0 /classes/Cart.php:1430
20 
SELECT SQL_NO_CACHE m.page, ml.url_rewrite, ml.id_lang
FROM `een_meta` m
LEFT JOIN `een_meta_lang` ml ON (m.id_meta = ml.id_meta AND ml.id_shop = 1 )
ORDER BY LENGTH(ml.url_rewrite) DESC
 0.187 ms 66 Yes /classes/Dispatcher.php:654
105 
SHOW COLUMNS FROM een_gmcp_tags LIKE "custom_label_set_postion"
 0.187 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:128
202 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 40018 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.186 ms 1 Yes /classes/SpecificPrice.php:576
298 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 615879 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 615879 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.186 ms 0 /classes/Cart.php:1430
420 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 545554
ORDER BY f.position ASC
 0.185 ms 5 Yes /classes/Product.php:6021
16 
SELECT SQL_NO_CACHE `id_hook`, `name` FROM `een_hook`
 0.184 ms 1060 /classes/Hook.php:1326
162 
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `een_feature_value` v LEFT JOIN `een_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `een_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 20 ORDER BY vl.`value` ASC
 0.184 ms 9 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
411 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 545729
ORDER BY f.position ASC
 0.182 ms 5 Yes /classes/Product.php:6021
428 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 544260 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 544260 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.179 ms 0 /classes/Cart.php:1430
651 
SELECT SQL_NO_CACHE product_id as id_product, COUNT(product_id) AS sales
FROM `een_order_detail`
WHERE product_id IN (
SELECT id_product
FROM `een_category_product`
LEFT JOIN een_product USING (id_product)
WHERE id_category = 2
AND active = 1
)
GROUP BY product_id
ORDER BY sales DESC LIMIT 5
 0.177 ms 36 Yes /modules/facebookconversiontrackingplus/facebookconversiontrackingplus.php:2918
267 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 13137
ORDER BY f.position ASC
 0.174 ms 7 Yes /classes/Product.php:6021
363 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 579017 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 579017 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.172 ms 0 /classes/Cart.php:1430
598 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (36978) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.172 ms 1 Yes Yes /classes/Product.php:4524
195 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 40039 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 40039 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.169 ms 0 /classes/Cart.php:1430
429 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 544260
ORDER BY f.position ASC
 0.169 ms 6 Yes /classes/Product.php:6021
307 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 615819 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 615819 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.167 ms 0 /classes/Cart.php:1430
604 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (641723) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.167 ms 1 Yes Yes /classes/Product.php:4524
383 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 565075 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 565075 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.166 ms 0 /classes/Cart.php:1430
454 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 13135 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.166 ms 1 Yes /classes/SpecificPrice.php:576
185 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 40039 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 2 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.166 ms 1 Yes /classes/SpecificPrice.php:576
317 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 609519 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 609519 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.166 ms 0 /classes/Cart.php:1430
606 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (615819) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.166 ms 1 Yes Yes /classes/Product.php:4524
471 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 13136
ORDER BY f.position ASC
 0.165 ms 7 Yes /classes/Product.php:6021
181 
SELECT SQL_NO_CACHE DISTINCT `id_product` FROM `een_specific_price` WHERE `id_product` != 0
 0.162 ms 527 /classes/SpecificPrice.php:310
470 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 13136 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 13136 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.161 ms 0 /classes/Cart.php:1430
299 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 615879
ORDER BY f.position ASC
 0.160 ms 2 Yes /classes/Product.php:6021
600 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (30658) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.160 ms 1 Yes Yes /classes/Product.php:4524
602 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (13137) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.160 ms 1 Yes Yes /classes/Product.php:4524
623 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (13136) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.160 ms 1 Yes Yes /classes/Product.php:4524
459 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 13135 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 13135 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.159 ms 0 /classes/Cart.php:1430
560 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 13135) AND (b.`id_shop` = 1) LIMIT 1
 0.158 ms 1 /src/Adapter/EntityMapper.php:71
601 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (30571) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.158 ms 1 Yes Yes /classes/Product.php:4524
373 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 567844 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 567844 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.157 ms 0 /classes/Cart.php:1430
599 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (30970) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.157 ms 1 Yes Yes /classes/Product.php:4524
448 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 542329
ORDER BY f.position ASC
 0.157 ms 7 Yes /classes/Product.php:6021
607 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (609519) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.157 ms 1 Yes Yes /classes/Product.php:4524
207 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 40018 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 40018 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.156 ms 0 /classes/Cart.php:1430
196 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 40039
ORDER BY f.position ASC
 0.155 ms 2 Yes /classes/Product.php:6021
289 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 641723
ORDER BY f.position ASC
 0.155 ms 2 Yes /classes/Product.php:6021
402 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 547001
ORDER BY f.position ASC
 0.155 ms 6 Yes /classes/Product.php:6021
624 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (604308) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.155 ms 1 Yes Yes /classes/Product.php:4524
518 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 607485) AND (b.`id_shop` = 1) LIMIT 1
 0.154 ms 1 /src/Adapter/EntityMapper.php:71
481 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 40039) AND (b.`id_shop` = 1) LIMIT 1
 0.153 ms 1 /src/Adapter/EntityMapper.php:71
545 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 545729) AND (b.`id_shop` = 1) LIMIT 1
 0.153 ms 1 /src/Adapter/EntityMapper.php:71
622 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (13135) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.153 ms 1 Yes Yes /classes/Product.php:4524
465 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 13136 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.153 ms 1 Yes /classes/SpecificPrice.php:576
573 
SELECT SQL_NO_CACHE * FROM `een_cart_rule` cr
LEFT JOIN `een_cart_rule_lang` crl 
ON (cr.`id_cart_rule` = crl.`id_cart_rule` AND crl.`id_lang` = 0) WHERE (cr.`id_customer` = 0) AND NOW() BETWEEN cr.date_from AND cr.date_to
AND cr.`active` = 1
AND cr.`quantity` > 0 AND highlight = 1 AND code NOT LIKE "BO_ORDER_%"
 0.152 ms 1 /classes/CartRule.php:423
612 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (579017) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.152 ms 1 Yes Yes /classes/Product.php:4524
460 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 13135
ORDER BY f.position ASC
 0.151 ms 7 Yes /classes/Product.php:6021
548 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 545554) AND (b.`id_shop` = 1) LIMIT 1
 0.151 ms 1 /src/Adapter/EntityMapper.php:71
308 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 615819
ORDER BY f.position ASC
 0.150 ms 2 Yes /classes/Product.php:6021
617 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (545729) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.150 ms 1 Yes Yes /classes/Product.php:4524
608 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (607485) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.150 ms 1 Yes Yes /classes/Product.php:4524
609 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (598594) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.149 ms 1 Yes Yes /classes/Product.php:4524
613 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (567844) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.149 ms 1 Yes Yes /classes/Product.php:4524
208 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 40018
ORDER BY f.position ASC
 0.148 ms 2 Yes /classes/Product.php:6021
318 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 609519
ORDER BY f.position ASC
 0.148 ms 2 Yes /classes/Product.php:6021
611 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (580689) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.148 ms 1 Yes Yes /classes/Product.php:4524
615 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (552215) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.148 ms 1 Yes Yes /classes/Product.php:4524
566 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 604308) AND (b.`id_shop` = 1) LIMIT 1
 0.148 ms 1 /src/Adapter/EntityMapper.php:71
567 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 604308
ORDER BY `position`
 0.148 ms 10 Yes /classes/Product.php:3545
571 
SELECT SQL_NO_CACHE * FROM `een_cart_rule` cr
LEFT JOIN `een_cart_rule_lang` crl 
ON (cr.`id_cart_rule` = crl.`id_cart_rule` AND crl.`id_lang` = 1) WHERE (cr.`id_customer` = 0) AND NOW() BETWEEN cr.date_from AND cr.date_to
AND cr.`active` = 1
AND free_shipping = 1 AND carrier_restriction = 1
 0.147 ms 1 /classes/CartRule.php:423
610 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (589384) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.147 ms 1 Yes Yes /classes/Product.php:4524
620 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (542487) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.147 ms 1 Yes Yes /classes/Product.php:4524
536 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 565075) AND (b.`id_shop` = 1) LIMIT 1
 0.146 ms 1 /src/Adapter/EntityMapper.php:71
214 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 36978 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.146 ms 1 Yes /classes/SpecificPrice.php:576
279 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4319
ORDER BY f.position ASC
 0.146 ms 10 Yes /classes/Product.php:6021
525 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 589384
ORDER BY `position`
 0.146 ms 7 Yes /classes/Product.php:3545
539 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 552215) AND (b.`id_shop` = 1) LIMIT 1
 0.146 ms 1 /src/Adapter/EntityMapper.php:71
515 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 609519) AND (b.`id_shop` = 1) LIMIT 1
 0.145 ms 1 /src/Adapter/EntityMapper.php:71
530 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 579017) AND (b.`id_shop` = 1) LIMIT 1
 0.145 ms 1 /src/Adapter/EntityMapper.php:71
392 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 552215 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 552215 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.144 ms 0 /classes/Cart.php:1430
522 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 598594
ORDER BY `position`
 0.144 ms 8 Yes /classes/Product.php:3545
531 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 579017
ORDER BY `position`
 0.144 ms 10 Yes /classes/Product.php:3545
614 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (565075) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.144 ms 1 Yes Yes /classes/Product.php:4524
621 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (542329) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.144 ms 1 Yes Yes /classes/Product.php:4524
447 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 542329 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 542329 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.143 ms 0 /classes/Cart.php:1430
485 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 40018) AND (b.`id_shop` = 1) LIMIT 1
 0.143 ms 1 /src/Adapter/EntityMapper.php:71
563 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 13136) AND (b.`id_shop` = 1) LIMIT 1
 0.143 ms 1 /src/Adapter/EntityMapper.php:71
616 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (547001) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.143 ms 1 Yes Yes /classes/Product.php:4524
273 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 4319 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.141 ms 1 Yes /classes/SpecificPrice.php:576
509 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 615879) AND (b.`id_shop` = 1) LIMIT 1
 0.141 ms 1 /src/Adapter/EntityMapper.php:71
24 
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `een_module` m
LEFT JOIN `een_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
 0.140 ms 104 /classes/module/Module.php:346
219 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 36978 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 36978 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.140 ms 0 /classes/Cart.php:1430
227 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 30970 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.140 ms 1 Yes /classes/SpecificPrice.php:576
479 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 604308 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 604308 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.140 ms 0 /classes/Cart.php:1430
239 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 30658 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.139 ms 1 Yes /classes/SpecificPrice.php:576
261 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 13137 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.139 ms 1 Yes /classes/SpecificPrice.php:576
326 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 607485 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 607485 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.139 ms 0 /classes/Cart.php:1430
534 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 567844
ORDER BY `position`
 0.139 ms 8 Yes /classes/Product.php:3545
364 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 579017
ORDER BY f.position ASC
 0.138 ms 2 Yes /classes/Product.php:6021
384 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 565075
ORDER BY f.position ASC
 0.138 ms 3 Yes /classes/Product.php:6021
438 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 542487 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 542487 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.138 ms 0 /classes/Cart.php:1430
564 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 13136
ORDER BY `position`
 0.138 ms 5 Yes /classes/Product.php:3545
232 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 30970 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 30970 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.137 ms 0 /classes/Cart.php:1430
439 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 542487
ORDER BY f.position ASC
 0.137 ms 7 Yes /classes/Product.php:6021
533 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 567844) AND (b.`id_shop` = 1) LIMIT 1
 0.137 ms 1 /src/Adapter/EntityMapper.php:71
278 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4319 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4319 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.137 ms 0 /classes/Cart.php:1430
335 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 598594 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 598594 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.136 ms 0 /classes/Cart.php:1430
542 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 547001) AND (b.`id_shop` = 1) LIMIT 1
 0.136 ms 1 /src/Adapter/EntityMapper.php:71
551 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 544260) AND (b.`id_shop` = 1) LIMIT 1
 0.136 ms 1 /src/Adapter/EntityMapper.php:71
557 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 542329) AND (b.`id_shop` = 1) LIMIT 1
 0.135 ms 1 /src/Adapter/EntityMapper.php:71
245 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 30658 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 30658 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.135 ms 0 /classes/Cart.php:1430
254 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 30571 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 30571 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.135 ms 0 /classes/Cart.php:1430
374 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 567844
ORDER BY f.position ASC
 0.135 ms 2 Yes /classes/Product.php:6021
549 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 545554
ORDER BY `position`
 0.135 ms 8 Yes /classes/Product.php:3545
554 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 542487) AND (b.`id_shop` = 1) LIMIT 1
 0.135 ms 1 /src/Adapter/EntityMapper.php:71
570 
SELECT SQL_NO_CACHE 1 FROM `een_cart_rule` WHERE ((date_to >= "2026-05-04 00:00:00" AND date_to <= "2026-05-04 23:59:59") OR (date_from >= "2026-05-04 00:00:00" AND date_from <= "2026-05-04 23:59:59") OR (date_from < "2026-05-04 00:00:00" AND date_to > "2026-05-04 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
 0.134 ms 2 /classes/CartRule.php:357
18 
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `een_module` m
LEFT JOIN `een_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
 0.133 ms 104 /classes/module/Module.php:346
266 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 13137 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 13137 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.133 ms 0 /classes/Cart.php:1430
345 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 589384 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 589384 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.133 ms 0 /classes/Cart.php:1430
552 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 544260
ORDER BY `position`
 0.133 ms 8 Yes /classes/Product.php:3545
401 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 547001 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 547001 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.132 ms 0 /classes/Cart.php:1430
480 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 604308
ORDER BY f.position ASC
 0.132 ms 2 Yes /classes/Product.php:6021
2 
SELECT SQL_NO_CACHE gs.*, s.*, gs.name AS group_name, s.name AS shop_name, s.active, su.domain, su.domain_ssl, su.physical_uri, su.virtual_uri
FROM een_shop_group gs
LEFT JOIN een_shop s
ON s.id_shop_group = gs.id_shop_group
LEFT JOIN een_shop_url su
ON s.id_shop = su.id_shop AND su.main = 1
WHERE s.deleted = 0
AND gs.deleted = 0
ORDER BY gs.name, s.name
 0.132 ms 1 Yes /classes/shop/Shop.php:715
403 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 545729
AND image_shop.`cover` = 1 LIMIT 1
 0.132 ms 7 /classes/Product.php:3570
327 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 607485
ORDER BY f.position ASC
 0.131 ms 3 Yes /classes/Product.php:6021
558 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 542329
ORDER BY `position`
 0.131 ms 9 Yes /classes/Product.php:3545
354 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 580689 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 580689 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.131 ms 0 /classes/Cart.php:1430
519 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 607485
ORDER BY `position`
 0.131 ms 6 Yes /classes/Product.php:3545
543 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 547001
ORDER BY `position`
 0.130 ms 8 Yes /classes/Product.php:3545
346 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 589384
ORDER BY f.position ASC
 0.128 ms 2 Yes /classes/Product.php:6021
482 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 40039
ORDER BY `position`
 0.128 ms 8 Yes /classes/Product.php:3545
524 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 589384) AND (b.`id_shop` = 1) LIMIT 1
 0.128 ms 1 /src/Adapter/EntityMapper.php:71
619 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (544260) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.128 ms 1 Yes Yes /classes/Product.php:4524
491 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 30970) AND (b.`id_shop` = 1) LIMIT 1
 0.126 ms 1 /src/Adapter/EntityMapper.php:71
500 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 13137) AND (b.`id_shop` = 1) LIMIT 1
 0.126 ms 1 /src/Adapter/EntityMapper.php:71
220 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 36978
ORDER BY f.position ASC
 0.125 ms 2 Yes /classes/Product.php:6021
488 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 36978) AND (b.`id_shop` = 1) LIMIT 1
 0.124 ms 1 /src/Adapter/EntityMapper.php:71
618 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (545554) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.124 ms 1 Yes Yes /classes/Product.php:4524
1 
