Accueil

Product added to wishlist
Product added to compare.

Ce site utilise des cookies provenant de Google afin de fournir ses services et d'analyser le trafic. Les informations relatives à votre utilisation du site sont partagées avec Google. En cliquant sur "Accepter", vous acceptez l'utilisation des cookies.

Load Time 604.840 ms
Querying Time 219 ms
Queries 611
Memory Peak Usage 24.7 Mb
Included Files 983 files - 13.11 Mb
PrestaShop Cache - Mb
Global vars 0.69 Mb
PrestaShop Version 8.2.0
PHP Version 8.1.34
MySQL Version 11.4.10-MariaDB
Memory Limit 4048M
Max Execution Time 600s
Smarty Cache enabled
Smarty Compilation auto
  Time Cumulated Time Memory Usage Memory Peak Usage
config 0.648 ms 0.648 ms 5.49 Mb 6.9 Mb
__construct 0.005 ms 0.653 ms - Mb 6.9 Mb
init 5.352 ms 6.005 ms 1.19 Mb 6.9 Mb
checkAccess 0.001 ms 6.006 ms - Mb 6.9 Mb
setMedia 0.701 ms 6.707 ms 0.15 Mb 6.9 Mb
postProcess 0.000 ms 6.707 ms - Mb 6.9 Mb
initHeader 0.001 ms 6.708 ms - Mb 6.9 Mb
initContent 233.633 ms 240.341 ms 10.75 Mb 17.7 Mb
initFooter 0.001 ms 240.342 ms - Mb 17.7 Mb
display 364.498 ms 604.840 ms 6.37 Mb 24.7 Mb
Hook Time Memory Usage
DisplayFooter 190.144 ms 1.01 Mb
displayProductListFunctionalButtons 4.151 ms 0.05 Mb
displayBeforeBodyClosingTag 2.249 ms 0.71 Mb
DisplayBeforeBodyClosingTag 1.287 ms 0.19 Mb
DisplayHeader 1.286 ms 0.20 Mb
displayCountDown 0.886 ms 0.09 Mb
displayNav2 0.773 ms 0.18 Mb
displayNav1 0.486 ms 0.09 Mb
displayMainMenu 0.418 ms 0.17 Mb
displayFooter 0.357 ms 0.09 Mb
displayCategoryElementor 0.355 ms 0.08 Mb
displayCustomerLoginFormAfter 0.296 ms 0.07 Mb
renderWidget 0.279 ms 0.10 Mb
IsJustElementor 0.177 ms 0.02 Mb
ProductSearchProvider 0.126 ms - Mb
ActionFrontControllerSetMedia 0.049 ms 0.01 Mb
OverrideLayoutTemplate 0.021 ms - Mb
DisplayTop 0.008 ms - Mb
ModuleRoutes 0.003 ms - Mb
ActionDispatcher 0.003 ms - Mb
ActionProductSearchAfter 0.002 ms - Mb
Header 0.001 ms - Mb
22 hook(s) 203.356 ms 3.07 Mb
Module Time Memory Usage
ph_simpleblog 2.926 ms 1.98 Mb
iqitthemeeditor 0.296 ms 0.15 Mb
ps_emailalerts 0.067 ms 0.04 Mb
facebookconversiontrackingplus 190.689 ms 1.11 Mb
revsliderprestashop 0.381 ms 0.08 Mb
ps_shoppingcart 0.048 ms 0.02 Mb
ps_googleanalytics 1.498 ms 0.31 Mb
iqitcompare 2.184 ms 0.12 Mb
iqitcontactpage 0.042 ms 0.02 Mb
iqitcookielaw 0.314 ms 0.07 Mb
iqitcountdown 0.948 ms 0.03 Mb
iqitelementor 0.696 ms 0.17 Mb
iqitfreedeliverycount 0.041 ms 0.02 Mb
iqitmegamenu 0.513 ms 0.29 Mb
iqitsizecharts 0.057 ms 0.04 Mb
iqitwishlist 4.593 ms 0.76 Mb
iqitextendedproduct 0.082 ms 0.05 Mb
iqitsociallogin 0.347 ms 0.09 Mb
gmerchantcenterpro 6.360 ms 1.18 Mb
stripe_official 0.298 ms 0.09 Mb
abandonedcart 0.295 ms 0.16 Mb
vivawalletsmartcheckout 0.166 ms - Mb
ps_facetedsearch 0.566 ms 0.14 Mb
iqitlinksmanager 0.732 ms 0.17 Mb
ps_languageselector 0.205 ms 0.13 Mb
ps_currencyselector 0.196 ms 0.06 Mb
iqitsearch 0.076 ms 0.01 Mb
ps_customersignin 0.029 ms 0.02 Mb
ps_emailsubscription 1.065 ms 0.28 Mb
29 module(s) 215.711 ms 7.57 Mb

Stopwatch SQL - 611 queries

# Query Time (ms) Rows Filesort Group By Location
160
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value IN (150, 143, 232660, 148))) AND ((fp_1.id_feature_value IN (33201, 33209))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=2 AND c.nright<=659 GROUP BY p.id_product) p INNER JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) LEFT JOIN een_feature_product fp_2 ON (p.id_product = fp_2.id_product) WHERE ((fp.id_feature=13)) AND ((fp_1.id_feature_value IN (150, 143, 232660, 148))) AND ((fp_2.id_feature_value IN (33201, 33209))) GROUP BY fp.id_feature_value
19.894 ms 74713088 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
170
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value IN (150, 143, 232660, 148))) AND ((fp_1.id_feature_value IN (33201, 33209))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=2 AND c.nright<=659 GROUP BY p.id_product) p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) LEFT JOIN een_feature_product fp_2 ON (p.id_product = fp_2.id_product) WHERE ((sa.quantity>0)) AND ((fp_1.id_feature_value IN (150, 143, 232660, 148))) AND ((fp_2.id_feature_value IN (33201, 33209)))