SELECT SQL_NO_CACHE s.id_shop, CONCAT(su.physical_uri, su.virtual_uri) AS uri, su.domain, su.main
FROM een_shop_url su
LEFT JOIN een_shop s ON (s.id_shop = su.id_shop)
WHERE (su.domain = 'decozzia.com' OR su.domain_ssl = 'decozzia.com')
AND s.active = 1
AND s.deleted = 0
ORDER BY LENGTH(CONCAT(su.physical_uri, su.virtual_uri)) DESC
 0.123 ms 1 Yes /classes/shop/Shop.php:1364
233 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 30970
ORDER BY f.position ASC
 0.123 ms 2 Yes /classes/Product.php:6021
393 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 552215
ORDER BY f.position ASC
 0.123 ms 2 Yes /classes/Product.php:6021
512 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 615819) AND (b.`id_shop` = 1) LIMIT 1
 0.123 ms 1 /src/Adapter/EntityMapper.php:71
246 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 30658
ORDER BY f.position ASC
 0.121 ms 2 Yes /classes/Product.php:6021
516 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 609519
ORDER BY `position`
 0.121 ms 8 Yes /classes/Product.php:3545
527 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 580689) AND (b.`id_shop` = 1) LIMIT 1
 0.121 ms 1 /src/Adapter/EntityMapper.php:71
546 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 545729
ORDER BY `position`
 0.121 ms 7 Yes /classes/Product.php:3545
561 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 13135
ORDER BY `position`
 0.121 ms 5 Yes /classes/Product.php:3545
572 
SELECT SQL_NO_CACHE 1 FROM `een_cart_rule` WHERE ((date_to >= "2026-05-04 00:00:00" AND date_to <= "2026-05-04 23:59:59") OR (date_from >= "2026-05-04 00:00:00" AND date_from <= "2026-05-04 23:59:59") OR (date_from < "2026-05-04 00:00:00" AND date_to > "2026-05-04 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
 0.121 ms 2 /classes/CartRule.php:357
336 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 598594
ORDER BY f.position ASC
 0.119 ms 2 Yes /classes/Product.php:6021
25 
SELECT SQL_NO_CACHE *
FROM `een_category` a
LEFT JOIN `een_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `een_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 2) AND (b.`id_shop` = 1) LIMIT 1
 0.117 ms 1 /src/Adapter/EntityMapper.php:71
537 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 565075
ORDER BY `position`
 0.117 ms 7 Yes /classes/Product.php:3545
555 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 542487
ORDER BY `position`
 0.117 ms 5 Yes /classes/Product.php:3545
355 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 580689
ORDER BY f.position ASC
 0.116 ms 2 Yes /classes/Product.php:6021
109 
SELECT SQL_NO_CACHE *
FROM `een_gmcp_feeds` ff
WHERE (ff.iso_lang="fr") AND (ff.id_shop=1)
ORDER BY ff.feed_is_default ASC
 0.116 ms 370 Yes /modules/gmerchantcenterpro/models/Feeds.php:72
255 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 30571
ORDER BY f.position ASC
 0.116 ms 2 Yes /classes/Product.php:6021
540 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 552215
ORDER BY `position`
 0.115 ms 5 Yes /classes/Product.php:3545
506 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 641723) AND (b.`id_shop` = 1) LIMIT 1
 0.114 ms 1 /src/Adapter/EntityMapper.php:71
513 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 615819
ORDER BY `position`
 0.113 ms 7 Yes /classes/Product.php:3545
486 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 40018
ORDER BY `position`
 0.112 ms 7 Yes /classes/Product.php:3545
503 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4319) AND (b.`id_shop` = 1) LIMIT 1
 0.112 ms 1 /src/Adapter/EntityMapper.php:71
494 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 30658) AND (b.`id_shop` = 1) LIMIT 1
 0.111 ms 1 /src/Adapter/EntityMapper.php:71
449 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 13135
AND image_shop.`cover` = 1 LIMIT 1
 0.111 ms 5 /classes/Product.php:3570
461 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 13136
AND image_shop.`cover` = 1 LIMIT 1
 0.111 ms 5 /classes/Product.php:3570
497 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 30571) AND (b.`id_shop` = 1) LIMIT 1
 0.111 ms 1 /src/Adapter/EntityMapper.php:71
190 
SELECT SQL_NO_CACHE tr.*
FROM `een_tax_rule` tr
JOIN `een_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 21
AND tr.`id_tax_rules_group` = 1
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
 0.110 ms 1 /classes/tax/TaxRulesTaxManager.php:109
510 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 615879
ORDER BY `position`
 0.110 ms 6 Yes /classes/Product.php:3545
174 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 40039
AND image_shop.`cover` = 1 LIMIT 1
 0.109 ms 8 /classes/Product.php:3570
268 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4319
AND image_shop.`cover` = 1 LIMIT 1
 0.106 ms 6 /classes/Product.php:3570
501 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 13137
ORDER BY `position`
 0.105 ms 6 Yes /classes/Product.php:3545
528 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 580689
ORDER BY `position`
 0.105 ms 4 Yes /classes/Product.php:3545
43 
SELECT SQL_NO_CACHE *
FROM `een_category` a
LEFT JOIN `een_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `een_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 1000) AND (b.`id_shop` = 1) LIMIT 1
 0.105 ms 1 /src/Adapter/EntityMapper.php:71
412 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 545554
AND image_shop.`cover` = 1 LIMIT 1
 0.105 ms 8 /classes/Product.php:3570
421 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 544260
AND image_shop.`cover` = 1 LIMIT 1
 0.105 ms 8 /classes/Product.php:3570
504 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4319
ORDER BY `position`
 0.105 ms 6 Yes /classes/Product.php:3545
203 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 40018)
 0.104 ms 1 /classes/Product.php:3860
303 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 615819)
 0.104 ms 1 /classes/Product.php:3860
489 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 36978
ORDER BY `position`
 0.104 ms 7 Yes /classes/Product.php:3545
475 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 604308)
 0.103 ms 1 /classes/Product.php:3860
507 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 641723
ORDER BY `position`
 0.103 ms 7 Yes /classes/Product.php:3545
290 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 615879
AND image_shop.`cover` = 1 LIMIT 1
 0.102 ms 6 /classes/Product.php:3570
492 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 30970
ORDER BY `position`
 0.102 ms 5 Yes /classes/Product.php:3545
495 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 30658
ORDER BY `position`
 0.102 ms 6 Yes /classes/Product.php:3545
58 
SELECT SQL_NO_CACHE *
FROM `een_category` a0
LEFT JOIN `een_category_lang` `a1` ON (a0.`id_category` = a1.`id_category`)
WHERE (a0.`nleft` < 2) AND (a0.`nright` > 659) AND (a1.`id_lang` = 1) AND (a1.`id_shop` = 1)
ORDER BY a0.`nleft` asc
 0.102 ms 1 /classes/PrestaShopCollection.php:383
406 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 545729)
 0.102 ms 1 /classes/Product.php:3860
300 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 615819
AND image_shop.`cover` = 1 LIMIT 1
 0.101 ms 7 /classes/Product.php:3570
434 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 542487)
 0.101 ms 1 /classes/Product.php:3860
591 
SELECT SQL_NO_CACHE c.id_elementor FROM een_iqit_elementor_category c LEFT JOIN een_iqit_elementor_category_shop s ON c.id_elementor = s.id_elementor WHERE c.id_category = 2 AND s.id_shop = 1 LIMIT 1
 0.101 ms 61 /modules/iqitelementor/src/IqitElementorCategory.php:87
322 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 607485)
 0.101 ms 1 /classes/Product.php:3860
424 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 544260)
 0.100 ms 1 /classes/Product.php:3860
430 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 542487
AND image_shop.`cover` = 1 LIMIT 1
 0.098 ms 5 /classes/Product.php:3570
294 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 615879)
 0.098 ms 1 /classes/Product.php:3860
415 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 545554)
 0.098 ms 1 /classes/Product.php:3860
146 
SELECT SQL_NO_CACHE type, id_value, filter_show_limit, filter_type FROM een_layered_category
WHERE controller = 'category'
AND id_category = 2
AND id_shop = 1
GROUP BY `type`, id_value ORDER BY position ASC
 0.097 ms 10 Yes Yes /modules/ps_facetedsearch/src/Filters/Provider.php:61
498 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 30571
ORDER BY `position`
 0.097 ms 6 Yes /classes/Product.php:3545
574 
SELECT SQL_NO_CACHE COUNT(*) FROM `een_orders` o
LEFT JOIN `een_order_cart_rule` ocr ON (ocr.`id_order` = o.`id_order`)
WHERE o.`id_customer` = 0
AND ocr.`deleted` = 0 AND ocr.`id_cart_rule` = 0 LIMIT 1
 0.097 ms 1 /classes/order/Order.php:881
472 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 604308
AND image_shop.`cover` = 1 LIMIT 1
 0.096 ms 10 /classes/Product.php:3570
209 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 36978
AND image_shop.`cover` = 1 LIMIT 1
 0.095 ms 7 /classes/Product.php:3570
0 
SELECT SQL_NO_CACHE * FROM een_memcached_servers
 0.094 ms 1 /classes/cache/CacheMemcached.php:263
313 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 609519)
 0.094 ms 1 /classes/Product.php:3860
197 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 40018
AND image_shop.`cover` = 1 LIMIT 1
 0.093 ms 7 /classes/Product.php:3570
309 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 609519
AND image_shop.`cover` = 1 LIMIT 1
 0.093 ms 8 /classes/Product.php:3570
186 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 40039)
 0.091 ms 1 /classes/Product.php:3860
328 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 598594
AND image_shop.`cover` = 1 LIMIT 1
 0.090 ms 8 /classes/Product.php:3570
319 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 607485
AND image_shop.`cover` = 1 LIMIT 1
 0.090 ms 6 /classes/Product.php:3570
455 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 13135)
 0.090 ms 1 /classes/Product.php:3860
274 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4319)
 0.089 ms 1 /classes/Product.php:3860
12 
SELECT SQL_NO_CACHE COUNT(DISTINCT l.id_lang) FROM `een_lang` l
JOIN een_lang_shop lang_shop ON (lang_shop.id_lang = l.id_lang AND lang_shop.id_shop = 1)
WHERE l.`active` = 1 LIMIT 1
 0.089 ms 1 /classes/Language.php:1216
228 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 30970)
 0.088 ms 1 /classes/Product.php:3860
215 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 36978)
 0.087 ms 1 /classes/Product.php:3860
350 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 580689)
 0.087 ms 1 /classes/Product.php:3860
466 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 13136)
 0.087 ms 1 /classes/Product.php:3860
331 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 598594)
 0.084 ms 1 /classes/Product.php:3860
234 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 30658
AND image_shop.`cover` = 1 LIMIT 1
 0.083 ms 6 /classes/Product.php:3570
280 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 641723
AND image_shop.`cover` = 1 LIMIT 1
 0.083 ms 7 /classes/Product.php:3570
652 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "ps_emailsubscription" LIMIT 1
 0.083 ms 1 /classes/module/Module.php:2659
29 
SELECT SQL_NO_CACHE *
FROM `een_currency` a
LEFT JOIN `een_currency_lang` `b` ON a.`id_currency` = b.`id_currency` AND b.`id_lang` = 1
LEFT JOIN `een_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
 0.082 ms 1 /src/Adapter/EntityMapper.php:71
379 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 565075)
 0.082 ms 1 /classes/Product.php:3860
221 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 30970
AND image_shop.`cover` = 1 LIMIT 1
 0.081 ms 5 /classes/Product.php:3570
240 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 30658)
 0.081 ms 1 /classes/Product.php:3860
337 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 589384
AND image_shop.`cover` = 1 LIMIT 1
 0.081 ms 7 /classes/Product.php:3570
375 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 565075
AND image_shop.`cover` = 1 LIMIT 1
 0.081 ms 7 /classes/Product.php:3570
440 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 542329
AND image_shop.`cover` = 1 LIMIT 1
 0.081 ms 9 /classes/Product.php:3570
262 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 13137)
 0.081 ms 1 /classes/Product.php:3860
365 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 567844
AND image_shop.`cover` = 1 LIMIT 1
 0.081 ms 8 /classes/Product.php:3570
385 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 552215
AND image_shop.`cover` = 1 LIMIT 1
 0.081 ms 5 /classes/Product.php:3570
394 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 547001
AND image_shop.`cover` = 1 LIMIT 1
 0.080 ms 8 /classes/Product.php:3570
577 
SELECT SQL_NO_CACHE COUNT(DISTINCT c.id_currency) FROM `een_currency` c
LEFT JOIN een_currency_shop cs ON (cs.id_currency = c.id_currency AND cs.id_shop = 1)
WHERE c.`active` = 1 AND c.`deleted` = 0 LIMIT 1
 0.080 ms 1 /classes/Currency.php:1136
397 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 547001)
 0.080 ms 1 /classes/Product.php:3860
569 
SELECT SQL_NO_CACHE c.id_elementor FROM een_iqit_elementor_category c WHERE c.id_category = 2 LIMIT 1
 0.080 ms 61 /modules/iqitelementor/src/IqitElementorCategory.php:87
247 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 30571
AND image_shop.`cover` = 1 LIMIT 1
 0.079 ms 6 /classes/Product.php:3570
369 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 567844)
 0.079 ms 1 /classes/Product.php:3860
586 
SELECT SQL_NO_CACHE SUM(`quantity`)
FROM `een_cart_product`
WHERE `id_cart` = 0 LIMIT 1
 0.079 ms 1 /classes/Cart.php:1303
341 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 589384)
 0.078 ms 1 /classes/Product.php:3860
26 
SELECT SQL_NO_CACHE * FROM `een_currency` c ORDER BY `iso_code` ASC
 0.077 ms 1 Yes /classes/Currency.php:709
250 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 30571)
 0.077 ms 1 /classes/Product.php:3860
356 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 579017
AND image_shop.`cover` = 1 LIMIT 1
 0.077 ms 10 /classes/Product.php:3570
443 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 542329)
 0.077 ms 1 /classes/Product.php:3860
44 
SELECT SQL_NO_CACHE *
FROM `een_category` a
LEFT JOIN `een_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `een_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 5816) AND (b.`id_shop` = 1) LIMIT 1
 0.076 ms 1 /src/Adapter/EntityMapper.php:71
284 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 641723)
 0.076 ms 1 /classes/Product.php:3860
297 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 615879) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.076 ms 1 /classes/stock/StockAvailable.php:453
256 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 13137
AND image_shop.`cover` = 1 LIMIT 1
 0.076 ms 6 /classes/Product.php:3570
7 
SELECT SQL_NO_CACHE *
FROM `een_country` a
LEFT JOIN `een_country_lang` `b` ON a.`id_country` = b.`id_country` AND b.`id_lang` = 1
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 8) LIMIT 1
 0.075 ms 1 /src/Adapter/EntityMapper.php:71
347 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 580689
AND image_shop.`cover` = 1 LIMIT 1
 0.075 ms 4 /classes/Product.php:3570
388 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 552215)
 0.075 ms 1 /classes/Product.php:3860
19 
SELECT SQL_NO_CACHE name, alias FROM `een_hook_alias`
 0.074 ms 87 /classes/Hook.php:339
52 
SELECT SQL_NO_CACHE * FROM `een_image_type` WHERE 1 AND `products` = 1  ORDER BY `width` DESC, `height` DESC, `name`ASC
 0.072 ms 8 Yes /classes/ImageType.php:109
150 
SELECT SQL_NO_CACHE *
FROM `een_category` a
LEFT JOIN `een_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 2) LIMIT 1
 0.072 ms 1 /src/Adapter/EntityMapper.php:71
359 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 579017)
 0.072 ms 1 /classes/Product.php:3860
372 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 567844) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.072 ms 1 /classes/stock/StockAvailable.php:453
589 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "iqitelementor" LIMIT 1
 0.072 ms 1 /classes/module/Module.php:2659
153 
SELECT SQL_NO_CACHE data FROM een_layered_filter_block WHERE hash="b4683c742914bd7e84f84f0bfb3e3a25" LIMIT 1
 0.071 ms 1 /modules/ps_facetedsearch/src/Filters/Block.php:186
594 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "iqitcountdown" LIMIT 1
 0.071 ms 1 /classes/module/Module.php:2659
592 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "ps_facetedsearch" LIMIT 1
 0.069 ms 1 /classes/module/Module.php:2659
46 
SELECT SQL_NO_CACHE *
FROM `een_category` a
LEFT JOIN `een_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `een_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 5756) AND (b.`id_shop` = 1) LIMIT 1
 0.068 ms 1 /src/Adapter/EntityMapper.php:71
66 
CREATE TABLE IF NOT EXISTS `een_gmcp_reporting` (`id_reporting` int(11) NOT NULL AUTO_INCREMENT,`iso_feed` LONGTEXT NOT NULL,    `reporting_content` LONGTEXT NOT NULL,`id_shop` int(11) NOT NULL,`date_add` datetime NOT NULL,`date_upd` datetime NOT NULL,PRIMARY KEY (`id_reporting`)) ENGINE=' . _MYSQL_ENGINE_ . ' DEFAULT CHARSET=utf8;
 0.068 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
45 
SELECT SQL_NO_CACHE *
FROM `een_category` a
LEFT JOIN `een_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `een_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 2756) AND (b.`id_shop` = 1) LIMIT 1
 0.068 ms 1 /src/Adapter/EntityMapper.php:71
296 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 615879 AND `id_group` = 1 LIMIT 1
 0.068 ms 0 /classes/GroupReduction.php:156
427 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 544260) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.068 ms 1 /classes/stock/StockAvailable.php:453
17 
SELECT SQL_NO_CACHE value FROM `een_configuration` WHERE `name` = "PS_MULTISHOP_FEATURE_ACTIVE" LIMIT 1
 0.067 ms 1 /classes/shop/Shop.php:1183
47 
SELECT SQL_NO_CACHE *
FROM `een_category` a
LEFT JOIN `een_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `een_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 5757) AND (b.`id_shop` = 1) LIMIT 1
 0.067 ms 1 /src/Adapter/EntityMapper.php:71
242 
SELECT SQL_NO_CACHE tr.*
FROM `een_tax_rule` tr
JOIN `een_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 21
AND tr.`id_tax_rules_group` = 8
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
 0.067 ms 0 /classes/tax/TaxRulesTaxManager.php:109
625 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "supercheckout" LIMIT 1
 0.067 ms 0 /classes/module/Module.php:2659
15 
SELECT SQL_NO_CACHE `name`, `alias` FROM `een_hook_alias`
 0.066 ms 87 /classes/Hook.php:287
556 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 542487
 0.066 ms 1 /classes/Product.php:2902
559 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 542329
 0.066 ms 1 /classes/Product.php:2902
575 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "iqitlinksmanager" LIMIT 1
 0.066 ms 1 /classes/module/Module.php:2659
6 
SELECT SQL_NO_CACHE l.*, ls.`id_shop`
FROM `een_lang` l
LEFT JOIN `een_lang_shop` ls ON (l.id_lang = ls.id_lang)
 0.065 ms 1 /classes/Language.php:1080
474 
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 604308 LIMIT 1
 0.065 ms 1 /classes/SpecificPrice.php:435
568 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 604308
 0.065 ms 1 /classes/Product.php:2902
5 
SELECT SQL_NO_CACHE su.physical_uri, su.virtual_uri, su.domain, su.domain_ssl
FROM een_shop s
LEFT JOIN een_shop_url su ON (s.id_shop = su.id_shop)
WHERE s.id_shop = 1
AND s.active = 1 AND s.deleted = 0 AND su.main = 1 LIMIT 1
 0.065 ms 1 /classes/shop/Shop.php:218
514 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 615819
 0.064 ms 1 /classes/Product.php:2902
553 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 544260
 0.064 ms 1 /classes/Product.php:2902
32 
SELECT SQL_NO_CACHE *
FROM `een_country` a
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 21) LIMIT 1
 0.063 ms 1 /src/Adapter/EntityMapper.php:71
193 
SELECT SQL_NO_CACHE tr.*
FROM `een_tax_rule` tr
JOIN `een_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 21
AND tr.`id_tax_rules_group` = 0
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
 0.063 ms 0 /classes/tax/TaxRulesTaxManager.php:109
562 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 13135
 0.063 ms 1 /classes/Product.php:2902
321 
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 607485 LIMIT 1
 0.062 ms 1 /classes/SpecificPrice.php:435
595 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 74 AND `id_shop` = 1 LIMIT 1
 0.062 ms 1 /classes/module/Module.php:2132
9 
SELECT SQL_NO_CACHE *
FROM `een_lang` a
LEFT JOIN `een_lang_shop` `c` ON a.`id_lang` = c.`id_lang` AND c.`id_shop` = 1
WHERE (a.`id_lang` = 1) LIMIT 1
 0.061 ms 1 /src/Adapter/EntityMapper.php:71
37 
SELECT SQL_NO_CACHE *
FROM `een_group` a
LEFT JOIN `een_group_shop` `c` ON a.`id_group` = c.`id_group` AND c.`id_shop` = 1
WHERE (a.`id_group` = 1) LIMIT 1
 0.061 ms 1 /src/Adapter/EntityMapper.php:71
151 
SELECT SQL_NO_CACHE *
FROM `een_category_lang`
WHERE `id_category` = 2 AND `id_shop` = 1
 0.061 ms 1 /src/Adapter/EntityMapper.php:79
404 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1020 LIMIT 1
 0.061 ms 1 /classes/Product.php:5659
520 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 607485
 0.061 ms 1 /classes/Product.php:2902
578 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "ps_languageselector" LIMIT 1
 0.061 ms 1 /classes/module/Module.php:2659
584 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "iqitcompare" LIMIT 1
 0.061 ms 1 /classes/module/Module.php:2659
423 
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 544260 LIMIT 1
 0.061 ms 1 /classes/SpecificPrice.php:435
11 
SELECT SQL_NO_CACHE domain, domain_ssl
FROM een_shop_url
WHERE main = 1
AND id_shop = 1 LIMIT 1
 0.060 ms 1 /classes/shop/ShopUrl.php:182
21 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "ets_superspeed" LIMIT 1
 0.060 ms 0 /classes/module/Module.php:2659
28 
SELECT SQL_NO_CACHE c.id_currency
FROM `een_currency` c
WHERE (iso_code = 'EUR') LIMIT 1
 0.060 ms 1 /classes/Currency.php:893
469 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 13136) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.060 ms 1 /classes/stock/StockAvailable.php:453
517 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 609519
 0.060 ms 1 /classes/Product.php:2902
544 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 547001
 0.060 ms 1 /classes/Product.php:2902
654 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "iqitsociallogin" LIMIT 1
 0.060 ms 1 /classes/module/Module.php:2659
27 
SELECT SQL_NO_CACHE `id_lang` FROM `een_lang`
WHERE `locale` = 'fr-fr'
OR `language_code` = 'fr-fr' LIMIT 1
 0.060 ms 1 /classes/Language.php:883
565 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 13136
 0.060 ms 1 /classes/Product.php:2902
593 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 24 AND `id_shop` = 1 LIMIT 1
 0.059 ms 1 /classes/module/Module.php:2132
59 
SELECT SQL_NO_CACHE * FROM een_revslider_sliders
 0.059 ms 1 /modules/revsliderprestashop/includes/revslider_db.class.php:214
291 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 5727 LIMIT 1
 0.059 ms 1 /classes/Category.php:1378
523 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 598594
 0.059 ms 1 /classes/Product.php:2902
526 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 589384
 0.059 ms 1 /classes/Product.php:2902
590 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 75 AND `id_shop` = 1 LIMIT 1
 0.058 ms 1 /classes/module/Module.php:2132
182 
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE `from` BETWEEN '2026-05-04 00:00:00' AND '2026-05-04 23:59:59' LIMIT 1
 0.058 ms 1 /classes/SpecificPrice.php:377
312 
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 609519 LIMIT 1
 0.058 ms 1 /classes/SpecificPrice.php:435
378 
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 565075 LIMIT 1
 0.058 ms 1 /classes/SpecificPrice.php:435
462 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1011 LIMIT 1
 0.058 ms 1 /classes/Product.php:5659
487 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 40018
 0.058 ms 1 /classes/Product.php:2902
576 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 78 AND `id_shop` = 1 LIMIT 1
 0.058 ms 1 /classes/module/Module.php:2132
582 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "iqitwishlist" LIMIT 1
 0.058 ms 1 /classes/module/Module.php:2659
587 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "iqitmegamenu" LIMIT 1
 0.058 ms 1 /classes/module/Module.php:2659
34 
SELECT SQL_NO_CACHE *
FROM `een_currency` a
LEFT JOIN `een_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
 0.057 ms 1 /src/Adapter/EntityMapper.php:71
271 
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 4319 LIMIT 1
 0.057 ms 1 /classes/SpecificPrice.php:435
293 
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 615879 LIMIT 1
 0.057 ms 1 /classes/SpecificPrice.php:435
405 
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 545729 LIMIT 1
 0.057 ms 1 /classes/SpecificPrice.php:435
409 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 545729) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.057 ms 1 /classes/stock/StockAvailable.php:453
450 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 1011 LIMIT 1
 0.057 ms 1 /classes/Category.php:1378
535 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 567844
 0.057 ms 1 /classes/Product.php:2902
206 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 40018) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.056 ms 1 /classes/stock/StockAvailable.php:453
413 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 5727 LIMIT 1
 0.056 ms 1 /classes/Product.php:5659
422 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 5727 LIMIT 1
 0.056 ms 1 /classes/Product.php:5659
483 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 40039
 0.056 ms 1 /classes/Product.php:2902
643 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "attributewizardpro" LIMIT 1
 0.056 ms 0 /classes/module/Module.php:2659
4 
SELECT SQL_NO_CACHE *
FROM `een_shop` a
WHERE (a.`id_shop` = 1) LIMIT 1
 0.055 ms 1 /src/Adapter/EntityMapper.php:71
55 
SELECT SQL_NO_CACHE *
FROM `een_country` a
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 17) LIMIT 1
 0.055 ms 1 /src/Adapter/EntityMapper.php:71
362 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 579017) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.055 ms 1 /classes/stock/StockAvailable.php:453
532 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 579017
 0.055 ms 1 /classes/Product.php:2902
414 
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 545554 LIMIT 1
 0.055 ms 1 /classes/SpecificPrice.php:435
31 
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'US' LIMIT 1
 0.054 ms 1 /classes/Country.php:194
178 
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 0 LIMIT 1
 0.054 ms 1 /classes/SpecificPrice.php:426
194 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 40039) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.054 ms 1 /classes/stock/StockAvailable.php:453
323 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 607485 AND id_shop=1 LIMIT 1
 0.054 ms 1 /classes/Product.php:6876
418 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 545554) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.054 ms 1 /classes/stock/StockAvailable.php:453
431 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 441 LIMIT 1
 0.054 ms 1 /classes/Category.php:1378
23 
SELECT SQL_NO_CACHE * FROM `een_hook_module_exceptions`
WHERE `id_shop` IN (1)
 0.054 ms 1 /classes/module/Module.php:2041
295 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 615879 AND id_shop=1 LIMIT 1
 0.054 ms 1 /classes/Product.php:6876
444 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 542329 AND id_shop=1 LIMIT 1
 0.054 ms 1 /classes/Product.php:6876
541 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 552215
 0.054 ms 1 /classes/Product.php:2902
433 
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 542487 LIMIT 1
 0.053 ms 1 /classes/SpecificPrice.php:435
175 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 369 LIMIT 1
 0.053 ms 1 /classes/Category.php:1378
484 
SELECT SQL_NO_CACHE state FROM een_feature_flag WHERE name = 'multiple_image_format' LIMIT 1
 0.053 ms 1 /classes/FeatureFlag.php:105
585 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 70 AND `id_shop` = 1 LIMIT 1
 0.053 ms 1 /classes/module/Module.php:2132
310 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 1023 LIMIT 1
 0.052 ms 1 /classes/Category.php:1378
550 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 545554
 0.052 ms 1 /classes/Product.php:2902
38 
SELECT SQL_NO_CACHE *
FROM `een_group_lang`
WHERE `id_group` = 1
 0.052 ms 1 /src/Adapter/EntityMapper.php:79
107 
SELECT SQL_NO_CACHE id_feed
FROM `een_gmcp_feeds` ff
WHERE (ff.id_shop=1) LIMIT 1
 0.052 ms 370 /modules/gmerchantcenterpro/models/Feeds.php:53
210 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 1020 LIMIT 1
 0.052 ms 1 /classes/Category.php:1378
269 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 1042 LIMIT 1
 0.052 ms 1 /classes/Category.php:1378
302 
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 615819 LIMIT 1
 0.052 ms 1 /classes/SpecificPrice.php:435
330 
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 598594 LIMIT 1
 0.052 ms 1 /classes/SpecificPrice.php:435
425 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 544260 AND id_shop=1 LIMIT 1
 0.052 ms 1 /classes/Product.php:6876
435 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 542487 AND id_shop=1 LIMIT 1
 0.052 ms 1 /classes/Product.php:6876
437 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 542487) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.052 ms 1 /classes/stock/StockAvailable.php:453
547 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 545729
 0.052 ms 1 /classes/Product.php:2902
653 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 19 AND `id_shop` = 1 LIMIT 1
 0.052 ms 0 /classes/module/Module.php:2132
658 
SELECT SQL_NO_CACHE data
FROM `een_ganalytics_data`
WHERE id_cart = 0
AND id_shop = 1 LIMIT 1
 0.052 ms 0 /modules/ps_googleanalytics/classes/Repository/GanalyticsDataRepository.php:43
53 
SELECT SQL_NO_CACHE format
FROM `een_address_format`
WHERE `id_country` = 17 LIMIT 1
 0.051 ms 1 /classes/AddressFormat.php:656
316 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 609519) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.051 ms 1 /classes/stock/StockAvailable.php:453
325 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 607485) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.051 ms 1 /classes/stock/StockAvailable.php:453
416 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 545554 AND id_shop=1 LIMIT 1
 0.051 ms 1 /classes/Product.php:6876
463 
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 13136 LIMIT 1
 0.051 ms 1 /classes/SpecificPrice.php:435
511 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 615879
 0.051 ms 1 /classes/Product.php:2902
588 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 79 AND `id_shop` = 1 LIMIT 1
 0.051 ms 1 /classes/module/Module.php:2132
292 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 5727 LIMIT 1
 0.051 ms 1 /classes/Product.php:5659
114 
SELECT SQL_NO_CACHE c.id_currency
FROM `een_currency` c
WHERE (deleted = 0) AND (iso_code = 'EUR') LIMIT 1
 0.050 ms 1 /classes/Currency.php:893
301 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 5727 LIMIT 1
 0.050 ms 1 /classes/Product.php:5659
304 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 615819 AND id_shop=1 LIMIT 1
 0.050 ms 1 /classes/Product.php:6876
306 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 615819) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.050 ms 1 /classes/stock/StockAvailable.php:453
382 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 565075) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.050 ms 1 /classes/stock/StockAvailable.php:453
320 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1023 LIMIT 1
 0.050 ms 1 /classes/Product.php:5659
48 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "facebookproductsfeed" LIMIT 1
 0.049 ms 0 /classes/module/Module.php:2659
56 
SELECT SQL_NO_CACHE *
FROM `een_country_lang`
WHERE `id_country` = 17
 0.049 ms 1 /src/Adapter/EntityMapper.php:79
311 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1023 LIMIT 1
 0.049 ms 1 /classes/Product.php:5659
329 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 5727 LIMIT 1
 0.049 ms 1 /classes/Product.php:5659
493 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 30970
 0.049 ms 1 /classes/Product.php:2902
496 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 30658
 0.049 ms 1 /classes/Product.php:2902
508 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 641723
 0.049 ms 1 /classes/Product.php:2902
538 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 565075
 0.049 ms 1 /classes/Product.php:2902
22 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.049 ms 0 /classes/module/Module.php:2132
33 
SELECT SQL_NO_CACHE *
FROM `een_country_lang`
WHERE `id_country` = 21
 0.049 ms 1 /src/Adapter/EntityMapper.php:79
60 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "pm_advancedpack" LIMIT 1
 0.049 ms 0 /classes/module/Module.php:2659
204 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 40018 AND id_shop=1 LIMIT 1
 0.049 ms 1 /classes/Product.php:6876
334 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 598594) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.049 ms 1 /classes/stock/StockAvailable.php:453
407 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 545729 AND id_shop=1 LIMIT 1
 0.049 ms 1 /classes/Product.php:6876
505 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 4319
 0.049 ms 1 /classes/Product.php:2902
626 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.049 ms 0 /classes/module/Module.php:2132
112 
SELECT SQL_NO_CACHE *
FROM `een_country` a
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 8) LIMIT 1
 0.048 ms 1 /src/Adapter/EntityMapper.php:71
452 
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 13135 LIMIT 1
 0.048 ms 1 /classes/SpecificPrice.php:435
456 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 13135 AND id_shop=1 LIMIT 1
 0.048 ms 1 /classes/Product.php:6876
490 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 36978
 0.048 ms 1 /classes/Product.php:2902
502 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 13137
 0.048 ms 1 /classes/Product.php:2902
30 
SELECT SQL_NO_CACHE `id_lang` FROM `een_lang`
WHERE `locale` = 'fr-fr'
OR `language_code` = 'fr-fr' LIMIT 1
 0.048 ms 1 /classes/Language.php:883
314 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 609519 AND id_shop=1 LIMIT 1
 0.048 ms 1 /classes/Product.php:6876
340 
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 589384 LIMIT 1
 0.048 ms 1 /classes/SpecificPrice.php:435
476 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 604308 AND id_shop=1 LIMIT 1
 0.048 ms 1 /classes/Product.php:6876
656 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "iqitcookielaw" LIMIT 1
 0.048 ms 1 /classes/module/Module.php:2659
110 
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'FR' LIMIT 1
 0.047 ms 1 /classes/Country.php:194
200 
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 40018 LIMIT 1
 0.047 ms 1 /classes/SpecificPrice.php:435
201 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 40018
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.047 ms 0 /classes/SpecificPrice.php:259
35 
SELECT SQL_NO_CACHE *
FROM `een_currency_lang`
WHERE `id_currency` = 1
 0.047 ms 1 /src/Adapter/EntityMapper.php:79
137 
SELECT SQL_NO_CACHE *
FROM `een_country` a
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 3) LIMIT 1
 0.047 ms 1 /src/Adapter/EntityMapper.php:71
143 
SELECT SQL_NO_CACHE id_order
FROM `een_orders` o
WHERE (o.id_cart=0) LIMIT 1
 0.047 ms 1 /modules/gmerchantcenterpro/lib/dao/moduleDao.php:450
180 
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE `id_product` != 0 LIMIT 1
 0.047 ms 527 /classes/SpecificPrice.php:297
191 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 40039 AND `id_group` = 1 LIMIT 1
 0.047 ms 0 /classes/GroupReduction.php:156
198 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 1022 LIMIT 1
 0.047 ms 1 /classes/Category.php:1378
212 
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 36978 LIMIT 1
 0.047 ms 1 /classes/SpecificPrice.php:435
253 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 30571) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.047 ms 1 /classes/stock/StockAvailable.php:453
324 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 607485 AND `id_group` = 1 LIMIT 1
 0.047 ms 0 /classes/GroupReduction.php:156
344 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 589384) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.047 ms 1 /classes/stock/StockAvailable.php:453
391 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 552215) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.047 ms 1 /classes/stock/StockAvailable.php:453
396 
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 547001 LIMIT 1
 0.047 ms 1 /classes/SpecificPrice.php:435
458 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 13135) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.047 ms 1 /classes/stock/StockAvailable.php:453
478 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 604308) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.047 ms 1 /classes/stock/StockAvailable.php:453
499 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 30571
 0.047 ms 1 /classes/Product.php:2902
529 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 580689
 0.047 ms 1 /classes/Product.php:2902
580 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "ps_currencyselector" LIMIT 1
 0.047 ms 1 /classes/module/Module.php:2659
120 
SELECT SQL_NO_CACHE c.id_currency
FROM `een_currency` c
WHERE (deleted = 0) AND (iso_code = 'XAF') LIMIT 1
 0.046 ms 1 /classes/Currency.php:893
129 
SELECT SQL_NO_CACHE *
FROM `een_country` a
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 19) LIMIT 1
 0.046 ms 1 /src/Adapter/EntityMapper.php:71
249 
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 30571 LIMIT 1
 0.046 ms 1 /classes/SpecificPrice.php:435
473 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1013 LIMIT 1
 0.046 ms 1 /classes/Product.php:5659
655 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 93 AND `id_shop` = 1 LIMIT 1
 0.046 ms 1 /classes/module/Module.php:2132
395 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1021 LIMIT 1
 0.046 ms 1 /classes/Product.php:5659
116 
SELECT SQL_NO_CACHE c.id_currency
FROM `een_currency` c
WHERE (deleted = 0) AND (iso_code = 'TND') LIMIT 1
 0.045 ms 1 /classes/Currency.php:893
187 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 40039 AND id_shop=1 LIMIT 1
 0.045 ms 1 /classes/Product.php:6876
231 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 30970) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.045 ms 1 /classes/stock/StockAvailable.php:453
400 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 547001) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.045 ms 1 /classes/stock/StockAvailable.php:453
441 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1021 LIMIT 1
 0.045 ms 1 /classes/Product.php:5659
446 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 542329) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.045 ms 1 /classes/stock/StockAvailable.php:453
119 
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'FR' LIMIT 1
 0.045 ms 1 /classes/Country.php:194
265 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 13137) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.045 ms 1 /classes/stock/StockAvailable.php:453
370 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 567844 AND id_shop=1 LIMIT 1
 0.045 ms 1 /classes/Product.php:6876
118 
SELECT SQL_NO_CACHE c.id_currency
FROM `een_currency` c
WHERE (deleted = 0) AND (iso_code = 'DZD') LIMIT 1
 0.044 ms 1 /classes/Currency.php:893
122 
SELECT SQL_NO_CACHE c.id_currency
FROM `een_currency` c
WHERE (deleted = 0) AND (iso_code = 'XOF') LIMIT 1
 0.044 ms 1 /classes/Currency.php:893
124 
SELECT SQL_NO_CACHE c.id_currency
FROM `een_currency` c
WHERE (deleted = 0) AND (iso_code = 'MGA') LIMIT 1
 0.044 ms 1 /classes/Currency.php:893
133 
SELECT SQL_NO_CACHE *
FROM `een_country` a
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 4) LIMIT 1
 0.044 ms 1 /src/Adapter/EntityMapper.php:71
177 
SELECT SQL_NO_CACHE `name`
FROM `een_manufacturer`
WHERE `id_manufacturer` = 1635
AND `active` = 1 LIMIT 1
 0.044 ms 1 /classes/Manufacturer.php:316
183 
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE `to` BETWEEN '2026-05-04 00:00:00' AND '2026-05-04 23:59:59' LIMIT 1
 0.044 ms 1 /classes/SpecificPrice.php:381
222 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 1010 LIMIT 1
 0.044 ms 1 /classes/Category.php:1378
235 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 1004 LIMIT 1
 0.044 ms 1 /classes/Category.php:1378
349 
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 580689 LIMIT 1
 0.044 ms 1 /classes/SpecificPrice.php:435
353 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 580689) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.044 ms 1 /classes/stock/StockAvailable.php:453
218 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 36978) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.044 ms 1 /classes/stock/StockAvailable.php:453
244 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 30658) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.044 ms 1 /classes/stock/StockAvailable.php:453
287 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 641723) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.044 ms 1 /classes/stock/StockAvailable.php:453
442 
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 542329 LIMIT 1
 0.044 ms 1 /classes/SpecificPrice.php:435
216 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 36978 AND id_shop=1 LIMIT 1
 0.043 ms 1 /classes/Product.php:6876
248 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1022 LIMIT 1
 0.043 ms 1 /classes/Product.php:5659
426 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 544260 AND `id_group` = 1 LIMIT 1
 0.043 ms 0 /classes/GroupReduction.php:156
432 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 441 LIMIT 1
 0.043 ms 1 /classes/Product.php:5659
10 
SELECT SQL_NO_CACHE id_shop
FROM `een_lang_shop`
WHERE `id_lang` = 1
AND id_shop = 1 LIMIT 1
 0.043 ms 1 /classes/ObjectModel.php:1729
50 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "ps_legalcompliance" LIMIT 1
 0.043 ms 0 /classes/module/Module.php:2659
121 
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'FR' LIMIT 1
 0.043 ms 1 /classes/Country.php:194
126 
SELECT SQL_NO_CACHE c.id_currency
FROM `een_currency` c
WHERE (deleted = 0) AND (iso_code = 'MAD') LIMIT 1
 0.043 ms 1 /classes/Currency.php:893
144 
SELECT SQL_NO_CACHE `name`
FROM `een_hook`
WHERE `id_hook` = 1013 LIMIT 1
 0.043 ms 1 /classes/Hook.php:244
179 
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 40039 LIMIT 1
 0.043 ms 1 /classes/SpecificPrice.php:435
225 
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 30970 LIMIT 1
 0.043 ms 1 /classes/SpecificPrice.php:435
237 
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 30658 LIMIT 1
 0.043 ms 1 /classes/SpecificPrice.php:435
257 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 1013 LIMIT 1
 0.043 ms 1 /classes/Category.php:1378
272 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 4319
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.043 ms 0 /classes/SpecificPrice.php:259
338 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 411 LIMIT 1
 0.043 ms 1 /classes/Category.php:1378
376 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 5726 LIMIT 1