17.089 ms 149426176 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
167
SELECT SQL_NO_CACHE cp.id_category, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value IN (150, 143, 232660, 148))) AND ((fp_1.id_feature_value IN (33201, 33209))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=2 AND c.nright<=659 GROUP BY p.id_product) p INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value IN (150, 143, 232660, 148))) AND ((fp_1.id_feature_value IN (33201, 33209))) AND cg.id_group='1' AND c.level_depth<=2 AND c.nleft>2 AND c.nright<659 GROUP BY cp.id_category
17.010 ms 74713088 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
158
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (33201, 33209))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=2 AND c.nright<=659 GROUP BY p.id_product) p INNER JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=10)) AND ((fp_1.id_feature_value IN (33201, 33209))) GROUP BY fp.id_feature_value
16.190 ms 18678272 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
163
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (150, 143, 232660, 148))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=2 AND c.nright<=659 GROUP BY p.id_product) p INNER JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=29)) AND ((fp_1.id_feature_value IN (150, 143, 232660, 148))) GROUP BY fp.id_feature_value
16.072 ms 18678272 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
152
SELECT SQL_NO_CACHE p.id_product FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value IN (150, 143, 232660, 148))) AND ((fp_1.id_feature_value IN (33201, 33209))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=2 AND c.nright<=659 GROUP BY p.id_product) p INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) GROUP BY p.id_product ORDER BY p.position ASC, p.id_product DESC
15.944 ms 18678272 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
168
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value IN (150, 143, 232660, 148))) AND ((fp_1.id_feature_value IN (33201, 33209))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=2 AND c.nright<=659 GROUP BY p.id_product) p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_stock_available sa_1 ON (p.id_product = sa_1.id_product AND IFNULL(pac.id_product_attribute, 0) = sa_1.id_product_attribute AND sa_1.id_shop = 1  AND sa_1.id_shop_group = 0 ) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) LEFT JOIN een_feature_product fp_2 ON (p.id_product = fp_2.id_product) WHERE ((sa.quantity<=0 AND sa_1.out_of_stock IN (0, 2))) AND ((fp_1.id_feature_value IN (150, 143, 232660, 148))) AND ((fp_2.id_feature_value IN (33201, 33209)))
15.857 ms 149426176 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
154
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value IN (150, 143, 232660, 148))) AND ((fp_1.id_feature_value IN (33201, 33209))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=2 AND c.nright<=659 GROUP BY p.id_product) p LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) LEFT JOIN een_feature_product fp_2 ON (p.id_product = fp_2.id_product) WHERE ((p.on_sale=1)) AND ((fp_1.id_feature_value IN (150, 143, 232660, 148))) AND ((fp_2.id_feature_value IN (33201, 33209)))
15.645 ms 74713088 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
155
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value IN (150, 143, 232660, 148))) AND ((fp_1.id_feature_value IN (33201, 33209))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=2 AND c.nright<=659 GROUP BY p.id_product) p LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value IN (150, 143, 232660, 148))) AND ((fp_1.id_feature_value IN (33201, 33209))) AND p.date_add>'2026-02-04 00:00:00'
15.274 ms 74713088 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
169