 0.043 ms 1 /classes/Category.php:1378
467 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 13136 AND id_shop=1 LIMIT 1
 0.043 ms 1 /classes/Product.php:6876
583 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 87 AND `id_shop` = 1 LIMIT 1
 0.043 ms 1 /classes/module/Module.php:2132
141 
SELECT SQL_NO_CACHE *
FROM `een_country` a
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 186) LIMIT 1
 0.042 ms 1 /src/Adapter/EntityMapper.php:71
259 
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 13137 LIMIT 1
 0.042 ms 1 /classes/SpecificPrice.php:435
41 
SELECT SQL_NO_CACHE ctg.`id_group`
FROM een_category_group ctg
WHERE ctg.`id_category` = 2 AND ctg.`id_group` = 1 LIMIT 1
 0.042 ms 1 /classes/Category.php:1754
57 
SELECT SQL_NO_CACHE id_required_field, object_name, field_name
FROM een_required_field
 0.042 ms 1 /classes/ObjectModel.php:1592
115 
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'FR' LIMIT 1
 0.042 ms 1 /classes/Country.php:194
275 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 4319 AND id_shop=1 LIMIT 1
 0.042 ms 1 /classes/Product.php:6876
277 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 4319) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.042 ms 1 /classes/stock/StockAvailable.php:453
281 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1020 LIMIT 1
 0.042 ms 1 /classes/Product.php:5659
332 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 598594 AND id_shop=1 LIMIT 1
 0.042 ms 1 /classes/Product.php:6876
351 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 580689 AND id_shop=1 LIMIT 1
 0.042 ms 1 /classes/Product.php:6876
358 
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 579017 LIMIT 1
 0.042 ms 1 /classes/SpecificPrice.php:435
366 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 1021 LIMIT 1
 0.042 ms 1 /classes/Category.php:1378
368 
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 567844 LIMIT 1
 0.042 ms 1 /classes/SpecificPrice.php:435
386 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1023 LIMIT 1
 0.042 ms 1 /classes/Product.php:5659
387 
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 552215 LIMIT 1
 0.042 ms 1 /classes/SpecificPrice.php:435
8 
SELECT SQL_NO_CACHE *
FROM `een_shop_group` a
WHERE (a.`id_shop_group` = 1) LIMIT 1
 0.041 ms 1 /src/Adapter/EntityMapper.php:71
36 
SELECT SQL_NO_CACHE id_shop
FROM `een_currency_shop`
WHERE `id_currency` = 1
AND id_shop = 1 LIMIT 1
 0.041 ms 1 /classes/ObjectModel.php:1729
131 
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'CA' LIMIT 1
 0.041 ms 1 /classes/Country.php:194
229 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 30970 AND id_shop=1 LIMIT 1
 0.041 ms 1 /classes/Product.php:6876
241 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 30658 AND id_shop=1 LIMIT 1
 0.041 ms 1 /classes/Product.php:6876
251 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 30571 AND id_shop=1 LIMIT 1
 0.041 ms 1 /classes/Product.php:6876
283 
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 641723 LIMIT 1
 0.041 ms 1 /classes/SpecificPrice.php:435
348 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1020 LIMIT 1
 0.041 ms 1 /classes/Product.php:5659
579 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 6 AND `id_shop` = 1 LIMIT 1
 0.041 ms 1 /classes/module/Module.php:2132
649 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "blockwishlist" LIMIT 1
 0.041 ms 1 /classes/module/Module.php:2659
39 
SELECT SQL_NO_CACHE id_shop
FROM `een_group_shop`
WHERE `id_group` = 1
AND id_shop = 1 LIMIT 1
 0.040 ms 1 /classes/ObjectModel.php:1729
63 
SELECT SQL_NO_CACHE * FROM `een_image_type`
 0.040 ms 8 /classes/ImageType.php:161
127 
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'CH' LIMIT 1
 0.040 ms 1 /classes/Country.php:194
263 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 13137 AND id_shop=1 LIMIT 1
 0.040 ms 1 /classes/Product.php:6876
285 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 641723 AND id_shop=1 LIMIT 1
 0.040 ms 1 /classes/Product.php:6876
342 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 589384 AND id_shop=1 LIMIT 1
 0.040 ms 1 /classes/Product.php:6876
357 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 5727 LIMIT 1
 0.040 ms 1 /classes/Product.php:5659
389 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 552215 AND id_shop=1 LIMIT 1
 0.040 ms 1 /classes/Product.php:6876
390 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 552215 AND `id_group` = 1 LIMIT 1
 0.040 ms 0 /classes/GroupReduction.php:156
398 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 547001 AND id_shop=1 LIMIT 1
 0.040 ms 1 /classes/Product.php:6876
417 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 545554 AND `id_group` = 1 LIMIT 1
 0.040 ms 0 /classes/GroupReduction.php:156
453 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 13135
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.040 ms 0 /classes/SpecificPrice.php:259
627 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "onepagecheckout" LIMIT 1
 0.040 ms 0 /classes/module/Module.php:2659
40 
SELECT SQL_NO_CACHE `id_category`
FROM `een_category_shop`
WHERE `id_category` = 2
AND `id_shop` = 1 LIMIT 1
 0.040 ms 1 /classes/Category.php:2450
360 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 579017 AND id_shop=1 LIMIT 1
 0.040 ms 1 /classes/Product.php:6876
380 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 565075 AND id_shop=1 LIMIT 1
 0.040 ms 1 /classes/Product.php:6876
113 
SELECT SQL_NO_CACHE *
FROM `een_country_lang`
WHERE `id_country` = 8
 0.039 ms 1 /src/Adapter/EntityMapper.php:79
123 
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'FR' LIMIT 1
 0.039 ms 1 /classes/Country.php:194
125 
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'FR' LIMIT 1
 0.039 ms 1 /classes/Country.php:194
139 
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'SA' LIMIT 1
 0.039 ms 1 /classes/Country.php:194
176 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 369 LIMIT 1
 0.039 ms 1 /classes/Product.php:5659
199 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1022 LIMIT 1
 0.039 ms 1 /classes/Product.php:5659
270 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1042 LIMIT 1
 0.039 ms 1 /classes/Product.php:5659
436 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 542487 AND `id_group` = 1 LIMIT 1
 0.039 ms 0 /classes/GroupReduction.php:156
130 
SELECT SQL_NO_CACHE *
FROM `een_country_lang`
WHERE `id_country` = 19
 0.039 ms 1 /src/Adapter/EntityMapper.php:79
135 
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'BE' LIMIT 1
 0.039 ms 1 /classes/Country.php:194
184 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 40039
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.039 ms 0 /classes/SpecificPrice.php:259
134 
SELECT SQL_NO_CACHE *
FROM `een_country_lang`
WHERE `id_country` = 4
 0.038 ms 1 /src/Adapter/EntityMapper.php:79
145 
SELECT SQL_NO_CACHE `id_category`
FROM `een_category_shop`
WHERE `id_category` = 2
AND `id_shop` = 1 LIMIT 1
 0.038 ms 1 /classes/Category.php:2450
211 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1020 LIMIT 1
 0.038 ms 1 /classes/Product.php:5659
657 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 72 AND `id_shop` = 1 LIMIT 1
 0.038 ms 1 /classes/module/Module.php:2132
117 
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'FR' LIMIT 1
 0.038 ms 1 /classes/Country.php:194
138 
SELECT SQL_NO_CACHE *
FROM `een_country_lang`
WHERE `id_country` = 3
 0.038 ms 1 /src/Adapter/EntityMapper.php:79
371 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 567844 AND `id_group` = 1 LIMIT 1
 0.038 ms 0 /classes/GroupReduction.php:156
408 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 545729 AND `id_group` = 1 LIMIT 1
 0.038 ms 0 /classes/GroupReduction.php:156
451 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1011 LIMIT 1
 0.038 ms 1 /classes/Product.php:5659
464 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 13136
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.038 ms 0 /classes/SpecificPrice.php:259
644 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.038 ms 0 /classes/module/Module.php:2132
49 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.037 ms 0 /classes/module/Module.php:2132
377 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 5726 LIMIT 1
 0.037 ms 1 /classes/Product.php:5659
111 
SELECT SQL_NO_CACHE `name`
FROM `een_country_lang`
WHERE `id_lang` = 1
AND `id_country` = 8 LIMIT 1
 0.037 ms 1 /classes/Country.php:252
205 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 40018 AND `id_group` = 1 LIMIT 1
 0.037 ms 0 /classes/GroupReduction.php:156
213 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 36978
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.037 ms 0 /classes/SpecificPrice.php:259
305 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 615819 AND `id_group` = 1 LIMIT 1
 0.037 ms 0 /classes/GroupReduction.php:156
315 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 609519 AND `id_group` = 1 LIMIT 1
 0.037 ms 0 /classes/GroupReduction.php:156
628 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.037 ms 0 /classes/module/Module.php:2132
132 
SELECT SQL_NO_CACHE `name`
FROM `een_country_lang`
WHERE `id_lang` = 1
AND `id_country` = 4 LIMIT 1
 0.036 ms 1 /classes/Country.php:252
142 
SELECT SQL_NO_CACHE *
FROM `een_country_lang`
WHERE `id_country` = 186
 0.036 ms 1 /src/Adapter/EntityMapper.php:79
192 
SELECT SQL_NO_CACHE `reduction`
FROM `een_group`
WHERE `id_group` = 1 LIMIT 1
 0.036 ms 1 /classes/Group.php:154
282 
SELECT SQL_NO_CACHE `name`
FROM `een_manufacturer`
WHERE `id_manufacturer` = 11523
AND `active` = 1 LIMIT 1
 0.036 ms 1 /classes/Manufacturer.php:316
333 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 598594 AND `id_group` = 1 LIMIT 1
 0.036 ms 0 /classes/GroupReduction.php:156
361 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 579017 AND `id_group` = 1 LIMIT 1
 0.036 ms 0 /classes/GroupReduction.php:156
445 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 542329 AND `id_group` = 1 LIMIT 1
 0.036 ms 0 /classes/GroupReduction.php:156
581 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 7 AND `id_shop` = 1 LIMIT 1
 0.036 ms 1 /classes/module/Module.php:2132
630 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.036 ms 0 /classes/module/Module.php:2132
638 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.036 ms 0 /classes/module/Module.php:2132
54 
SELECT SQL_NO_CACHE `need_identification_number`
FROM `een_country`
WHERE `id_country` = 17 LIMIT 1
 0.035 ms 1 /classes/Country.php:405
73 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_last_product_not_ordered` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `last_product_ordered` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
 0.035 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
128 
SELECT SQL_NO_CACHE `name`
FROM `een_country_lang`
WHERE `id_lang` = 1
AND `id_country` = 19 LIMIT 1
 0.035 ms 1 /classes/Country.php:252
224 
SELECT SQL_NO_CACHE `name`
FROM `een_manufacturer`
WHERE `id_manufacturer` = 1646
AND `active` = 1 LIMIT 1
 0.035 ms 1 /classes/Manufacturer.php:316
238 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 30658
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.035 ms 0 /classes/SpecificPrice.php:259
243 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 30658 AND `id_group` = 1 LIMIT 1
 0.035 ms 0 /classes/GroupReduction.php:156
260 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 13137
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.035 ms 0 /classes/SpecificPrice.php:259
339 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 411 LIMIT 1
 0.035 ms 1 /classes/Product.php:5659
477 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 604308 AND `id_group` = 1 LIMIT 1
 0.035 ms 0 /classes/GroupReduction.php:156
286 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 641723 AND `id_group` = 1 LIMIT 1
 0.035 ms 0 /classes/GroupReduction.php:156
457 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 13135 AND `id_group` = 1 LIMIT 1
 0.035 ms 0 /classes/GroupReduction.php:156
51 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.034 ms 0 /classes/module/Module.php:2132
61 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "gsnippetsreviews" LIMIT 1
 0.034 ms 0 /classes/module/Module.php:2659
223 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1010 LIMIT 1
 0.034 ms 1 /classes/Product.php:5659
236 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1004 LIMIT 1
 0.034 ms 1 /classes/Product.php:5659
629 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "onepagecheckoutps" LIMIT 1
 0.034 ms 0 /classes/module/Module.php:2659
631 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "steasycheckout" LIMIT 1
 0.034 ms 0 /classes/module/Module.php:2659
632 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.034 ms 0 /classes/module/Module.php:2132
226 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 30970
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.034 ms 0 /classes/SpecificPrice.php:259
468 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 13136 AND `id_group` = 1 LIMIT 1
 0.034 ms 0 /classes/GroupReduction.php:156
650 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 3 AND `id_shop` = 1 LIMIT 1
 0.033 ms 0 /classes/module/Module.php:2132
136 
SELECT SQL_NO_CACHE `name`
FROM `een_country_lang`
WHERE `id_lang` = 1
AND `id_country` = 3 LIMIT 1
 0.033 ms 1 /classes/Country.php:252
140 
SELECT SQL_NO_CACHE `name`
FROM `een_country_lang`
WHERE `id_lang` = 1
AND `id_country` = 186 LIMIT 1
 0.033 ms 1 /classes/Country.php:252
217 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 36978 AND `id_group` = 1 LIMIT 1
 0.033 ms 0 /classes/GroupReduction.php:156
258 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1013 LIMIT 1
 0.033 ms 1 /classes/Product.php:5659
343 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 589384 AND `id_group` = 1 LIMIT 1
 0.033 ms 0 /classes/GroupReduction.php:156
367 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1021 LIMIT 1
 0.033 ms 1 /classes/Product.php:5659
633 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "thecheckout" LIMIT 1
 0.033 ms 0 /classes/module/Module.php:2659
634 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.033 ms 0 /classes/module/Module.php:2132
635 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "idxropc" LIMIT 1
 0.033 ms 0 /classes/module/Module.php:2659
640 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.033 ms 0 /classes/module/Module.php:2132
67 
CREATE TABLE IF NOT EXISTS `een_gmcp_feeds` (`id_feed` int(11) NOT NULL AUTO_INCREMENT,`iso_lang` LONGTEXT NOT NULL,`iso_country` LONGTEXT NOT NULL,`iso_currency` LONGTEXT NOT NULL, `taxonomy` LONGTEXT NOT NULL, `id_shop` int(11) NOT NULL,`date_add` datetime NOT NULL,`date_upd` datetime NOT NULL,PRIMARY KEY (`id_feed`)) ENGINE=' . _MYSQL_ENGINE_ . ' DEFAULT CHARSET=utf8;
 0.032 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
230 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 30970 AND `id_group` = 1 LIMIT 1
 0.032 ms 0 /classes/GroupReduction.php:156
639 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "easycheckout" LIMIT 1
 0.032 ms 0 /classes/module/Module.php:2659
645 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "cdesigner" LIMIT 1
 0.032 ms 0 /classes/module/Module.php:2659
252 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 30571 AND `id_group` = 1 LIMIT 1
 0.031 ms 0 /classes/GroupReduction.php:156
264 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 13137 AND `id_group` = 1 LIMIT 1
 0.031 ms 0 /classes/GroupReduction.php:156
276 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 4319 AND `id_group` = 1 LIMIT 1
 0.031 ms 0 /classes/GroupReduction.php:156
352 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 580689 AND `id_group` = 1 LIMIT 1
 0.031 ms 0 /classes/GroupReduction.php:156
381 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 565075 AND `id_group` = 1 LIMIT 1
 0.031 ms 0 /classes/GroupReduction.php:156
399 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 547001 AND `id_group` = 1 LIMIT 1
 0.031 ms 0 /classes/GroupReduction.php:156
636 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.031 ms 0 /classes/module/Module.php:2132
648 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.031 ms 0 /classes/module/Module.php:2132
62 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "gremarketing" LIMIT 1
 0.030 ms 0 /classes/module/Module.php:2659
70 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_last_product_ordered` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `last_product_ordered` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
 0.030 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
96 
CREATE TABLE IF NOT EXISTS `een_gmcp_feeds` (`id_feed` int(11) NOT NULL AUTO_INCREMENT,`iso_lang` LONGTEXT NOT NULL,`iso_country` LONGTEXT NOT NULL,`iso_currency` LONGTEXT NOT NULL, `taxonomy` LONGTEXT NOT NULL, `id_shop` int(11) NOT NULL,`date_add` datetime NOT NULL,`date_upd` datetime NOT NULL,PRIMARY KEY (`id_feed`)) ENGINE=' . _MYSQL_ENGINE_ . ' DEFAULT CHARSET=utf8;
 0.030 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
637 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "pwpaysoncheckout" LIMIT 1
 0.030 ms 0 /classes/module/Module.php:2659
647 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "configurator" LIMIT 1
 0.030 ms 0 /classes/module/Module.php:2659
646 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.030 ms 0 /classes/module/Module.php:2132
68 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_price_range` (`id_tag` int(11) NOT NULL, `price_min` CHAR(255) NOT NULL, `price_max` CHAR(255), `id_product` CHAR(255), UNIQUE KEY `tag_price_range` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
 0.029 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
77 
CREATE TABLE IF NOT EXISTS `een_gmcp_taxonomy` (`id_taxonomy` int(11) NOT NULL AUTO_INCREMENT, `value` text NOT NULL, `lang` varchar(5) NOT NULL, PRIMARY KEY (`id_taxonomy`), KEY `lang` (`lang`), FULLTEXT KEY `ft_index` (`value`)) ENGINE=MyISAM DEFAULT CHARSET=utf8 AUTO_INCREMENT=1;
 0.028 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
97 
CREATE TABLE IF NOT EXISTS `een_gmcp_advanced_exclusion` (`id` int(11) NOT NULL AUTO_INCREMENT, `status` int(11) NOT NULL DEFAULT "1", `id_shop` int(11) NOT NULL DEFAULT "1", `name` char(255) NOT NULL, `type` char(255) NOT NULL, `exclusion_value` longtext NOT NULL, PRIMARY KEY (`id`)) ENGINE=InnoDB DEFAULT CHARSET=utf8 AUTO_INCREMENT=1;
 0.028 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
76 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags` (`id_tag` int(11) NOT NULL AUTO_INCREMENT, `id_shop` int(11) NOT NULL DEFAULT "1", `name` char(255) NOT NULL, `type` char(255) NOT NULL, `active` TINYINT NOT NULL, `position` INT NOT NULL, `end_date` DATE, PRIMARY KEY (`id_tag`)) ENGINE=MyISAM DEFAULT CHARSET=utf8 AUTO_INCREMENT=1 ;
 0.028 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
69 
CREATE TABLE IF NOT EXISTS `een_gmcp_tmp_rules`(`id` int(11) NOT NULL AUTO_INCREMENT, `id_shop` int(11) NOT NULL DEFAULT "1",`type` char(255) NOT NULL, `exclusion_values` longtext NOT NULL, PRIMARY KEY (`id`)) ENGINE=InnoDB DEFAULT CHARSET=utf8 AUTO_INCREMENT=1;
 0.027 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
71 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_promotion` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `promotion` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
 0.026 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
74 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_last_product_not_ordered` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `last_product_ordered` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
 0.026 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
75 
CREATE TABLE IF NOT EXISTS `een_gmcp_discount_association` (`id_association` int(11) NOT NULL AUTO_INCREMENT, `id_discount` int(11) NOT NULL, `id_product` int(11) NOT NULL, `channel` CHAR(120) NOT NULL DEFAULT "SHOPPING_ADS", PRIMARY KEY (`id_association`) ) ENGINE=MyISAM DEFAULT CHARSET=utf8;
 0.026 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
95 
CREATE TABLE IF NOT EXISTS `een_gmcp_reporting` (`id_reporting` int(11) NOT NULL AUTO_INCREMENT,`iso_feed` LONGTEXT NOT NULL,    `reporting_content` LONGTEXT NOT NULL,`id_shop` int(11) NOT NULL,`date_add` datetime NOT NULL,`date_upd` datetime NOT NULL,PRIMARY KEY (`id_reporting`)) ENGINE=' . _MYSQL_ENGINE_ . ' DEFAULT CHARSET=utf8;
 0.026 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
78 
CREATE TABLE IF NOT EXISTS `een_gmcp_categories` (`id_category` int(11) NOT NULL, `id_shop` int(11) NOT NULL DEFAULT "1",  UNIQUE KEY `id_category` (`id_category`, `id_shop`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
 0.025 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
79 
CREATE TABLE IF NOT EXISTS `een_gmcp_taxonomy_categories` (`id_category` int(11) NOT NULL, `id_shop` int(3) NOT NULL DEFAULT "1", `txt_taxonomy` text NOT NULL, `lang` char(5) NOT NULL, KEY `id_category` (`id_category`,`lang`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
 0.025 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
84 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_products` (`id_tag` int(11) NOT NULL, `id_product` int(11) NOT NULL, product_name VARCHAR (255) NOT NULL, UNIQUE KEY `tag_product` (`id_tag`,`id_product`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
 0.025 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
91 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_best_sale` (`id_tag` int(11) NOT NULL, `amount` CHAR(255) NOT NULL, `unit` CHAR(255) ,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255),  `id_shop` int(11) NOT NULL,  UNIQUE KEY `tag_best_sales` (`id_tag`, `id_product`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
 0.025 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
100 