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value IN (150, 143, 232660, 148))) AND ((fp_1.id_feature_value IN (33201, 33209))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=2 AND c.nright<=659 GROUP BY p.id_product) p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) LEFT JOIN een_feature_product fp_2 ON (p.id_product = fp_2.id_product) WHERE ((sa.out_of_stock=1) OR (sa.quantity>0)) AND ((fp_1.id_feature_value IN (150, 143, 232660, 148))) AND ((fp_2.id_feature_value IN (33201, 33209)))
15.264 ms 149426176 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
156
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value IN (150, 143, 232660, 148))) AND ((fp_1.id_feature_value IN (33201, 33209))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=2 AND c.nright<=659 GROUP BY p.id_product) p LEFT JOIN een_specific_price sp ON (
sp.id_product = p.id_product AND 
sp.id_shop IN (0, 1) AND 
sp.id_currency IN (0, 1) AND 
sp.id_country IN (0, 21) AND 
sp.id_group IN (0, 1) AND 
sp.from_quantity = 1 AND
sp.reduction > 0 AND
sp.id_customer = 0 AND
sp.id_cart = 0 AND 
(sp.from = '0000-00-00 00:00:00' OR '2026-05-04 18:46:13' >= sp.from) AND 
(sp.to = '0000-00-00 00:00:00' OR '2026-05-04 18:46:13' <= sp.to) 
) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) LEFT JOIN een_feature_product fp_2 ON (p.id_product = fp_2.id_product) WHERE ((sp.reduction>0)) AND ((fp_1.id_feature_value IN (150, 143, 232660, 148))) AND ((fp_2.id_feature_value IN (33201, 33209)))
1.517 ms 16864 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
171
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value IN (150, 143, 232660, 148))) AND ((fp_1.id_feature_value IN (33201, 33209))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=2 AND c.nright<=659 GROUP BY p.id_product) p INNER JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) LEFT JOIN een_feature_product fp_2 ON (p.id_product = fp_2.id_product) WHERE ((fp.id_feature=17)) AND ((fp_1.id_feature_value IN (150, 143, 232660, 148))) AND ((fp_2.id_feature_value IN (33201, 33209))) GROUP BY fp.id_feature_value
1.495 ms 18144 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
157
SELECT SQL_NO_CACHE psi.price_min, MIN(price_min) as min, MAX(price_max) as max FROM een_product p INNER JOIN een_layered_price_index psi ON (psi.id_product = p.id_product AND psi.id_shop = 1 AND psi.id_currency = 1 AND psi.id_country = 21) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value IN (150, 143, 232660, 148))) AND ((fp_1.id_feature_value IN (33201, 33209))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=2 AND c.nright<=659
1.349 ms 6112 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
161
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value IN (150, 143, 232660, 148))) AND ((fp_1.id_feature_value IN (33201, 33209))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=2 AND c.nright<=659 GROUP BY p.id_product) p INNER JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) LEFT JOIN een_feature_product fp_2 ON (p.id_product = fp_2.id_product) WHERE ((fp.id_feature=20)) AND ((fp_1.id_feature_value IN (150, 143, 232660, 148))) AND ((fp_2.id_feature_value IN (33201, 33209))) GROUP BY fp.id_feature_value
1.210 ms 8832 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
3
SELECT SQL_NO_CACHE c.`name`, cl.`id_lang`, IF(cl.`id_lang` IS NULL, c.`value`, cl.`value`) AS value, c.id_shop_group, c.id_shop
FROM `een_configuration` c
LEFT JOIN `een_configuration_lang` cl ON (c.`id_configuration` = cl.`id_configuration`)
0.888 ms 1696 /classes/Configuration.php:180
593
SELECT SQL_NO_CACHE id_category, id_parent, level_depth, name, is_root_category, active FROM een_category LEFT JOIN een_category_lang AS cl USING (id_category) LEFT JOIN een_category_shop AS cs USING (id_category) WHERE cs.id_shop = 1 AND cl.id_lang = 1 ORDER BY `een_category`.`id_parent` ASC, `een_category`.`id_category` ASC
0.726 ms 329 Yes /modules/facebookconversiontrackingplus/facebookconversiontrackingplus.php:2945
165
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature_value IN (150, 143, 232660, 148))) AND ((fp_1.id_feature_value IN (33201, 33209))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=2 AND c.nright<=659 GROUP BY p.id_product) p INNER JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) LEFT JOIN een_feature_product fp_2 ON (p.id_product = fp_2.id_product) WHERE ((fp.id_feature=34)) AND ((fp_1.id_feature_value IN (150, 143, 232660, 148))) AND ((fp_2.id_feature_value IN (33201, 33209))) GROUP BY fp.id_feature_value