CREATE TABLE IF NOT EXISTS `een_gmcp_tmp_rules`(`id` int(11) NOT NULL AUTO_INCREMENT, `id_shop` int(11) NOT NULL DEFAULT "1",`type` char(255) NOT NULL, `exclusion_values` longtext NOT NULL, PRIMARY KEY (`id`)) ENGINE=InnoDB DEFAULT CHARSET=utf8 AUTO_INCREMENT=1;
 0.025 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
81 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags` (`id_tag` int(11) NOT NULL AUTO_INCREMENT, `id_shop` int(11) NOT NULL DEFAULT "1", `name` char(255) NOT NULL, `type` char(255) NOT NULL, `active` TINYINT NOT NULL, `position` INT NOT NULL, `end_date` DATE, PRIMARY KEY (`id_tag`)) ENGINE=MyISAM DEFAULT CHARSET=utf8 AUTO_INCREMENT=1 ;
 0.025 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
90 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_new_product` (`id_tag` int(11) NOT NULL,  `from_date` DATETIME, `id_product` int,  `id_shop` int(11) NOT NULL,  UNIQUE KEY `tag_new_product` (`id_tag`, `id_product`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
 0.025 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
88 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_features` (`id_tag` int(11) NOT NULL, `id_feature` int(11) NOT NULL, `id_shop` int(11) NOT NULL,  UNIQUE KEY `tag_feature` (`id_tag`, `id_feature`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
 0.024 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
89 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_categories` (`id_tag` int(11) NOT NULL, `id_category` int(11) NOT NULL, `id_shop` int(11) NOT NULL,  UNIQUE KEY `tag_feature` (`id_tag`, `id_category`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
 0.024 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
92 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_last_product_ordered` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `last_product_ordered` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
 0.024 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
98 
CREATE TABLE IF NOT EXISTS `een_gmcp_product_excluded` (`id_rule` int(11) NOT NULL DEFAULT "0",`id_product` int(11) NOT NULL DEFAULT "0", `id_product_attribute` int(11)) ENGINE=InnoDB DEFAULT CHARSET=utf8 AUTO_INCREMENT=1;
 0.024 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
80 
CREATE TABLE IF NOT EXISTS `een_gmcp_brands` (`id_brands` int(11) NOT NULL, `id_shop` int(11) NOT NULL DEFAULT "1",  UNIQUE KEY `id_brands` (`id_brands`, `id_shop`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
 0.024 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
86 
CREATE TABLE IF NOT EXISTS `een_gmcp_features_by_cat` (`id_cat` int(11) NOT NULL DEFAULT '0', `id_shop` int(3) NOT NULL DEFAULT "1", `values` text NOT NULL, PRIMARY KEY (`id_cat`, `id_shop`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
 0.024 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
87 
CREATE TABLE IF NOT EXISTS `een_gmcp_discount_association` (`id_association` int(11) NOT NULL AUTO_INCREMENT, `id_discount` int(11) NOT NULL, `id_product` int(11) NOT NULL, `channel` CHAR(120) NOT NULL DEFAULT "SHOPPING_ADS", PRIMARY KEY (`id_association`) ) ENGINE=MyISAM DEFAULT CHARSET=utf8;
 0.024 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
93 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_last_product_not_ordered` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `last_product_ordered` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
 0.024 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
99 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_price_range` (`id_tag` int(11) NOT NULL, `price_min` CHAR(255) NOT NULL, `price_max` CHAR(255), `id_product` CHAR(255), UNIQUE KEY `tag_price_range` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
 0.024 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
82 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_brands` (`id_tag` int(11) NOT NULL, `id_brand` int(11) NOT NULL, UNIQUE KEY `tag_brand` (`id_tag`,`id_brand`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
 0.023 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
85 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_suppliers` (`id_tag` int(11) NOT NULL, `id_supplier` int(11) NOT NULL, UNIQUE KEY `tag_supplier` (`id_tag`,`id_supplier`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
 0.023 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
94 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_promotion` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `promotion` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
 0.023 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
83 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_cats` (`id_tag` int(11) NOT NULL, `id_category` int(11) NOT NULL, UNIQUE KEY `tag_cat` (`id_tag`,`id_category`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
 0.023 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
64 
BEGIN
 0.022 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:81
106 
COMMIT
 0.021 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:155
101 
COMMIT
 0.016 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:107
102 
BEGIN
 0.015 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:121

Doubles

30 queries 
SELECT XX FROM `een_specific_price` WHERE id_product = XX LIMIT XX
29 queries 
SELECT image_shop.`id_image`
                    FROM `een_image` i
                     INNER JOIN een_image_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
                    WHERE i.`id_product` = XX
                    AND image_shop.`cover` = XX LIMIT XX
29 queries 
SELECT name FROM een_category_lang WHERE id_shop = XX AND id_lang = XX AND id_category = XX LIMIT XX
29 queries 
SELECT product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,XX) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = XX)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = XX)
WHERE (p.`id_product` = XX)
29 queries 
                            SELECT `id_tax_rules_group`
                            FROM `een_product_shop`
                            WHERE `id_product` = XX AND id_shop=XX LIMIT XX
29 queries 
			SELECT `reduction`
			FROM `een_product_group_reduction_cache`
			WHERE `id_product` = XX AND `id_group` = XX LIMIT XX
29 queries 
SELECT SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
29 queries 
SELECT
            COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), XX) as deep_quantity,
            COALESCE(SUM(first_level_quantity), XX) as quantity
          FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, XX as pack_quantity
          FROM `een_cart_product` cp
            WHERE cp.`id_product_attribute` = XX
            
            AND cp.`id_cart` = XX AND cp.`id_product` = XX UNION SELECT XX as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
          FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
            WHERE cp.`id_product_attribute` = XX
            
            AND cp.`id_cart` = XX AND p.`id_product_item` = XX AND (pr.`pack_stock_type` IN (XX,XX) OR (
            pr.`pack_stock_type` = XX
            AND XX = XX
        ))) as q LIMIT XX
29 queries 
                SELECT name, value, pf.id_feature, f.position, fvl.id_feature_value
                FROM een_feature_product pf
                LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = XX)
                LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = XX)
                LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = XX)
                 INNER JOIN een_feature_shop feature_shop
        ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = XX)
                WHERE pf.id_product = XX
                ORDER BY f.position ASC
29 queries 
SELECT *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = XX
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = XX
WHERE (a.`id_product` = XX) AND (b.`id_shop` = XX) LIMIT XX
29 queries 
            SELECT image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
            FROM `een_image` i
             INNER JOIN een_image_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
            LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = XX)
            WHERE i.`id_product` = XX
            ORDER BY `position`
29 queries 
SELECT `id_product_attribute`
            FROM `een_product_attribute`
            WHERE `id_product` = XX
29 queries 
SELECT pa.`id_product`, a.`color`, pac.`id_product_attribute`, XX qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
            FROM `een_product_attribute` pa
             INNER JOIN een_product_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX)
            JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
            JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
            JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = XX)
            JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
            WHERE pa.`id_product` IN (XX) AND ag.`is_color_group` = XX
            GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
            
            ORDER BY a.`position` ASC;
27 queries 
SELECT `id_module` FROM `een_module_shop` WHERE `id_module` = XX AND `id_shop` = XX LIMIT XX
14 queries 
			SELECT cl.`link_rewrite`
			FROM `een_category_lang` cl
			WHERE `id_lang` = XX
			 AND cl.id_shop = XX 
			AND cl.`id_category` = XX LIMIT XX
9 queries 
				SELECT `priority`, `id_specific_price_priority`
				FROM `een_specific_price_priority`
				WHERE `id_product` = XX
				ORDER BY `id_specific_price_priority` DESC LIMIT XX
9 queries 
			SELECT *, ( IF (`id_shop` = XX, XX, XX) +  IF (`id_country` = XX, XX, XX) +  IF (`id_currency` = XX, XX, XX) +  IF (`id_group` = XX, XX, XX) +  IF (`id_customer` = XX, XX, XX)) AS `score`
				FROM `een_specific_price`
				WHERE
                `id_shop` IN (XX, XX) AND
                `id_currency` IN (XX, XX) AND
                `id_country` IN (XX, XX) AND
                `id_group` IN (XX, XX) AND `id_product` = XX AND `id_customer` = XX AND `id_product_attribute` = XX AND `id_cart` = XX  AND (`from` = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' >= `from`) AND (`to` = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' <= `to`)
				AND IF(`from_quantity` > XX, `from_quantity`, XX) <= XX ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT XX
7 queries 
SELECT *
FROM `een_country` a
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = XX
WHERE (a.`id_country` = XX) LIMIT XX
7 queries 
SELECT *
							FROM `een_country_lang`
							WHERE `id_country` = XX
7 queries 
			SELECT `id_country`
			FROM `een_country`
			WHERE `iso_code` = 'FR' LIMIT XX
6 queries 
SELECT *
FROM `een_category` a
LEFT JOIN `een_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = XX
LEFT JOIN `een_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = XX
WHERE (a.`id_category` = XX) AND (b.`id_shop` = XX) LIMIT XX
5 queries 
							SELECT `name`
							FROM `een_country_lang`
							WHERE `id_lang` = XX
							AND `id_country` = XX LIMIT XX
5 queries 
SELECT v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `een_feature_value` v LEFT JOIN `een_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = XX) LEFT JOIN `een_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = XX) WHERE v.`id_feature` = XX ORDER BY vl.`value` ASC
4 queries 
SELECT fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, XX) = sa.id_product_attribute AND sa.id_shop = XX  AND sa.id_shop_group = XX ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = XX AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=XX) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_XX ON (p.id_product = fp_XX.id_product) WHERE ((fp.id_feature_value IN (XX, XX, XX))) AND ((fp_XX.id_feature_value IN (XX, XX, XX))) AND ps.id_shop='XX' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='XX' AND c.nleft>=XX AND c.nright<=XX GROUP BY p.id_product) p INNER JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_XX ON (p.id_product = fp_XX.id_product) LEFT JOIN een_feature_product fp_XX ON (p.id_product = fp_XX.id_product) WHERE ((fp.id_feature=XX)) AND ((fp_XX.id_feature_value IN (XX, XX, XX))) AND ((fp_XX.id_feature_value IN (XX, XX, XX))) GROUP BY fp.id_feature_value
3 queries 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_last_product_not_ordered` (`id_tag` int(XX) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(XX), UNIQUE KEY `last_product_ordered` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utfXX;
3 queries 
				SELECT `name`
				FROM `een_manufacturer`
				WHERE `id_manufacturer` = XX
				AND `active` = XX LIMIT XX
3 queries 
				SELECT tr.*
				FROM `een_tax_rule` tr
				JOIN `een_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
				WHERE trg.`active` = XX
				AND tr.`id_country` = XX
				AND tr.`id_tax_rules_group` = XX
				AND tr.`id_state` IN (XX, XX)
				AND ('XX' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
					OR (tr.`zipcode_to` = XX AND tr.`zipcode_from` IN(XX, 'XX')))
				ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
2 queries 
                SELECT m.`id_module`, m.`name`, ms.`id_module`as `mshop`
                FROM `een_module` m
                LEFT JOIN `een_module_shop` ms
                ON m.`id_module` = ms.`id_module`
                AND ms.`id_shop` = XX
2 queries 
SELECT `id_lang` FROM `een_lang`
                    WHERE `locale` = 'fr-fr'
                    OR `language_code` = 'fr-fr' LIMIT XX
2 queries 
		SELECT `id_category`
		FROM `een_category_shop`
		WHERE `id_category` = XX
		AND `id_shop` = XX LIMIT XX
2 queries 
BEGIN
2 queries 
SHOW TABLES LIKE "een_gmcp_XX"
2 queries 
CREATE TABLE IF NOT EXISTS `een_gmcp_reporting` (`id_reporting` int(XX) NOT NULL AUTO_INCREMENT,`iso_feed` LONGTEXT NOT NULL,    `reporting_content` LONGTEXT NOT NULL,`id_shop` int(XX) NOT NULL,`date_add` datetime NOT NULL,`date_upd` datetime NOT NULL,PRIMARY KEY (`id_reporting`)) ENGINE=' . _MYSQL_ENGINE_ . ' DEFAULT CHARSET=utfXX;
2 queries 
CREATE TABLE IF NOT EXISTS `een_gmcp_feeds` (`id_feed` int(XX) NOT NULL AUTO_INCREMENT,`iso_lang` LONGTEXT NOT NULL,`iso_country` LONGTEXT NOT NULL,`iso_currency` LONGTEXT NOT NULL, `taxonomy` LONGTEXT NOT NULL, `id_shop` int(XX) NOT NULL,`date_add` datetime NOT NULL,`date_upd` datetime NOT NULL,PRIMARY KEY (`id_feed`)) ENGINE=' . _MYSQL_ENGINE_ . ' DEFAULT CHARSET=utfXX;
2 queries 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_price_range` (`id_tag` int(XX) NOT NULL, `price_min` CHAR(XX) NOT NULL, `price_max` CHAR(XX), `id_product` CHAR(XX), UNIQUE KEY `tag_price_range` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utfXX;
2 queries 
CREATE TABLE IF NOT EXISTS `een_gmcp_tmp_rules`(`id` int(XX) NOT NULL AUTO_INCREMENT, `id_shop` int(XX) NOT NULL DEFAULT "XX",`type` char(XX) NOT NULL, `exclusion_values` longtext NOT NULL, PRIMARY KEY (`id`)) ENGINE=InnoDB DEFAULT CHARSET=utfXX AUTO_INCREMENT=XX;
2 queries 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_last_product_ordered` (`id_tag` int(XX) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(XX), UNIQUE KEY `last_product_ordered` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utfXX;
2 queries 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_promotion` (`id_tag` int(XX) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(XX), UNIQUE KEY `promotion` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utfXX;
2 queries 
CREATE TABLE IF NOT EXISTS `een_gmcp_discount_association` (`id_association` int(XX) NOT NULL AUTO_INCREMENT, `id_discount` int(XX) NOT NULL, `id_product` int(XX) NOT NULL, `channel` CHAR(XX) NOT NULL DEFAULT "SHOPPING_ADS", PRIMARY KEY (`id_association`) ) ENGINE=MyISAM DEFAULT CHARSET=utfXX;
2 queries 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags` (`id_tag` int(XX) NOT NULL AUTO_INCREMENT, `id_shop` int(XX) NOT NULL DEFAULT "XX", `name` char(XX) NOT NULL, `type` char(XX) NOT NULL, `active` TINYINT NOT NULL, `position` INT NOT NULL, `end_date` DATE, PRIMARY KEY (`id_tag`)) ENGINE=MyISAM DEFAULT CHARSET=utfXX AUTO_INCREMENT=XX ;
2 queries 
COMMIT
2 queries 
SELECT fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, XX) = sa.id_product_attribute AND sa.id_shop = XX  AND sa.id_shop_group = XX ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = XX AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=XX) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (XX, XX, XX))) AND ps.id_shop='XX' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='XX' AND c.nleft>=XX AND c.nright<=XX GROUP BY p.id_product) p INNER JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_XX ON (p.id_product = fp_XX.id_product) WHERE ((fp.id_feature=XX)) AND ((fp_XX.id_feature_value IN (XX, XX, XX))) GROUP BY fp.id_feature_value
2 queries 
SELECT XX FROM `een_cart_rule` WHERE ((date_to >= "XX-XX-XX XX:XX:XX" AND date_to <= "XX-XX-XX XX:XX:XX") OR (date_from >= "XX-XX-XX XX:XX:XX" AND date_from <= "XX-XX-XX XX:XX:XX") OR (date_from < "XX-XX-XX XX:XX:XX" AND date_to > "XX-XX-XX XX:XX:XX")) AND `id_customer` IN (XX,XX) LIMIT XX
2 queries 
SELECT product_id as id_product, COUNT(product_id) AS sales
            FROM `een_order_detail`
            WHERE product_id IN (
                SELECT id_product
                FROM `een_category_product`
                LEFT JOIN een_product USING (id_product)
                WHERE id_category = XX
                AND active = XX
            )
            GROUP BY product_id
            ORDER BY sales DESC LIMIT XX

Tables stress

105 product
103 product_shop
87 feature_product
75 product_attribute
59 cart_product
58 image
58 image_shop
58 product_attribute_shop
55 category_lang
48 stock_available
46 product_attribute_combination
44 specific_price
34 module
34 feature_value_lang
30 module_shop
30 feature
30 feature_shop
30 feature_lang
30 product_lang
29 product_group_reduction_cache
29 pack
29 image_lang
29 attribute
29 attribute_lang
29 attribute_group
28 category
21 country
20 category_product
18 category_group
14 product_sale
13 country_lang
13 category_shop
12 currency
9 specific_price_priority
8 country_shop
7 hook
5 lang
5 feature_value
5 layered_indexable_feature_value_lang_value
4 shop_url
4 shop
4 lang_shop
4 currency_shop
4 gmcp_feeds
4 cart_rule
3 hook_alias
3 manufacturer
3 tax_rule
3 tax_rules_group
2 shop_group
2 configuration
2 hook_module
2 currency_lang
2 group
2 group_shop
2 image_type
2 orders
2 iqit_elementor_category
2 cart_rule_lang
2 order_detail
1 memcached_servers
1 configuration_lang
1 module_group
1 meta
1 meta_lang
1 hook_module_exceptions
1 group_lang
1 address_format
1 required_field
1 revslider_sliders
1 gmcp_discount_association
1 gmcp_tags
1 layered_category
1 layered_indexable_feature
1 layered_indexable_feature_lang_value
1 layered_filter_block
1 layered_price_index
1 feature_flag
1 order_cart_rule
1 iqit_elementor_category_shop
1 ganalytics_data

ObjectModel instances

Name Instances Source
Product 29 /src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 40039]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 40018]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 36978]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 30970]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 30658]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 30571]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 13137]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4319]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 641723]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 615879]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 615819]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 609519]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 607485]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 598594]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 589384]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 580689]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 579017]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 567844]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 565075]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 552215]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 547001]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 545729]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 545554]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 544260]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 542487]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 542329]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 13135]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 13136]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 604308]
Country 15 /config/config.inc.php:148 (__construct) [id: 8]
/classes/controller/FrontController.php:946 (__construct) [id: 21]
/classes/AddressFormat.php:404 (__construct) [id: 17]
/classes/controller/FrontController.php:1779 (__construct) [id: 17]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 8]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 8]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 8]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 8]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 8]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 8]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 8]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 19]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 4]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 3]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 186]
Language 13 /config/config.inc.php:213 (__construct) [id: 1]
/classes/Tools.php:560 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
Category 13 /controllers/front/listing/CategoryController.php:78 (__construct) [id: 2]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 1000]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 5816]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 2756]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 5756]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 5757]