0.608 ms 896 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
188
SELECT SQL_NO_CACHE `id_hook`, `name`
FROM `een_hook`
UNION
SELECT `id_hook`, ha.`alias` as name
FROM `een_hook_alias` ha
INNER JOIN `een_hook` h ON ha.name = h.name
0.588 ms 0 /classes/Hook.php:1326
189
SELECT SQL_NO_CACHE h.id_hook, h.name as h_name, title, description, h.position, hm.position as hm_position, m.id_module, m.name, m.active
FROM `een_hook_module` hm
STRAIGHT_JOIN `een_hook` h ON (h.id_hook = hm.id_hook AND hm.id_shop = 1)
STRAIGHT_JOIN `een_module` as m ON (m.id_module = hm.id_module)
ORDER BY hm.position
0.546 ms 487 /classes/Hook.php:456
14
SELECT SQL_NO_CACHE h.`name` as hook, m.`id_module`, h.`id_hook`, m.`name` as module
FROM `een_module` m
INNER JOIN een_module_shop module_shop
ON (module_shop.id_module = m.id_module AND module_shop.id_shop = 1 AND module_shop.enable_device & 1)
INNER JOIN `een_hook_module` `hm` ON hm.`id_module` = m.`id_module`
INNER JOIN `een_hook` `h` ON hm.`id_hook` = h.`id_hook`
LEFT JOIN `een_module_group` `mg` ON mg.`id_module` = m.`id_module`
WHERE (h.`name` != "paymentOptions") AND (hm.`id_shop` = 1) AND (mg.id_shop = 1 AND  mg.`id_group` IN (1))
GROUP BY hm.id_hook, hm.id_module
ORDER BY hm.`position`
0.498 ms 310 Yes Yes /classes/Hook.php:1267
610
SELECT SQL_NO_CACHE cp.`id_category`, cp.`id_product`, cl.`name` FROM `een_category_product` cp
LEFT JOIN `een_category` c ON (c.id_category = cp.id_category)
LEFT JOIN `een_category_lang` cl ON (cp.`id_category` = cl.`id_category` AND cl.id_shop = 1 )
INNER JOIN een_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
WHERE cp.`id_product` IN (40036,14272,13137,12939,6655,6363,4498,4495,4442,4319,609473,603687,600667,596002,585532,573233,572166,567392,544260,542487,541355,571471,13135,13136,604308) AND cl.`id_lang` = 1
ORDER BY c.`level_depth` DESC
0.477 ms 71 Yes /modules/ps_googleanalytics/classes/Wrapper/ProductWrapper.php:109
173
SELECT SQL_NO_CACHE p.*,
ps.*,
pl.*,
sa.out_of_stock,
IFNULL(sa.quantity, 0) as quantity,
(DATEDIFF(
p.`date_add`,
DATE_SUB(
'2026-05-04 00:00:00',
INTERVAL 90 DAY
)
) > 0) as new
FROM een_product p
LEFT JOIN een_product_lang pl
ON pl.id_product = p.id_product
AND pl.id_shop = 1
AND pl.id_lang = 1
LEFT JOIN een_stock_available sa   ON sa.id_product = p.id_product
AND sa.id_product_attribute = 0
AND sa.id_shop = 1 LEFT JOIN een_product_shop ps
ON ps.id_product = p.id_product
AND ps.id_shop = 1
WHERE p.id_product IN (40036,14272,13137,12939,6655,6363,4498,4495,4442,4319,609473,603687,600667,596002,585532,573233,572166,567392,544260,542487,541355,571471,13135,13136,604308)
0.420 ms 25 /classes/ProductAssembler.php:95
166
SELECT SQL_NO_CACHE c.`id_category`, cl.`name`
FROM `een_category` c
INNER JOIN een_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `een_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
ORDER BY c.nleft, c.position
0.410 ms 330 Yes /classes/Category.php:724
42
SELECT SQL_NO_CACHE c.*, cl.`id_lang`, cl.`name`, cl.`description`, cl.`additional_description`, cl.`link_rewrite`, cl.`meta_title`, cl.`meta_keywords`, cl.`meta_description`
FROM `een_category` c
INNER JOIN een_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `een_category_lang` cl ON (c.`id_category` = cl.`id_category` AND `id_lang` = 1  AND cl.id_shop = 1 )
LEFT JOIN `een_category_group` cg ON (cg.`id_category` = c.`id_category`)
WHERE `id_parent` = 2
AND `active` = 1
AND cg.`id_group` =1
GROUP BY c.`id_category`
ORDER BY `level_depth` ASC, category_shop.`position` ASC
0.391 ms 12 Yes Yes /classes/Category.php:924
108
SELECT SQL_NO_CACHE *
FROM `een_gmcp_feeds` ff
WHERE (ff.id_shop=1)
ORDER BY ff.feed_is_default ASC
0.379 ms 370 Yes /modules/gmerchantcenterpro/models/Feeds.php:62
65
SHOW TABLES LIKE "een_gmcp_1800"
0.275 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:88
159