/classes/Meta.php:380 (__construct) [id: 2]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/modules/ps_facetedsearch/src/Product/Search.php:365 (__construct) [id: 2]
/modules/ps_facetedsearch/src/Filters/Block.php:157 (__construct) [id: 2]
/modules/facebookconversiontrackingplus/facebookconversiontrackingplus.php:3085 (__construct) [id: 2]
/classes/Link.php:402 (__construct) [id: 2]
/modules/facebookconversiontrackingplus/classes/ConversionApi.php:518 (__construct) [id: 2]
Currency 9 /src/Adapter/Currency/CurrencyDataProvider.php:101 (__construct) [id: 1]
/classes/Tools.php:690 (getCurrencyInstance) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:213 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:213 (__construct) [id: 0]
/modules/gmerchantcenterpro/lib/moduleTools.php:213 (__construct) [id: 0]
/modules/gmerchantcenterpro/lib/moduleTools.php:213 (__construct) [id: 0]
/modules/gmerchantcenterpro/lib/moduleTools.php:213 (__construct) [id: 0]
/modules/gmerchantcenterpro/lib/moduleTools.php:213 (__construct) [id: 0]
/modules/gmerchantcenterpro/lib/moduleTools.php:213 (__construct) [id: 0]
Address 4 /classes/shop/Shop.php:486 (__construct) [id: ]
/classes/Product.php:3694 (initialize) [id: ]
/classes/Product.php:3804 (__construct) [id: ]
/classes/Product.php:5964 (__construct) [id: ]
Cart 2 /classes/controller/FrontController.php:467 (__construct) [id: ]
/classes/controller/FrontController.php:541 (__construct) [id: ]
Shop 1 /config/config.inc.php:119 (initialize) [id: 1]
ShopGroup 1 /classes/shop/Shop.php:561 (__construct) [id: 1]
Customer 1 /config/config.inc.php:266 (__construct) [id: ]
Group 1 /classes/Cart.php:249 (getCurrent) [id: 1]
Gender 1 /classes/controller/FrontController.php:1702 (__construct) [id: 0]
Risk 1 /classes/controller/FrontController.php:1705 (__construct) [id: ]
AddressFormat 1 /classes/controller/FrontController.php:1773 (generateAddress) [id: ]
State 1 /classes/controller/FrontController.php:1778 (__construct) [id: 0]
IqitElementorCategory 1 /modules/iqitelementor/iqitelementor.php:784 (isJustElementor) [id: ]

Included Files

# Filename
0 /index.php
1 /config/config.inc.php
2 /config/defines.inc.php
3 /config/autoload.php
4 /vendor/autoload.php
5 /vendor/composer/autoload_real.php
6 /vendor/composer/platform_check.php
7 /vendor/composer/ClassLoader.php
8 /vendor/composer/include_paths.php
9 /vendor/composer/autoload_static.php
10 /vendor/symfony/polyfill-php72/bootstrap.php
11 /vendor/symfony/polyfill-mbstring/bootstrap.php
12 /vendor/symfony/polyfill-mbstring/bootstrap80.php
13 /vendor/symfony/polyfill-intl-normalizer/bootstrap.php
14 /vendor/symfony/polyfill-intl-normalizer/bootstrap80.php
15 /vendor/symfony/polyfill-intl-idn/bootstrap.php
16 /vendor/symfony/deprecation-contracts/function.php
17 /vendor/ralouphie/getallheaders/src/getallheaders.php
18 /vendor/symfony/polyfill-ctype/bootstrap.php
19 /vendor/symfony/polyfill-ctype/bootstrap80.php
20 /vendor/symfony/polyfill-php80/bootstrap.php
21 /vendor/guzzlehttp/promises/src/functions_include.php
22 /vendor/guzzlehttp/promises/src/functions.php
23 /vendor/guzzlehttp/guzzle/src/functions_include.php
24 /vendor/guzzlehttp/guzzle/src/functions.php
25 /vendor/symfony/polyfill-iconv/bootstrap.php
26 /vendor/ezyang/htmlpurifier/library/HTMLPurifier.composer.php
27 /vendor/jakeasmith/http_build_url/src/http_build_url.php
28 /vendor/lcobucci/jwt/compat/class-aliases.php
29 /vendor/lcobucci/jwt/src/Token.php
30 /vendor/lcobucci/jwt/src/Signature.php
31 /vendor/lcobucci/jwt/compat/json-exception-polyfill.php
32 /vendor/lcobucci/jwt/compat/lcobucci-clock-polyfill.php
33 /vendor/swiftmailer/swiftmailer/lib/swift_required.php
34 /vendor/swiftmailer/swiftmailer/lib/classes/Swift.php
35 /vendor/symfony/polyfill-intl-icu/bootstrap.php
36 /vendor/symfony/polyfill-php73/bootstrap.php
37 /vendor/symfony/polyfill-php81/bootstrap.php
38 /vendor/api-platform/core/src/deprecation.php
39 /vendor/api-platform/core/src/Api/FilterInterface.php
40 /vendor/api-platform/core/src/Api/ResourceClassResolverInterface.php
41 /vendor/api-platform/core/src/deprecated_interfaces.php
42 /vendor/api-platform/core/src/Metadata/Property/Factory/PropertyNameCollectionFactoryInterface.php
43 /vendor/api-platform/core/src/Metadata/Resource/Factory/ResourceNameCollectionFactoryInterface.php
44 /vendor/api-platform/core/src/Metadata/Extractor/ResourceExtractorInterface.php
45 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/DateFilterInterface.php
46 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/ExistsFilterInterface.php
47 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/OrderFilterInterface.php
48 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/RangeFilterInterface.php
49 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/SearchFilterInterface.php
50 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationCollectionExtensionInterface.php
51 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationItemExtensionInterface.php
52 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultCollectionExtensionInterface.php
53 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultItemExtensionInterface.php
54 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Filter/FilterInterface.php
55 /vendor/api-platform/core/src/Doctrine/Orm/QueryAwareInterface.php
56 /vendor/api-platform/core/src/Doctrine/Orm/Util/QueryNameGeneratorInterface.php
57 /vendor/api-platform/core/src/Elasticsearch/Metadata/Document/Factory/DocumentMetadataFactoryInterface.php
58 /vendor/api-platform/core/src/Symfony/Validator/ValidationGroupsGeneratorInterface.php
59 /vendor/api-platform/core/src/Symfony/Validator/Exception/ConstraintViolationListAwareExceptionInterface.php
60 /vendor/api-platform/core/src/Exception/ExceptionInterface.php
61 /vendor/api-platform/core/src/Core/Bridge/Symfony/Validator/Metadata/Property/Restriction/PropertySchemaRestrictionMetadataInterface.php
62 /vendor/api-platform/core/src/State/Pagination/PaginatorInterface.php
63 /vendor/api-platform/core/src/State/Pagination/PartialPaginatorInterface.php
64 /vendor/api-platform/core/src/Documentation/DocumentationInterface.php
65 /vendor/api-platform/core/src/JsonLd/AnonymousContextBuilderInterface.php
66 /vendor/api-platform/core/src/JsonLd/ContextBuilderInterface.php
67 /vendor/api-platform/core/src/Core/JsonSchema/SchemaFactoryInterface.php
68 /vendor/api-platform/core/src/JsonSchema/TypeFactoryInterface.php
69 /vendor/api-platform/core/src/OpenApi/Factory/OpenApiFactoryInterface.php
70 /vendor/api-platform/core/src/PathResolver/OperationPathResolverInterface.php
71 /vendor/api-platform/core/src/Symfony/Security/ResourceAccessCheckerInterface.php
72 /vendor/api-platform/core/src/Serializer/Filter/FilterInterface.php
73 /vendor/api-platform/core/src/Serializer/SerializerContextBuilderInterface.php
74 /vendor/api-platform/core/src/Validator/ValidatorInterface.php
75 /vendor/api-platform/core/src/Api/UrlGeneratorInterface.php
76 /vendor/api-platform/core/src/GraphQl/ExecutorInterface.php
77 /vendor/api-platform/core/src/GraphQl/Error/ErrorHandlerInterface.php
78 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ValidateStageInterface.php
79 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ReadStageInterface.php
80 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityPostDenormalizeStageInterface.php
81 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityStageInterface.php
82 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/WriteStageInterface.php
83 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SerializeStageInterface.php
84 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/DeserializeStageInterface.php
85 /vendor/api-platform/core/src/GraphQl/Resolver/QueryItemResolverInterface.php
86 /vendor/api-platform/core/src/GraphQl/Resolver/QueryCollectionResolverInterface.php
87 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Factory/ResolverFactoryInterface.php
88 /vendor/api-platform/core/src/GraphQl/Resolver/MutationResolverInterface.php
89 /vendor/api-platform/core/src/Core/GraphQl/Subscription/MercureSubscriptionIriGeneratorInterface.php
90 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionIdentifierGeneratorInterface.php
91 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionManagerInterface.php
92 /vendor/api-platform/core/src/Core/GraphQl/Serializer/SerializerContextBuilderInterface.php
93 /vendor/api-platform/core/src/GraphQl/Type/TypesFactoryInterface.php
94 /vendor/api-platform/core/src/GraphQl/Type/Definition/TypeInterface.php
95 /vendor/api-platform/core/src/GraphQl/Type/TypesContainerInterface.php
96 /vendor/psr/container/src/ContainerInterface.php
97 /vendor/api-platform/core/src/Operation/PathSegmentNameGeneratorInterface.php
98 /vendor/ircmaxell/password-compat/lib/password.php
99 /vendor/martinlindhe/php-mb-helpers/src/mb_helpers.php
100 /vendor/prestashop/laminas-code-lts/polyfill/ReflectionEnumPolyfill.php
101 /src/Core/Version.php
102 /config/alias.php
103 /vendor/prestashop/autoload/src/PrestashopAutoload.php
104 /vendor/prestashop/autoload/src/LegacyClassLoader.php
105 /vendor/symfony/symfony/src/Symfony/Component/Filesystem/Filesystem.php
106 /vendor/prestashop/autoload/src/Autoloader.php
107 /config/bootstrap.php
108 /src/Core/ContainerBuilder.php
109 /src/Core/Foundation/IoC/Container.php
110 /src/Adapter/ServiceLocator.php
111 /var/cache/prod/appParameters.php
114 /var/cache/prod/class_index.php
115 /classes/controller/Controller.php
117 /classes/ObjectModel.php
118 /src/Core/Foundation/Database/EntityInterface.php
120 /classes/db/Db.php
122 /classes/Hook.php
124 /classes/module/Module.php
125 /src/Core/Module/Legacy/ModuleInterface.php
127 /classes/Tools.php
128 /classes/Context.php
129 /classes/shop/Shop.php
130 /src/Core/Security/PasswordGenerator.php
131 /classes/db/DbPDO.php
132 /classes/AddressFormat.php
133 /classes/cache/Cache.php
134 /classes/cache/CacheMemcached.php
135 /config/db_slave_server.inc.php
136 /src/Core/Security/Hashing.php
137 /classes/Configuration.php
138 /classes/Validate.php
139 /src/Adapter/EntityMapper.php
140 /classes/db/DbQuery.php
141 /src/Core/Addon/Theme/ThemeManagerBuilder.php
142 /vendor/psr/log/Psr/Log/NullLogger.php
143 /vendor/psr/log/Psr/Log/AbstractLogger.php
144 /vendor/psr/log/Psr/Log/LoggerInterface.php
145 /src/Adapter/Configuration.php
146 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ParameterBag.php
147 /src/Core/Domain/Configuration/ShopConfigurationInterface.php
148 /src/Core/ConfigurationInterface.php
149 /src/Core/Addon/Theme/ThemeRepository.php
150 /src/Core/Addon/AddonRepositoryInterface.php
151 /src/Core/Domain/Shop/ValueObject/ShopConstraint.php
152 /src/Core/Addon/Theme/Theme.php
153 /src/Core/Addon/AddonInterface.php
154 /src/Core/Util/ArrayFinder.php
155 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccess.php
156 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorBuilder.php
157 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessor.php
158 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorInterface.php
159 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPath.php
160 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPathInterface.php
161 /config/defines_uri.inc.php
162 /classes/Language.php
163 /src/Core/Language/LanguageInterface.php
164 /classes/Country.php
165 /classes/PrestaShopCollection.php
166 /classes/shop/ShopGroup.php
167 /classes/Cookie.php
168 /classes/PhpEncryption.php
169 /classes/PhpEncryptionEngine.php
170 /vendor/defuse/php-encryption/src/Key.php
171 /vendor/defuse/php-encryption/src/Encoding.php
172 /vendor/defuse/php-encryption/src/Core.php
173 /vendor/defuse/php-encryption/src/Crypto.php
174 /vendor/defuse/php-encryption/src/KeyOrPassword.php
175 /vendor/defuse/php-encryption/src/RuntimeTests.php
176 /vendor/defuse/php-encryption/src/DerivedKeys.php
177 /vendor/defuse/php-encryption/src/Exception/WrongKeyOrModifiedCiphertextException.php
178 /vendor/defuse/php-encryption/src/Exception/CryptoException.php
179 /src/Core/Session/SessionHandler.php
180 /src/Core/Session/SessionHandlerInterface.php
181 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Session.php
182 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBag.php
183 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBagInterface.php
184 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagInterface.php
185 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBag.php
186 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBagInterface.php
187 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagProxy.php
188 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionInterface.php
189 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/PhpBridgeSessionStorage.php
190 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/NativeSessionStorage.php
191 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/MetadataBag.php
192 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/StrictSessionHandler.php
193 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/AbstractSessionHandler.php
194 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/SessionHandlerProxy.php
195 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/AbstractProxy.php
196 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/SessionStorageInterface.php
197 /config/smarty.config.inc.php
198 /vendor/smarty/smarty/libs/Smarty.class.php
199 /vendor/smarty/smarty/libs/functions.php
200 /vendor/smarty/smarty/libs/Autoloader.php
201 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_data.php
202 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_extension_handler.php
203 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php
204 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php
205 /vendor/smarty/smarty/libs/sysplugins/smarty_resource.php
206 /vendor/smarty/smarty/libs/sysplugins/smarty_variable.php
207 /vendor/smarty/smarty/libs/sysplugins/smarty_template_source.php
208 /vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php
209 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_resource_file.php
210 /config/smartyfront.config.inc.php
211 /classes/Smarty/SmartyResourceModule.php
212 /vendor/smarty/smarty/libs/sysplugins/smarty_resource_custom.php
213 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerresource.php
214 /classes/Smarty/SmartyResourceParent.php
215 /classes/Smarty/SmartyLazyRegister.php
216 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerplugin.php
217 /vendor/smarty/smarty/libs/plugins/modifier.truncate.php
218 /classes/Customer.php
219 /classes/Group.php
220 /override/classes/Link.php
221 /classes/Link.php
222 /classes/shop/ShopUrl.php
223 /override/classes/Dispatcher.php
224 /classes/Dispatcher.php
225 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Request.php
226 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeader.php
227 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeaderItem.php
228 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/FileBag.php
229 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderBag.php
230 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderUtils.php
231 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ServerBag.php
232 /src/Adapter/SymfonyContainer.php
233 /vendor/mobiledetect/mobiledetectlib/Mobile_Detect.php
234 /modules/ph_simpleblog/ph_simpleblog.php
235 /modules/ph_simpleblog/assets/phpthumb/ThumbLib.inc.php
236 /modules/ph_simpleblog/assets/phpthumb/PhpThumb.inc.php
237 /modules/ph_simpleblog/assets/phpthumb/ThumbBase.inc.php
238 /modules/ph_simpleblog/assets/phpthumb/GdThumb.inc.php
239 /modules/ph_simpleblog/vendor/autoload.php
240 /modules/ph_simpleblog/vendor/composer/autoload_real.php
241 /modules/ph_simpleblog/vendor/composer/platform_check.php
242 /modules/ph_simpleblog/vendor/composer/autoload_static.php
243 /modules/ph_simpleblog/models/SimpleBlogCategory.php
244 /modules/ph_simpleblog/models/SimpleBlogPost.php
245 /modules/ph_simpleblog/models/SimpleBlogPostType.php
246 /modules/ph_simpleblog/models/SimpleBlogPostImage.php
247 /modules/ph_simpleblog/models/SimpleBlogTag.php
248 /modules/ph_simpleblog/models/SimpleBlogComment.php
249 /modules/ph_simpleblog/models/SimpleBlogPostAuthor.php
250 /modules/ph_simpleblog/classes/SimpleBlogHelper.php
251 /modules/ph_simpleblog/classes/BlogPostsFinder.php
252 /modules/ph_simpleblog/controllers/front/default_list.php
253 /classes/controller/ModuleFrontController.php
254 /override/classes/controller/FrontController.php
255 /classes/controller/FrontController.php
256 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_createdata.php
257 /vendor/smarty/smarty/libs/sysplugins/smarty_data.php
258 /classes/Translate.php
259 /modules/ph_simpleblog/translations/fr.php
260 /src/PrestaShopBundle/Translation/TranslatorComponent.php
261 /vendor/symfony/symfony/src/Symfony/Component/Translation/Translator.php
262 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorInterface.php
263 /vendor/symfony/contracts/Translation/LocaleAwareInterface.php
264 /vendor/symfony/contracts/Translation/TranslatorInterface.php
265 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorBagInterface.php
266 /src/PrestaShopBundle/Translation/PrestaShopTranslatorTrait.php
267 /src/PrestaShopBundle/Translation/TranslatorLanguageTrait.php
268 /src/PrestaShopBundle/Translation/TranslatorInterface.php
269 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatter.php
270 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatter.php
271 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatterInterface.php
272 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatterInterface.php
273 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/ChoiceMessageFormatterInterface.php
274 /vendor/symfony/symfony/src/Symfony/Component/Translation/IdentityTranslator.php
275 /vendor/symfony/contracts/Translation/TranslatorTrait.php
276 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactory.php
277 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactoryInterface.php
278 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCache.php
279 /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerConfigCache.php
280 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheInterface.php
281 /var/cache/prod/translations/catalogue.fr-FR.NXhscRe.php
282 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogue.php
283 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogueInterface.php
284 /vendor/symfony/symfony/src/Symfony/Component/Translation/MetadataAwareInterface.php
285 /controllers/front/listing/CategoryController.php
286 /classes/controller/ProductListingFrontController.php
287 /classes/controller/ProductPresentingFrontController.php
288 /src/Adapter/Presenter/Object/ObjectPresenter.php
289 /src/Adapter/Presenter/PresenterInterface.php
290 /src/Adapter/Presenter/Cart/CartPresenter.php
291 /src/Adapter/Image/ImageRetriever.php
292 /classes/tax/TaxConfiguration.php
293 /classes/Smarty/TemplateFinder.php
294 /classes/assets/StylesheetManager.php
295 /classes/assets/AbstractAssetManager.php
296 /src/Adapter/Assets/AssetUrlGeneratorTrait.php
297 /classes/assets/JavascriptManager.php
298 /classes/assets/CccReducer.php
299 /modules/iqitthemeeditor/iqitthemeeditor.php
300 /modules/iqitthemeeditor/src/IqitSmartyModifiers.php
301 /modules/iqitthemeeditor/translations/fr.php
302 /classes/Category.php
303 /classes/webservice/WebserviceRequest.php
304 /src/Adapter/ContainerBuilder.php
305 /src/Adapter/Environment.php
306 /src/Core/EnvironmentInterface.php
307 /vendor/symfony/symfony/src/Symfony/Component/Cache/DoctrineProvider.php
308 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/CacheProvider.php
309 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Cache.php
310 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/FlushableCache.php
311 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/ClearableCache.php
312 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiOperationCache.php
313 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiGetCache.php
314 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiDeleteCache.php
315 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiPutCache.php
316 /vendor/symfony/symfony/src/Symfony/Component/Cache/PruneableInterface.php
317 /vendor/symfony/symfony/src/Symfony/Component/Cache/ResettableInterface.php
318 /vendor/symfony/contracts/Service/ResetInterface.php
319 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/ArrayAdapter.php
320 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ArrayTrait.php
321 /vendor/psr/log/Psr/Log/LoggerAwareTrait.php
322 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AdapterInterface.php
323 /vendor/symfony/symfony/src/Symfony/Component/Cache/CacheItem.php
324 /vendor/symfony/contracts/Cache/ItemInterface.php
325 /vendor/psr/cache/src/CacheItemInterface.php
326 /vendor/psr/cache/src/CacheItemPoolInterface.php
327 /vendor/symfony/contracts/Cache/CacheInterface.php
328 /vendor/psr/log/Psr/Log/LoggerAwareInterface.php
329 /vendor/doctrine/orm/lib/Doctrine/ORM/Tools/Setup.php
330 /vendor/doctrine/deprecations/lib/Doctrine/Deprecations/Deprecation.php
331 /vendor/doctrine/orm/lib/Doctrine/ORM/Configuration.php
332 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Configuration.php
333 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/CacheAdapter.php
334 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/DoctrineProvider.php
335 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationReader.php
336 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Reader.php
337 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationRegistry.php
338 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/DoctrineAnnotations.php
339 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Annotation.php
340 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Entity.php