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `een_feature_value` v LEFT JOIN `een_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `een_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 10 ORDER BY vl.`value` ASC
0.256 ms 37 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
13
SELECT SQL_NO_CACHE lower(name) as name
FROM `een_hook` h
WHERE (h.active = 1)
0.239 ms 1060 /classes/Hook.php:1366
147
SELECT SQL_NO_CACHE DISTINCT f.id_feature, f.*, fl.*, IF(liflv.`url_name` IS NULL OR liflv.`url_name` = "", NULL, liflv.`url_name`) AS url_name, IF(liflv.`meta_title` IS NULL OR liflv.`meta_title` = "", NULL, liflv.`meta_title`) AS meta_title, lif.indexable FROM `een_feature` f  INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1) LEFT JOIN `een_feature_lang` fl ON (f.`id_feature` = fl.`id_feature` AND fl.`id_lang` = 1) LEFT JOIN `een_layered_indexable_feature` lif ON (f.`id_feature` = lif.`id_feature`) LEFT JOIN `een_layered_indexable_feature_lang_value` liflv ON (f.`id_feature` = liflv.`id_feature` AND liflv.`id_lang` = 1) ORDER BY f.`position` ASC
0.239 ms 29 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:171
105
SHOW COLUMNS FROM een_gmcp_tags LIKE "custom_label_set_postion"
0.229 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:128
164
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `een_feature_value` v LEFT JOIN `een_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `een_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 29 ORDER BY vl.`value` ASC
0.222 ms 40 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
148
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `een_feature_value` v LEFT JOIN `een_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `een_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 10 ORDER BY vl.`value` ASC
0.218 ms 37 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
16
SELECT SQL_NO_CACHE `id_hook`, `name` FROM `een_hook`
0.213 ms 1060 /classes/Hook.php:1326
149
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `een_feature_value` v LEFT JOIN `een_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `een_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 29 ORDER BY vl.`value` ASC
0.200 ms 40 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
172
REPLACE INTO een_layered_filter_block (hash, data) VALUES ("df02ce58786285c236079f326d898233", "a:1:{s:7:\"filters\";a:7:{i:0;a:7:{s:9:\"type_lite\";s:6:\"extras\";s:4:\"type\";s:6:\"extras\";s:6:\"id_key\";i:0;s:4:\"name\";s:10:\"Selections\";s:6:\"values\";a:3:{s:4:\"sale\";a:2:{s:4:\"name\";s:8:\"En promo\";s:3:\"nbr\";i:0;}s:3:\"new\";a:2:{s:4:\"name\";s:15:\"Nouveau produit\";s:3:\"nbr\";i:0;}s:8:\"discount\";a:2:{s:4:\"name\";s:8:\"En promo\";s:3:\"nbr\";i:11;}}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";s:1:\"0\";}i:1;a:12:{s:9:\"type_lite\";s:5:\"price\";s:4:\"type\";s:5:\"price\";s:6:\"id_key\";i:0;s:4:\"name\";s:4:\"Prix\";s:3:\"max\";d:0;s:3:\"min\";d:0;s:4:\"unit\";s:3:\"€\";s:14:\"specifications\";a:11:{s:6:\"symbol\";a:11:{i:0;s:1:\",\";i:1;s:3:\" \";i:2;s:1:\";\";i:3;s:1:\"%\";i:4;s:1:\"-\";i:5;s:1:\"+\";i:6;s:1:\"E\";i:7;s:2:\"×\";i:8;s:3:\"‰\";i:9;s:3:\"∞\";i:10;s:3:\"NaN\";}s:12:\"currencyCode\";s:3:\"EUR\";s:14:\"currencySymbol\";s:3:\"€\";s:13:\"numberSymbols\";a:11:{i:0;s:1:\",\";i:1;s:3:\" \";i:2;s:1:\";\";i:3;s:1:\"%\";i:4;s:1:\"-\";i:5;s:1:\"+\";i:6;s:1:\"E\";i:7;s:2:\"×\";i:8;s:3:\"‰\";i:9;s:3:\"∞\";i:10;s:3:\"NaN\";}s:15:\"positivePattern\";s:12:\"#,##0.00 ¤\";s:15:\"negativePattern\";s:13:\"-#,##0.00 ¤\";s:17:\"maxFractionDigits\";i:2;s:17:\"minFractionDigits\";i:2;s:12:\"groupingUsed\";b:1;s:16:\"primaryGroupSize\";i:3;s:18:\"secondaryGroupSize\";i:3;}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:3;s:3:\"nbr\";i:25;s:5:\"value\";N;}i:2;a:9:{s:9:\"type_lite\";s:10:\"id_feature\";s:4:\"type\";s:10:\"id_feature\";s:6:\"id_key\";s:2:\"10\";s:6:\"values\";a:9:{i:151;a:4:{s:3:\"nbr\";s:2:\"36\";s:4:\"name\";s:11:\"Bois massif\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:146;a:4:{s:3:\"nbr\";s:2:\"44\";s:4:\"name\";s:17:\"Dérivés du bois\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:150;a:5:{s:3:\"nbr\";s:1:\"8\";s:4:\"name\";s:6:\"Métal\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:7:\"checked\";b:1;}i:81988;a:4:{s:3:\"nbr\";s:1:\"9\";s:4:\"name\";s:10:\"Pin massif\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:751261;a:4:{s:3:\"nbr\";s:1:\"1\";s:4:\"name\";s:62:\"Plateau : marbre coulé poli Structure / pied : métal brossé\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:159601;a:4:{s:3:\"nbr\";s:1:\"7\";s:4:\"name\";s:6:\"Simili\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:143;a:5:{s:3:\"nbr\";s:1:\"5\";s:4:\"name\";s:5:\"Tissu\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:7:\"checked\";b:1;}i:232660;a:5:{s:3:\"nbr\";s:1:\"6\";s:4:\"name\";s:7:\"Velours\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:7:\"checked\";b:1;}i:148;a:5:{s:3:\"nbr\";s:1:\"6\";s:4:\"name\";s:5:\"Verre\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:7:\"checked\";b:1;}}s:4:\"name\";s:8:\"Matière\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";s:1:\"0\";}i:3;a:9:{s:9:\"type_lite\";s:10:\"id_feature\";s:4:\"type\";s:10:\"id_feature\";s:6:\"id_key\";s:2:\"20\";s:6:\"values\";a:1:{i:526;a:4:{s:3:\"nbr\";s:1:\"4\";s:4:\"name\";s:13:\"Rectangulaire\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}}s:4:\"name\";s:5:\"Forme\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";s:1:\"0\";}i:4;a:9:{s:9:\"type_lite\";s:10:\"id_feature\";s:4:\"type\";s:10:\"id_feature\";s:6:\"id_key\";s:2:\"29\";s:6:\"values\";a:12:{i:33207;a:4:{s:3:\"nbr\";s:1:\"4\";s:4:\"name\";s:5:\"Beige\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:33201;a:5:{s:3:\"nbr\";s:2:\"19\";s:4:\"name\";s:5:\"Blanc\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:7:\"checked\";b:1;}i:33206;a:4:{s:3:\"nbr\";s:2:\"10\";s:4:\"name\";s:4:\"Bleu\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:86884;a:4:{s:3:\"nbr\";s:1:\"5\";s:4:\"name\";s:6:\"Crème\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:33203;a:4:{s:3:\"nbr\";s:1:\"1\";s:4:\"name\";s:4:\"Gris\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:33210;a:4:{s:3:\"nbr\";s:1:\"7\";s:4:\"name\";s:5:\"Jaune\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:33202;a:4:{s:3:\"nbr\";s:1:\"1\";s:4:\"name\";s:6:\"Marron\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:33204;a:4:{s:3:\"nbr\";s:2:\"87\";s:4:\"name\";s:4:\"Noir\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:33205;a:4:{s:3:\"nbr\";s:1:\"4\";s:4:\"name\";s:4:\"Rose\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:33209;a:5:{s:3:\"nbr\";s:1:\"6\";s:4:\"name\";s:5:\"Rouge\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:7:\"checked\";b:1;}i:86883;a:4:{s:3:\"nbr\";s:1:\"7\";s:4:\"name\";s:6:\"Taupe \";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:33208;a:4:{s:3:\"nbr\";s:2:\"15\";s:4:\"name\";s:4:\"Vert\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}}s:4:\"name\";s:7:\"Couleur\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";s:1:\"0\";}i:5;a:7:{s:9:\"type_lite\";s:8:\"category\";s:4:\"type\";s:8:\"category\";s:6:\"id_key\";i:0;s:4:\"name\";s:11:\"Catégories\";s:6:\"values\";a:3:{i:5756;a:2:{s:4:\"name\";s:12:\"Décorations\";s:3:\"nbr\";s:1:\"1\";}i:5757;a:2:{s:4:\"name\";s:10:\"Luminaires\";s:3:\"nbr\";s:1:\"8\";}i:5816;a:2:{s:4:\"name\";s:22:\"Promos et Ventes Flash\";s:3:\"nbr\";s:1:\"4\";}}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";s:1:\"0\";}i:6;a:7:{s:9:\"type_lite\";s:12:\"availability\";s:4:\"type\";s:12:\"availability\";s:6:\"id_key\";i:0;s:4:\"name\";s:14:\"Disponibilité\";s:6:\"values\";a:2:{i:2;a:2:{s:4:\"name\";s:8:\"En stock\";s:3:\"nbr\";i:24;}i:0;a:2:{s:4:\"name\";s:14:\"Non disponible\";s:3:\"nbr\";i:1;}}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";s:1:\"0\";}}}")
0.200 ms 1 /modules/ps_facetedsearch/src/Filters/Block.php:211
592
SELECT SQL_NO_CACHE product_id as id_product, COUNT(product_id) AS sales
FROM `een_order_detail`
WHERE product_id IN (
SELECT id_product
FROM `een_category_product`
LEFT JOIN een_product USING (id_product)
WHERE id_category = 2
AND active = 1
)
GROUP BY product_id
ORDER BY sales DESC LIMIT 5
0.197 ms 36 Yes /modules/facebookconversiontrackingplus/facebookconversiontrackingplus.php:2918