341 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embeddable.php
342 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embedded.php
343 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/MappedSuperclass.php
344 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/InheritanceType.php
345 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorColumn.php
346 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorMap.php
347 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Id.php
348 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/GeneratedValue.php
349 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Version.php
350 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumn.php
351 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumns.php
352 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Column.php
353 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToOne.php
354 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToMany.php
355 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToOne.php
356 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToMany.php
357 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Table.php
358 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/UniqueConstraint.php
359 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Index.php
360 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinTable.php
361 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SequenceGenerator.php
362 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/CustomIdGenerator.php
363 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ChangeTrackingPolicy.php
364 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OrderBy.php
365 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQueries.php
366 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQuery.php
367 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/HasLifecycleCallbacks.php
368 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PrePersist.php
369 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostPersist.php
370 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreUpdate.php
371 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostUpdate.php
372 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreRemove.php
373 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostRemove.php
374 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostLoad.php
375 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreFlush.php
376 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/FieldResult.php
377 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ColumnResult.php
378 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityResult.php
379 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQuery.php
380 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQueries.php
381 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMapping.php
382 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMappings.php
383 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverride.php
384 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverrides.php
385 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverride.php
386 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverrides.php
387 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityListeners.php
388 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Cache.php
389 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/SimpleAnnotationReader.php
390 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocParser.php
391 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocLexer.php
392 /vendor/doctrine/lexer/lib/Doctrine/Common/Lexer/AbstractLexer.php
393 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Target.php
394 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/AnnotationDriver.php
395 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/CompatibilityAnnotationDriver.php
396 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/MappingDriver.php
397 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/ColocatedMappingDriver.php
398 /var/cache/prod/FrontContainer.php
399 /src/Adapter/Container/LegacyContainer.php
400 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Container.php
401 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/RewindableGenerator.php
402 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/ServiceLocator.php
403 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ServiceLocator.php
404 /vendor/symfony/contracts/Service/ServiceLocatorTrait.php
405 /vendor/psr/container/src/ContainerExceptionInterface.php
406 /vendor/psr/container/src/NotFoundExceptionInterface.php
407 /vendor/symfony/contracts/Service/ServiceProviderInterface.php
408 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ResettableContainerInterface.php
409 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ContainerInterface.php
410 /src/Adapter/Container/LegacyContainerInterface.php
411 /modules/ps_categorytree/vendor/autoload.php
412 /modules/ps_categorytree/vendor/composer/autoload_real.php
413 /modules/ps_categorytree/vendor/composer/platform_check.php
414 /modules/ps_categorytree/vendor/composer/autoload_static.php
415 /modules/ps_facetedsearch/vendor/autoload.php
416 /modules/ps_facetedsearch/vendor/composer/autoload_real.php
417 /modules/ps_facetedsearch/vendor/composer/platform_check.php
418 /modules/ps_facetedsearch/vendor/composer/autoload_static.php
419 /modules/contactform/vendor/autoload.php
420 /modules/contactform/vendor/composer/autoload_real.php
421 /modules/contactform/vendor/composer/platform_check.php
422 /modules/contactform/vendor/composer/autoload_static.php
423 /modules/ps_sharebuttons/vendor/autoload.php
424 /modules/ps_sharebuttons/vendor/composer/autoload_real.php
425 /modules/ps_sharebuttons/vendor/composer/platform_check.php
426 /modules/ps_sharebuttons/vendor/composer/autoload_static.php
427 /modules/gsitemap/vendor/autoload.php
428 /modules/gsitemap/vendor/composer/autoload_real.php
429 /modules/gsitemap/vendor/composer/platform_check.php
430 /modules/gsitemap/vendor/composer/autoload_static.php
431 /modules/ps_crossselling/vendor/autoload.php
432 /modules/ps_crossselling/vendor/composer/autoload_real.php
433 /modules/ps_crossselling/vendor/composer/platform_check.php
434 /modules/ps_crossselling/vendor/composer/autoload_static.php
435 /modules/ps_themecusto/vendor/autoload.php
436 /modules/ps_themecusto/vendor/composer/autoload_real.php
437 /modules/ps_themecusto/vendor/composer/platform_check.php
438 /modules/ps_themecusto/vendor/composer/autoload_static.php
439 /modules/ps_supplierlist/vendor/autoload.php
440 /modules/ps_supplierlist/vendor/composer/autoload_real.php
441 /modules/ps_supplierlist/vendor/composer/platform_check.php
442 /modules/ps_supplierlist/vendor/composer/autoload_static.php
443 /modules/ps_googleanalytics/vendor/autoload.php
444 /modules/ps_googleanalytics/vendor/composer/autoload_real.php
445 /modules/ps_googleanalytics/vendor/composer/platform_check.php
446 /modules/ps_googleanalytics/vendor/composer/autoload_static.php
447 /modules/statssearch/vendor/autoload.php
448 /modules/statssearch/vendor/composer/autoload_real.php
449 /modules/statssearch/vendor/composer/platform_check.php
450 /modules/statssearch/vendor/composer/autoload_static.php
451 /modules/ps_categoryproducts/vendor/autoload.php
452 /modules/ps_categoryproducts/vendor/composer/autoload_real.php
453 /modules/ps_categoryproducts/vendor/composer/platform_check.php
454 /modules/ps_categoryproducts/vendor/composer/autoload_static.php
455 /modules/ps_wirepayment/vendor/autoload.php
456 /modules/ps_wirepayment/vendor/composer/autoload_real.php
457 /modules/ps_wirepayment/vendor/composer/platform_check.php
458 /modules/ps_wirepayment/vendor/composer/autoload_static.php
459 /modules/statsregistrations/vendor/autoload.php
460 /modules/statsregistrations/vendor/composer/autoload_real.php
461 /modules/statsregistrations/vendor/composer/platform_check.php
462 /modules/statsregistrations/vendor/composer/autoload_static.php
463 /modules/ps_distributionapiclient/vendor/autoload.php
464 /modules/ps_distributionapiclient/vendor/composer/autoload_real.php
465 /modules/ps_distributionapiclient/vendor/composer/platform_check.php
466 /modules/ps_distributionapiclient/vendor/composer/autoload_static.php
467 /modules/ps_distributionapiclient/vendor/symfony/polyfill-intl-grapheme/bootstrap.php
468 /modules/ps_distributionapiclient/vendor/symfony/string/Resources/functions.php
469 /modules/ps_emailalerts/vendor/autoload.php
470 /modules/ps_emailalerts/vendor/composer/autoload_real.php
471 /modules/ps_emailalerts/vendor/composer/platform_check.php
472 /modules/ps_emailalerts/vendor/composer/autoload_static.php
473 /modules/ps_brandlist/vendor/autoload.php
474 /modules/ps_brandlist/vendor/composer/autoload_real.php
475 /modules/ps_brandlist/vendor/composer/platform_check.php
476 /modules/ps_brandlist/vendor/composer/autoload_static.php
477 /modules/ps_viewedproduct/vendor/autoload.php
478 /modules/ps_viewedproduct/vendor/composer/autoload_real.php
479 /modules/ps_viewedproduct/vendor/composer/platform_check.php
480 /modules/ps_viewedproduct/vendor/composer/autoload_static.php
481 /modules/iqitsociallogin/vendor/autoload.php
482 /modules/iqitsociallogin/vendor/composer/autoload_real.php
483 /modules/iqitsociallogin/vendor/composer/platform_check.php
484 /modules/iqitsociallogin/vendor/composer/autoload_static.php
485 /modules/gmerchantcenterpro/vendor/autoload.php
486 /modules/gmerchantcenterpro/vendor/composer/autoload_real.php
487 /modules/gmerchantcenterpro/vendor/composer/platform_check.php
488 /modules/gmerchantcenterpro/vendor/composer/autoload_static.php
489 /modules/wizardai/vendor/autoload.php
490 /modules/wizardai/vendor/composer/autoload_real.php
491 /modules/wizardai/vendor/composer/platform_check.php
492 /modules/wizardai/vendor/composer/autoload_static.php
493 /modules/wizardai/vendor/clue/stream-filter/src/functions_include.php
494 /modules/wizardai/vendor/clue/stream-filter/src/functions.php
495 /modules/wizardai/vendor/guzzlehttp/psr7/src/functions_include.php
496 /modules/wizardai/vendor/guzzlehttp/psr7/src/functions.php
497 /modules/wizardai/vendor/php-http/message/src/filters.php
498 /modules/wizardai/vendor/symfony/polyfill-apcu/bootstrap.php
499 /modules/stripe_official/vendor/autoload.php
500 /modules/stripe_official/vendor/composer/autoload_real.php
501 /modules/stripe_official/vendor/composer/platform_check.php
502 /modules/stripe_official/vendor/composer/autoload_static.php
503 /modules/vivawalletsmartcheckout/vendor/autoload.php
504 /modules/vivawalletsmartcheckout/vendor/composer/autoload_real.php
505 /modules/vivawalletsmartcheckout/vendor/composer/autoload_static.php
506 /modules/autoupgrade/vendor/autoload.php
507 /modules/autoupgrade/vendor/composer/autoload_real.php
508 /modules/autoupgrade/vendor/composer/autoload_static.php
509 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment.php
510 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Client.php
511 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer.php
512 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/QueueConsumer.php
513 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/File.php
514 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/ForkCurl.php
515 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/LibCurl.php
516 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/Socket.php
517 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Version.php
518 /modules/ps_faviconnotificationbo/vendor/autoload.php
519 /modules/ps_faviconnotificationbo/vendor/composer/autoload_real.php
520 /modules/ps_faviconnotificationbo/vendor/composer/platform_check.php
521 /modules/ps_faviconnotificationbo/vendor/composer/autoload_static.php
522 /src/Core/Localization/Locale/Repository.php
523 /src/Core/Localization/Locale/RepositoryInterface.php
524 /src/Core/Localization/CLDR/LocaleRepository.php
525 /src/Core/Localization/CLDR/LocaleDataSource.php
526 /src/Core/Localization/CLDR/DataLayer/LocaleCache.php
527 /src/Core/Data/Layer/AbstractDataLayer.php
528 /src/Core/Localization/CLDR/LocaleDataLayerInterface.php
529 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/FilesystemAdapter.php
530 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AbstractAdapter.php
531 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractAdapterTrait.php
532 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractTrait.php
533 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ContractsTrait.php
534 /vendor/symfony/contracts/Cache/CacheTrait.php
535 /vendor/psr/cache/src/InvalidArgumentException.php
536 /vendor/psr/cache/src/CacheException.php
537 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemTrait.php
538 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemCommonTrait.php
539 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/DefaultMarshaller.php
540 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/MarshallerInterface.php
541 /src/Core/Localization/CLDR/DataLayer/LocaleReference.php
542 /src/Core/Localization/CLDR/Reader.php
543 /src/Core/Localization/CLDR/ReaderInterface.php
544 /src/Core/Localization/Currency/Repository.php
545 /src/Core/Localization/Currency/RepositoryInterface.php
546 /src/Core/Localization/Currency/CurrencyDataSource.php
547 /src/Core/Localization/Currency/DataSourceInterface.php
548 /src/Core/Localization/Currency/DataLayer/CurrencyCache.php
549 /src/Core/Localization/Currency/CurrencyDataLayerInterface.php
550 /src/Core/Localization/Currency/DataLayer/CurrencyDatabase.php
551 /src/Adapter/Currency/CurrencyDataProvider.php
552 /src/Core/Currency/CurrencyDataProviderInterface.php
553 /src/Adapter/LegacyContext.php
554 /src/Adapter/Tools.php
555 /src/Core/Localization/Currency/DataLayer/CurrencyReference.php
556 /src/Core/Localization/Currency/DataLayer/CurrencyInstalled.php
557 /vendor/prestashop/decimal/src/Operation/Rounding.php
558 /src/Core/Localization/Locale.php
559 /src/Core/Localization/LocaleInterface.php
560 /src/Core/Localization/Specification/Price.php
561 /src/Core/Localization/Specification/Number.php
562 /src/Core/Localization/Specification/NumberInterface.php
563 /src/Core/Localization/Specification/Factory.php
564 /src/Core/Localization/CLDR/LocaleData.php
565 /src/Core/Localization/CLDR/NumberSymbolsData.php
566 /src/Core/Localization/CLDR/CurrencyData.php
567 /src/Core/Localization/CLDR/Locale.php
568 /src/Core/Localization/CLDR/LocaleInterface.php
569 /src/Core/Localization/Specification/NumberSymbolList.php
570 /classes/Currency.php
571 /src/Core/Localization/Currency/LocalizedCurrencyId.php
572 /src/Core/Localization/Currency/CurrencyData.php
573 /src/Core/Localization/Currency/CurrencyCollection.php
574 /src/Core/Localization/Currency.php
575 /src/Core/Localization/CurrencyInterface.php
576 /src/Core/Localization/Specification/NumberCollection.php
577 /src/Core/Localization/Number/Formatter.php
578 /classes/Cart.php
579 /src/Adapter/AddressFactory.php
580 /override/classes/CartRule.php
581 /classes/CartRule.php
582 /classes/Product.php
583 /src/Core/Domain/Product/ValueObject/RedirectType.php
584 /src/Core/Util/DateTime/DateTime.php
585 /src/Core/Domain/Product/Stock/ValueObject/OutOfStockType.php
586 /src/Core/Domain/Product/Pack/ValueObject/PackStockType.php
587 /src/Core/Domain/Product/ValueObject/ProductType.php
588 /src/Core/Domain/Product/ValueObject/Reference.php
589 /src/Core/Domain/Product/ValueObject/Ean13.php
590 /src/Core/Domain/Product/ValueObject/Isbn.php
591 /src/Core/Domain/Product/ValueObject/Upc.php
592 /src/Core/Domain/Product/ProductSettings.php
593 /src/Core/Domain/Shop/ValueObject/ShopId.php
594 /src/Core/Domain/Shop/ValueObject/ShopIdInterface.php
595 /modules/ps_emailalerts/ps_emailalerts.php
596 /modules/ps_emailalerts/MailAlert.php
597 /src/PrestaShopBundle/Translation/DomainNormalizer.php
598 /modules/facebookconversiontrackingplus/facebookconversiontrackingplus.php
599 /modules/facebookconversiontrackingplus/classes/autoload.php
600 /modules/facebookconversiontrackingplus/translations/fr.php
601 /modules/facebookconversiontrackingplus/classes/ConversionApi.php
602 /modules/facebookconversiontrackingplus/classes/PixelTools.php
603 /modules/facebookconversiontrackingplus/classes/IpGeolocation.php
604 /src/Core/Security/OpenSsl/OpenSSL.php
605 /src/Core/Security/OpenSsl/OpenSSLInterface.php
606 /modules/facebookconversiontrackingplus/classes/SmartForm.php
607 /override/classes/Media.php
608 /classes/Media.php
609 /src/Adapter/Presenter/Cart/CartLazyArray.php
610 /src/Adapter/Presenter/AbstractLazyArray.php
611 /src/Adapter/Product/PriceFormatter.php
612 /src/Core/Util/Inflector.php
613 /vendor/doctrine/inflector/lib/Doctrine/Inflector/InflectorFactory.php
614 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Language.php
615 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/InflectorFactory.php
616 /vendor/doctrine/inflector/lib/Doctrine/Inflector/GenericLanguageInflectorFactory.php
617 /vendor/doctrine/inflector/lib/Doctrine/Inflector/LanguageInflectorFactory.php
618 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Rules.php
619 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Ruleset.php
620 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformations.php
621 /vendor/doctrine/inflector/lib/Doctrine/Inflector/WordInflector.php
622 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Inflectible.php
623 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformation.php
624 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Pattern.php
625 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Patterns.php
626 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Uninflected.php
627 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitutions.php
628 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitution.php
629 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Word.php
630 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Inflector.php
631 /vendor/doctrine/inflector/lib/Doctrine/Inflector/CachedWordInflector.php
632 /vendor/doctrine/inflector/lib/Doctrine/Inflector/RulesetInflector.php
633 /classes/Gender.php
634 /classes/Risk.php
635 /classes/Meta.php
636 /modules/revsliderprestashop/revsliderprestashop.php
637 /modules/revsliderprestashop/rev-loader.php
638 /modules/revsliderprestashop/includes/revslider_db.class.php
639 /modules/revsliderprestashop/includes/data.class.php
640 /modules/revsliderprestashop/includes/functions.class.php
641 /modules/revsliderprestashop/includes/em-integration.class.php
642 /modules/revsliderprestashop/includes/cssparser.class.php
643 /modules/revsliderprestashop/includes/woocommerce.class.php
644 /modules/revsliderprestashop/includes/wpml.class.php
645 /modules/revsliderprestashop/includes/colorpicker.class.php
646 /modules/revsliderprestashop/includes/navigation.class.php
647 /modules/revsliderprestashop/includes/object-library.class.php
648 /modules/revsliderprestashop/admin/includes/loadbalancer.class.php
649 /modules/revsliderprestashop/admin/includes/plugin-update.class.php
650 /modules/revsliderprestashop/includes/extension.class.php
651 /modules/revsliderprestashop/includes/favorite.class.php
652 /modules/revsliderprestashop/includes/aq-resizer.class.php
653 /modules/revsliderprestashop/includes/external-sources.class.php
654 /modules/revsliderprestashop/includes/page-template.class.php
655 /modules/revsliderprestashop/includes/slider.class.php
656 /modules/revsliderprestashop/includes/slide.class.php
657 /modules/revsliderprestashop/includes/output.class.php
658 /modules/revsliderprestashop/public/revslider-front.class.php
659 /modules/revsliderprestashop/includes/backwards.php
660 /modules/revsliderprestashop/admin/includes/class-pclzip.php
661 /modules/revsliderprestashop/admin/includes/license.class.php
662 /modules/revsliderprestashop/admin/includes/addons.class.php
663 /modules/revsliderprestashop/admin/includes/template.class.php
664 /modules/revsliderprestashop/admin/includes/functions-admin.class.php
665 /modules/revsliderprestashop/admin/includes/folder.class.php
666 /modules/revsliderprestashop/admin/includes/import.class.php
667 /modules/revsliderprestashop/admin/includes/export.class.php
668 /modules/revsliderprestashop/admin/includes/export-html.class.php
669 /modules/revsliderprestashop/admin/includes/newsletter.class.php
670 /modules/revsliderprestashop/admin/revslider-admin.class.php
671 /modules/revsliderprestashop/includes/update.class.php
672 /modules/revsliderprestashop/includes/resize-imag.php
673 /modules/revsliderprestashop/translations/fr.php
674 /classes/Address.php
675 /classes/ImageType.php
676 /classes/State.php
677 /src/Core/Security/PasswordPolicyConfiguration.php
678 /src/Core/Configuration/DataConfigurationInterface.php
679 /src/Core/Filter/FrontEndObject/MainFilter.php
680 /src/Core/Filter/FilterInterface.php
681 /src/Core/Filter/FrontEndObject/CartFilter.php
682 /src/Core/Filter/HashMapWhitelistFilter.php
683 /src/Core/Filter/CollectionFilter.php
684 /src/Core/Filter/FrontEndObject/ProductFilter.php
685 /src/Core/Filter/FrontEndObject/EmbeddedAttributesFilter.php
686 /src/Core/Filter/FrontEndObject/CustomerFilter.php
687 /src/Core/Filter/FrontEndObject/ShopFilter.php
688 /src/Core/Filter/FrontEndObject/ConfigurationFilter.php
689 /modules/ps_shoppingcart/ps_shoppingcart.php
690 /src/Core/Module/WidgetInterface.php
691 /modules/ps_googleanalytics/ps_googleanalytics.php
692 /modules/ps_googleanalytics/classes/Hook/HookDisplayHeader.php
693 /modules/ps_googleanalytics/classes/Hook/HookInterface.php
694 /vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php
695 /var/cache/prod/smarty/compile/warehouse/ee/78/8a/ee788a7ffa4b95e0a488ef6dc4b9f3c8b40ce111_2.file.ps_googleanalytics.tpl.php
696 /vendor/smarty/smarty/libs/plugins/modifier.escape.php
697 /modules/iqitcompare/iqitcompare.php
698 /modules/iqitcompare/translations/fr.php