575
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (604308) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.194 ms 1 Yes Yes /classes/Product.php:4524
569
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (544260) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.190 ms 1 Yes Yes /classes/Product.php:4524
103
SHOW COLUMNS FROM een_gmcp_feeds LIKE "feed_is_default"
0.187 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:128
562
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (603687) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.186 ms 1 Yes Yes /classes/Product.php:4524
551
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (40036) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.184 ms 1 Yes Yes /classes/Product.php:4524
72
SHOW TABLES LIKE "een_gmcp_1900"
0.178 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:88
563
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (600667) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.172 ms 1 Yes Yes /classes/Product.php:4524
20
SELECT SQL_NO_CACHE m.page, ml.url_rewrite, ml.id_lang
FROM `een_meta` m
LEFT JOIN `een_meta_lang` ml ON (m.id_meta = ml.id_meta AND ml.id_shop = 1 )
ORDER BY LENGTH(ml.url_rewrite) DESC
0.171 ms 66 Yes /classes/Dispatcher.php:654
558
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4495) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.167 ms 1 Yes Yes /classes/Product.php:4524
181
SELECT SQL_NO_CACHE DISTINCT `id_product` FROM `een_specific_price` WHERE `id_product` != 0
0.166 ms 527 /classes/SpecificPrice.php:310
470
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4495) AND (b.`id_shop` = 1) LIMIT 1
0.164 ms 1 /src/Adapter/EntityMapper.php:71
104
SHOW COLUMNS FROM een_gmcp_discount_association LIKE "channel"
0.163 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:128
185
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 40036 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 2 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.162 ms 1 Yes /classes/SpecificPrice.php:576
552
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (14272) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.161 ms 1 Yes Yes /classes/Product.php:4524
555
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6655) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.161 ms 1 Yes Yes /classes/Product.php:4524
568
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (567392) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.158 ms 1 Yes Yes /classes/Product.php:4524
195
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 40036 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 40036 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.158 ms 0 /classes/Cart.php:1430
553
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (13137) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.157 ms 1 Yes Yes /classes/Product.php:4524
554
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (12939) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.156 ms 1 Yes Yes /classes/Product.php:4524
162
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `een_feature_value` v LEFT JOIN `een_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `een_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 20 ORDER BY vl.`value` ASC
0.154 ms 9 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
557
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4498) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.154 ms 1 Yes Yes /classes/Product.php:4524
556
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (6363) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.153 ms 1 Yes Yes /classes/Product.php:4524
561
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (609473) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.152 ms 1 Yes Yes /classes/Product.php:4524
559
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4442) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.151 ms 1 Yes Yes /classes/Product.php:4524
560