699 /modules/iqitcontactpage/iqitcontactpage.php
700 /modules/iqitcontactpage/translations/fr.php
701 /modules/iqitcookielaw/iqitcookielaw.php
702 /modules/iqitcookielaw/translations/fr.php
703 /modules/iqitcountdown/iqitcountdown.php
704 /modules/iqitcountdown/translations/fr.php
705 /modules/iqitelementor/iqitelementor.php
706 /modules/iqitelementor/src/IqitElementorLanding.php
707 /modules/iqitelementor/src/IqitElementorTemplate.php
708 /modules/iqitelementor/src/IqitElementorProduct.php
709 /modules/iqitelementor/src/IqitElementorCategory.php
710 /modules/iqitelementor/src/IqitElementorContent.php
711 /modules/iqitelementor/src/iqitElementorWpHelper.php
712 /modules/iqitelementor/includes/plugin-elementor.php
713 /modules/iqitelementor/src/widgets/IqitElementorWidget_Brands.php
714 /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsList.php
715 /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsListTabs.php
716 /modules/iqitelementor/src/widgets/IqitElementorWidget_Modules.php
717 /modules/iqitelementor/src/widgets/IqitElementorWidget_CustomTpl.php
718 /modules/iqitelementor/src/widgets/IqitElementorWidget_Menu.php
719 /modules/iqitelementor/src/widgets/IqitElementorWidget_RevolutionSlider.php
720 /modules/iqitelementor/src/widgets/IqitElementorWidget_Newsletter.php
721 /modules/iqitelementor/src/widgets/IqitElementorWidget_Blog.php
722 /modules/iqitelementor/src/widgets/IqitElementorWidget_Search.php
723 /modules/iqitelementor/src/widgets/IqitElementorWidget_Links.php
724 /modules/iqitelementor/src/widgets/IqitElementorWidget_ContactForm.php
725 /modules/iqitelementor/translations/fr.php
726 /modules/iqitfreedeliverycount/iqitfreedeliverycount.php
727 /modules/iqitfreedeliverycount/translations/fr.php
728 /modules/iqitmegamenu/iqitmegamenu.php
729 /modules/iqitmegamenu/models/IqitMenuTab.php
730 /modules/iqitmegamenu/models/IqitMenuHtml.php
731 /modules/iqitmegamenu/models/IqitMenuLinks.php
732 /modules/iqitmegamenu/translations/fr.php
733 /modules/iqitsizecharts/iqitsizecharts.php
734 /modules/iqitsizecharts/src/IqitSizeCharts.php
735 /modules/iqitsizecharts/translations/fr.php
736 /modules/iqitwishlist/iqitwishlist.php
737 /modules/iqitwishlist/src/IqitWishlistProduct.php
738 /modules/iqitwishlist/translations/fr.php
739 /modules/iqitextendedproduct/iqitextendedproduct.php
740 /modules/iqitextendedproduct/src/IqitThreeSixty.php
741 /modules/iqitextendedproduct/src/IqitProductVideo.php
742 /modules/iqitextendedproduct/translations/fr.php
743 /classes/assets/PrestashopAssetsLibraries.php
744 /modules/iqitsociallogin/iqitsociallogin.php
745 /modules/iqitsociallogin/translations/fr.php
746 /modules/gmerchantcenterpro/gmerchantcenterpro.php
747 /modules/gmerchantcenterpro/translations/fr.php
748 /modules/gmerchantcenterpro/lib/moduleTools.php
749 /modules/gmerchantcenterpro/conf/moduleConfiguration.php
750 /modules/gmerchantcenterpro/lib/moduleUpdate.php
751 /modules/gmerchantcenterpro/lib/install/installController.php
752 /modules/gmerchantcenterpro/lib/install/installSql.php
753 /modules/gmerchantcenterpro/lib/install/installInterface.php
754 /modules/gmerchantcenterpro/models/Feeds.php
755 /modules/gmerchantcenterpro/lib/hook/hookController.php
756 /modules/gmerchantcenterpro/lib/hook/hookDisplay.php
757 /modules/gmerchantcenterpro/lib/hook/hookBase.php
758 /modules/gmerchantcenterpro/lib/dao/moduleDao.php
759 /var/cache/prod/smarty/compile/warehouse/f7/5f/75/f75f75b788ebecd0995da205f357ac74693f8076_2.file.header.tpl.php
760 /modules/stripe_official/stripe_official.php
761 /classes/PaymentModule.php
762 /modules/stripe_official/vendor/stripe/stripe-php/lib/Event.php
763 /modules/stripe_official/vendor/stripe/stripe-php/lib/ApiResource.php
764 /modules/stripe_official/vendor/stripe/stripe-php/lib/StripeObject.php
765 /modules/stripe_official/vendor/stripe/stripe-php/lib/ApiOperations/Request.php
766 /modules/stripe_official/classes/services/PrestashopTranslationService.php
767 /src/Adapter/Localization/LegacyTranslator.php
768 /modules/stripe_official/smarty/plugins/modifier.stripelreplace.php
769 /modules/stripe_official/vendor/stripe/stripe-php/lib/Stripe.php
770 /modules/stripe_official/vendor/stripe/stripe-php/lib/Util/ApiVersion.php
771 /modules/wizardai/vendor/prestashop/module-lib-service-container/src/DependencyInjection/ServiceContainer.php
772 /modules/stripe_official/classes/services/StripeDisplayHeaderService.php
773 /modules/abandonedcart/abandonedcart.php
774 /modules/abandonedcart/classes/abandonedcart_core.php
775 /modules/abandonedcart/translations/fr.php
776 /var/cache/prod/smarty/compile/warehouse/7f/09/a0/7f09a045a9b3f592faaac1a3835665419330db11_2.file.abandonedcart_front.tpl.php
777 /modules/vivawalletsmartcheckout/vivawalletsmartcheckout.php
778 /modules/vivawalletsmartcheckout/src/Helpers/Config.php
779 /modules/vivawalletsmartcheckout/config/app.php
780 /modules/vivawalletsmartcheckout/src/Helpers/General.php
781 /modules/vivawalletsmartcheckout/translations/fr.php
782 /modules/vivawalletsmartcheckout/vendor/vivawallet/vivawallet-php/lib/Application.php
783 /src/Core/Product/Search/ProductSearchContext.php
784 /src/Core/Product/Search/ProductSearchQuery.php
785 /src/Core/Product/Search/SortOrder.php
786 /modules/ps_facetedsearch/ps_facetedsearch.php
787 /modules/ps_facetedsearch/src/HookDispatcher.php
788 /modules/ps_facetedsearch/src/Hook/Attribute.php
789 /modules/ps_facetedsearch/src/Hook/AbstractHook.php
790 /modules/ps_facetedsearch/src/Hook/AttributeGroup.php
791 /modules/ps_facetedsearch/src/Hook/Category.php
792 /modules/ps_facetedsearch/src/Hook/Configuration.php
793 /modules/ps_facetedsearch/src/Hook/Design.php
794 /modules/ps_facetedsearch/src/Hook/Feature.php
795 /modules/ps_facetedsearch/src/Form/Feature/FormModifier.php
796 /modules/ps_facetedsearch/src/Form/Feature/FormDataProvider.php
797 /modules/ps_facetedsearch/src/Hook/FeatureValue.php
798 /modules/ps_facetedsearch/src/Form/FeatureValue/FormModifier.php
799 /modules/ps_facetedsearch/src/Form/FeatureValue/FormDataProvider.php
800 /modules/ps_facetedsearch/src/Hook/Product.php
801 /modules/ps_facetedsearch/src/Hook/ProductSearch.php
802 /modules/ps_facetedsearch/src/Hook/SpecificPrice.php
803 /modules/ps_facetedsearch/src/Filters/Provider.php
804 /modules/ps_facetedsearch/src/URLSerializer.php
805 /modules/ps_facetedsearch/src/Filters/DataAccessor.php
806 /modules/ps_facetedsearch/src/Product/SearchProvider.php
807 /src/Core/Product/Search/FacetsRendererInterface.php
808 /src/Core/Product/Search/ProductSearchProviderInterface.php
809 /modules/ps_facetedsearch/src/Filters/Converter.php
810 /modules/ps_facetedsearch/src/Product/SearchFactory.php
811 /src/Core/Product/Search/ProductSearchResult.php
812 /modules/ps_facetedsearch/src/Product/Search.php
813 /modules/ps_facetedsearch/src/Adapter/MySQL.php
814 /modules/ps_facetedsearch/src/Adapter/AbstractAdapter.php
815 /modules/ps_facetedsearch/src/Adapter/InterfaceAdapter.php
816 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ArrayCollection.php
817 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Collection.php
818 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ReadableCollection.php
819 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Selectable.php
820 /modules/ps_facetedsearch/src/Filters/Products.php
821 /classes/stock/StockAvailable.php
822 /modules/ps_facetedsearch/src/Filters/Block.php
823 /modules/ps_facetedsearch/src/Definition/Availability.php
824 /src/Core/Product/Search/Facet.php
825 /src/Core/Product/Search/Filter.php
826 /vendor/prestashop/decimal/src/DecimalNumber.php
827 /vendor/prestashop/decimal/src/Builder.php
828 /src/Core/Product/Search/FacetCollection.php
829 /classes/ProductAssembler.php
830 /classes/Combination.php
831 /classes/tax/Tax.php
832 /classes/Manufacturer.php
833 /classes/SpecificPrice.php
834 /classes/tax/TaxManagerFactory.php
835 /classes/tax/TaxRulesTaxManager.php
836 /classes/tax/TaxManagerInterface.php
837 /classes/tax/TaxCalculator.php
838 /classes/GroupReduction.php
839 /src/Core/Localization/CLDR/ComputingPrecision.php
840 /src/Core/Localization/CLDR/ComputingPrecisionInterface.php
841 /classes/Pack.php
842 /override/classes/order/Order.php
843 /classes/order/Order.php
844 /classes/Feature.php
845 /classes/ProductPresenterFactory.php
846 /src/Adapter/Presenter/Product/ProductListingPresenter.php
847 /src/Adapter/Presenter/Product/ProductPresenter.php
848 /src/Adapter/Product/ProductColorsRetriever.php
849 /src/Adapter/HookManager.php
850 /src/Core/Product/ProductPresentationSettings.php
851 /src/Adapter/Presenter/Product/ProductListingLazyArray.php
852 /src/Adapter/Presenter/Product/ProductLazyArray.php
853 /classes/Image.php
854 /src/Core/Image/ImageFormatConfiguration.php
855 /src/Core/Image/ImageFormatConfigurationInterface.php
856 /classes/FeatureFlag.php
857 /src/Core/FeatureFlag/FeatureFlagSettings.php
858 /vendor/prestashop/decimal/src/Operation/Multiplication.php
859 /vendor/prestashop/decimal/src/Operation/Addition.php
860 /var/cache/prod/smarty/compile/warehouse/d4/1d/65/d41d65d76b9471b5d365fe06cf1737c89a53af9f_2.module.ps_facetedsearchviewstemplatesfrontcatalogfacets.tpl.php
861 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_block.php
862 /vendor/smarty/smarty/libs/plugins/modifier.count.php
863 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php
864 /var/cache/prod/smarty/compile/warehouse/fb/ea/98/fbea98a84e509d7477392fb3e2519b1e908ae1d0_2.module.ps_facetedsearchviewstemplatesfrontcatalogfacetsdropdown.tpl.php
865 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_foreach.php
866 /var/cache/prod/smarty/compile/warehouse/2e/80/73/2e807335546cfa2360c36327ac89dd2fcb054379_2.module.ps_facetedsearchviewstemplatesfrontcatalogactivefilters.tpl.php
867 /src/Core/Product/Search/Pagination.php
868 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/a7/2d/dc/a72ddcc3457e523238167bfb787364e010571602_2.file.category.tpl.php
869 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_capture.php
870 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/90/cf/46/90cf4679dc49439c314d4747bbab91e7cd883211_2.file.product-list.tpl.php
871 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/20/1d/59/201d594b12ddb0579e97d2d00a38f32349d7f8e2_2.file.layout-full-width.tpl.php
872 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/9f/c0/0d/9fc00de9dab18af4bad561c5978e37a5cf7ba8dc_2.file.layout-both-columns.tpl.php
873 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/cb/45/38/cb4538e80db186323bd2c849a93c3a874eb9fa44_2.file.helpers.tpl.php
874 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_tplfunction.php
875 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/a3/5d/99/a35d9996c0259409d557b9de6f17182667bd08c0_2.file.head.tpl.php
876 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/d8/66/63/d8666378896e3199131756b2a049789ce82f9145_2.file.head-jsonld.tpl.php
877 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/8e/7c/ff/8e7cff5cfb78f6670e25ee2a2964eb6ccbe1b9d5_2.file.product-list-jsonld.tpl.php
878 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/b5/08/e2/b508e285f88ade9f85c8711af34aa86844c85366_2.file.pagination-seo.tpl.php
879 /vendor/smarty/smarty/libs/plugins/modifier.replace.php
880 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/52/ed/5b/52ed5bf4088d07f918e31ad1872568dff1a15122_2.file.stylesheets.tpl.php
881 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/2a/77/40/2a7740ed942475bcc06c5e40d5346b6b574f1441_2.file.javascript.tpl.php
882 /classes/ProductDownload.php
883 /src/Core/Cart/Calculator.php
884 /src/Core/Cart/CartRowCollection.php
885 /src/Core/Cart/Fees.php
886 /src/Core/Cart/AmountImmutable.php
887 /src/Core/Cart/CartRuleCollection.php
888 /src/Core/Cart/CartRuleCalculator.php
889 /src/Adapter/Product/PriceCalculator.php
890 /src/Core/Cart/CartRow.php
891 /vendor/symfony/symfony/src/Symfony/Component/Translation/PluralizationRules.php
892 /src/Core/Util/String/StringModifier.php
893 /src/Core/Util/String/StringModifierInterface.php
894 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/05/ac/4e/05ac4e59da39afc94ba29fd4c5bed100b6b3da19_2.file.product-activation.tpl.php
895 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/05/4d/41/054d41abc5a541ea4fd30d63caa94ec106d2993b_2.file.header.tpl.php
896 /modules/iqitlinksmanager/iqitlinksmanager.php
897 /modules/iqitlinksmanager/src/IqitLinkBlockRepository.php
898 /modules/iqitlinksmanager/src/IqitLinkBlock.php
899 /modules/iqitlinksmanager/src/IqitLinkBlockPresenter.php
900 /modules/iqitlinksmanager/translations/fr.php
901 /vendor/smarty/smarty/libs/sysplugins/smarty_template_cached.php
902 /vendor/smarty/smarty/libs/sysplugins/smarty_cacheresource.php
903 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_cacheresource_file.php
904 /var/cache/prod/smarty/cache/iqitlinksmanager/1/1/1/21/displayNav1/warehouse/a9/f2/c1/a9f2c1869604c8c628073c46891a26fcf1453e27.iqitlinksmanagerviewstemplateshookiqitlinksmanager.tpl.php
905 /modules/ps_languageselector/ps_languageselector.php
906 /modules/ps_currencyselector/ps_currencyselector.php
907 /var/cache/prod/smarty/compile/warehouse/73/27/77/73277702161b17505d668b28b8368941cf42c568_2.module.iqitwishlistviewstemplateshookdisplaynav.tpl.php
908 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/03/c2/a5/03c2a55aa51a9b7d61e7f129a111606f12475287_2.file.header-3.tpl.php
909 /modules/iqitsearch/iqitsearch.php
910 /modules/iqitsearch/translations/fr.php
911 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_gettemplatevars.php
912 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/d9/9b/94/d99b947421dcff226f28b1d6cb674c91f17399db_2.module.iqitsearchviewstemplateshookiqitsearchbtn.tpl.php
913 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/46/29/db/4629dbb3c4efa13c090c633dc2e46e5f2b42bed3_2.module.iqitsearchviewstemplateshooksearchbar.tpl.php
914 /modules/ps_customersignin/ps_customersignin.php
915 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/72/be/19/72be192e406191c1cad554abe284e159adeb4234_2.module.ps_customersigninps_customersigninbtn.tpl.php
916 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/b4/a4/76/b4a476e0a8201677b298f7c0f8ca1ac698e1bac3_2.module.ps_shoppingcartps_shoppingcartbtn.tpl.php
917 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/35/65/5e/35655e6409b6198f29dd6e732ef9598dec599880_2.module.ps_shoppingcartps_shoppingcart.tpl.php
918 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/f6/e9/f2/f6e9f2b1680a466582d2199d038efe2cfa3a83f7_2.module.ps_shoppingcartps_shoppingcartcontent.tpl.php
919 /var/cache/prod/smarty/cache/iqitmegamenu/index/1/1/1/21/warehouse/70/ca/47/70ca47640f8f16a0dd1dc3b1fce177bbeed38257.iqitmegamenuviewstemplateshookhorizontal.tpl.php
920 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/ce/2d/19/ce2d19cd13f5f27943d104183b745be20e3618a6_2.file.mobile-header-1.tpl.php
921 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/7a/30/38/7a3038780284d52e9fcd7a66e51e5b86a166106b_2.module.iqitsearchviewstemplateshooksearchbarmobile.tpl.php
922 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/be/ee/e6/beeee6f3d87613010f8af1cabc4c4562f8cf600a_2.module.ps_customersigninps_customersigninmobile.tpl.php
923 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/d4/e1/57/d4e1571b6b210795247564db06deb17061778b51_2.module.ps_shoppingcartps_shoppingcartmqty.tpl.php
924 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/28/b8/a6/28b8a6fb36f22bef1e0b5c53910267c19ceae859_2.file.breadcrumb.tpl.php
925 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/f1/e6/1e/f1e61e7ca59d67ddb45735d3ba11885aabdcd7c1_2.file.notifications.tpl.php
926 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/1d/15/44/1d154420732e4f5ec7164570156b8e82b8e743cc_2.file.category-header.tpl.php
927 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/08/3f/fe/083ffef0b3aeb82a59679210de0513024cfa645a_2.file.category-subcategories.tpl.php
928 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/8f/2c/f2/8f2cf264e8ef24eff54cdc3881bd1071ff6abcc5_2.file.products-top.tpl.php
929 /vendor/smarty/smarty/libs/plugins/modifier.regex_replace.php
930 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/ca/43/26/ca432646d2c581a6631dbab0f8a0ded19562cc5d_2.file.sort-orders.tpl.php
931 /var/cache/prod/smarty/compile/warehouse/81/a1/04/81a1040ed0eeab6f58198f9907167c7fced628c5_2.module.ps_facetedsearchps_facetedsearch.tpl.php
932 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/52/57/07/52570740bcdee3193f952d35d0d11ce53ff537f4_2.file.products.tpl.php
933 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/45/91/09/4591095b1d399add495fc541674f2fceb9d0f0e3_2.file.product.tpl.php
934 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/cb/91/6c/cb916c508b6fcc743788f1d7f95631e94668cb9d_2.file.product-miniature-1.tpl.php
935 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/31/03/a9/3103a9a485af7d714612ac0c47dbcfbc05c4fd95_2.file.product-miniature-thumb.tpl.php
936 /var/cache/prod/smarty/compile/warehouse/e9/21/d5/e921d51c062189725606e51308456f33ad945843_2.module.iqitwishlistviewstemplateshookproductminiature.tpl.php
937 /var/cache/prod/smarty/compile/warehouse/90/53/a0/9053a0dd520a39bef75969a0e9efeeae750df91b_2.module.iqitcompareviewstemplateshookproductminiature.tpl.php
938 /var/cache/prod/smarty/compile/warehouse/55/c7/a8/55c7a89f423f7f64b1b84881dcb668e4d788f013_2.module.iqitcountdownviewstemplateshookproduct.tpl.php
939 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/6c/98/2d/6c982d5090ff11db9654f1a7f6945865bc19603f_2.file.product-miniature-btn.tpl.php
940 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/8f/7a/83/8f7a832567456fbcc9b33e35ba7ca0da997b29d7_2.file.pagination.tpl.php
941 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/b1/d3/1b/b1d31b2d2e40bf3996d3350fd9793c705dd5bee6_2.file.products-bottom.tpl.php
942 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/e8/79/87/e87987b9e84bb947f6c535f03253877e87b62912_2.file.category-footer.tpl.php
943 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/99/9e/63/999e637a129f69005ecaa1ec5a360060ed703447_2.file.footer.tpl.php
944 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/7b/ea/10/7bea10cca96ef6b28b8f036ef026a7c11e3bde56_2.file.footer-1.tpl.php
945 /var/cache/prod/smarty/cache/iqitlinksmanager/1/1/1/21/displayFooter/warehouse/a9/f2/c1/a9f2c1869604c8c628073c46891a26fcf1453e27.iqitlinksmanagerviewstemplateshookiqitlinksmanager.tpl.php
946 /var/cache/prod/smarty/compile/warehouse/47/ac/57/47ac57039d904771d1de42366e1791900bdd2c2f_2.file.pixelheader.tpl.php
947 /vendor/smarty/smarty/libs/plugins/shared.mb_str_replace.php
948 /var/cache/prod/smarty/compile/warehouse/d5/a3/51/d5a351153329745771ab994e1aac2c50a2871ed1_2.file.pages_viewed.tpl.php
949 /var/cache/prod/smarty/compile/warehouse/e8/03/5a/e8035a8d1c12c085b510041163fece5592f47256_2.file.addtocart17.tpl.php
950 /var/cache/prod/smarty/compile/warehouse/77/34/89/773489e70d2bbbc33a3532f583f69463b9e8d34b_2.file.wishlist-iqitwishlist.tpl.php
951 /var/cache/prod/smarty/compile/warehouse/d8/97/09/d897090b6df2dbd807e718e356ae88dacdc94b72_2.file.category.tpl.php
952 /var/cache/prod/smarty/compile/warehouse/0b/1e/ae/0b1eae8b95d210de6545ab4d36ef1e0da4a2995c_2.file.newsletter.tpl.php
953 /var/cache/prod/smarty/compile/warehouse/bb/a9/2e/bba92e35e07193f35df4d88c25fef9c1ee267db4_2.file.page_time_event.tpl.php
954 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/2f/e6/59/2fe659ce5c8a3b849eecceed2fd2484c04ba6f2b_2.file.social-links.tpl.php
955 /modules/ps_emailsubscription/ps_emailsubscription.php
956 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/ca/11/75/ca1175f42cce659c415ef88a938d72e6064791dd_2.file.footer-copyrights-1.tpl.php
957 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/b2/b4/18/b2b418437d59a5c40ab3bf79b4a0534fdfc59e9d_2.file.password-policy-template.tpl.php
958 /classes/form/CustomerLoginForm.php
959 /classes/form/AbstractForm.php
960 /classes/form/FormInterface.php
961 /src/Core/Foundation/Templating/RenderableInterface.php
962 /classes/form/CustomerLoginFormatter.php
963 /classes/form/FormFormatterInterface.php
964 /classes/ValidateConstraintTranslator.php
965 /src/Core/Util/InternationalizedDomainNameConverter.php
966 /src/Core/Foundation/Templating/RenderableProxy.php
967 /var/cache/prod/smarty/compile/warehouse/52/f1/b8/52f1b8b385d74962f57df5c0ac1b0e91d62e4760_2.module.iqitwishlistviewstemplateshookdisplaymodal.tpl.php
968 /classes/form/FormField.php
969 /var/cache/prod/smarty/compile/warehouse/30/f5/ac/30f5acd1c8eb485e903c518c39df62f6dab88d7e_2.file.login-form.tpl.php
970 /var/cache/prod/smarty/compile/warehouse/21/f2/27/21f227e16d661dac3c649c0ff89b74dcf6812c75_2.file.form-errors.tpl.php
971 /var/cache/prod/smarty/compile/08/dc/b1/08dcb1adde6be40af6fcc0544d63eb4badcd22a6_2.file.form-fields.tpl.php
972 /var/cache/prod/smarty/compile/21/f2/27/21f227e16d661dac3c649c0ff89b74dcf6812c75_2.file.form-errors.tpl.php
973 /var/cache/prod/smarty/cache/iqitsociallogin/1/1/1/21/warehouse/7b/d5/c3/7bd5c305fe941e7514c4da4c50a911312eb62349.iqitsocialloginviewstemplateshookauthentication.tpl.php
974 /var/cache/prod/smarty/compile/warehouse/d4/a2/00/d4a200912ea9e133f46cf39b7eadc37ea7dd3d2f_2.module.iqitcompareviewstemplateshookdisplaymodal.tpl.php
975 /var/cache/prod/smarty/cache/iqitcookielaw/1/1/1/21/warehouse/6c/9a/c7/6c9ac7fc236180074d341c4bb3247222ad3545d0.iqitcookielawviewstemplateshookiqitcookielaw.tpl.php
976 /modules/ps_googleanalytics/classes/Hook/HookDisplayBeforeBodyClosingTag.php
977 /modules/ps_googleanalytics/classes/Handler/GanalyticsJsHandler.php
978 /modules/ps_googleanalytics/classes/Handler/GanalyticsDataHandler.php
979 /modules/ps_googleanalytics/classes/Repository/GanalyticsDataRepository.php
980 /modules/ps_googleanalytics/classes/Wrapper/ProductWrapper.php
981 /modules/ps_googleanalytics/classes/GoogleAnalyticsTools.php
982 /var/cache/prod/smarty/compile/warehouse/5c/93/46/5c93465cfee83ad9edb76aeff8896d92c35ee986_2.file.ga_tag.tpl.php