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (4319) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.150 ms 1 Yes Yes /classes/Product.php:4524
196
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 40036
ORDER BY f.position ASC
0.148 ms 2 Yes /classes/Product.php:6021
202
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 14272 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.145 ms 1 Yes /classes/SpecificPrice.php:576
564
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (596002) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.145 ms 1 Yes Yes /classes/Product.php:4524
276
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4495
ORDER BY f.position ASC
0.144 ms 7 Yes /classes/Product.php:6021
570
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (542487) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.144 ms 1 Yes Yes /classes/Product.php:4524
602
SELECT SQL_NO_CACHE product_id as id_product, COUNT(product_id) AS sales
FROM `een_order_detail`
WHERE product_id IN (
SELECT id_product
FROM `een_category_product`
LEFT JOIN een_product USING (id_product)
WHERE id_category = 2
AND active = 1
)
GROUP BY product_id
ORDER BY sales DESC LIMIT 5
0.144 ms 36 Yes /modules/facebookconversiontrackingplus/facebookconversiontrackingplus.php:2918
18
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `een_module` m
LEFT JOIN `een_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
0.143 ms 104 /classes/module/Module.php:346
109
SELECT SQL_NO_CACHE *
FROM `een_gmcp_feeds` ff
WHERE (ff.iso_lang="fr") AND (ff.id_shop=1)
ORDER BY ff.feed_is_default ASC
0.143 ms 370 Yes /modules/gmerchantcenterpro/models/Feeds.php:72
287
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4442
ORDER BY f.position ASC
0.141 ms 10 Yes /classes/Product.php:6021
421
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 13135 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.141 ms 1 Yes /classes/SpecificPrice.php:576
236
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 6655 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.140 ms 1 Yes /classes/SpecificPrice.php:576
298
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4319
ORDER BY f.position ASC
0.140 ms 10 Yes /classes/Product.php:6021
526
SELECT SQL_NO_CACHE * FROM `een_cart_rule` cr
LEFT JOIN `een_cart_rule_lang` crl 
ON (cr.`id_cart_rule` = crl.`id_cart_rule` AND crl.`id_lang` = 1) WHERE (cr.`id_customer` = 0) AND NOW() BETWEEN cr.date_from AND cr.date_to
AND cr.`active` = 1
AND free_shipping = 1 AND carrier_restriction = 1
0.138 ms 1 /classes/CartRule.php:423
214
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 13137 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.138 ms 1 Yes /classes/SpecificPrice.php:576
24
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `een_module` m
LEFT JOIN `een_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
0.137 ms 104 /classes/module/Module.php:346
207
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 14272 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 14272 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.137 ms 0 /classes/Cart.php:1430
337
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 596002 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 596002 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.137 ms 0 /classes/Cart.php:1430
265
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 4498
ORDER BY f.position ASC
0.137 ms 7 Yes /classes/Product.php:6021
432
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 13136 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.136 ms 1 Yes /classes/SpecificPrice.php:576
248
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 6363 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.136 ms 1 Yes /classes/SpecificPrice.php:576
259
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 4498 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.135 ms 1 Yes /classes/SpecificPrice.php:576
512
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 571471) AND (b.`id_shop` = 1) LIMIT 1
0.135 ms 1 /src/Adapter/EntityMapper.php:71
208
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 14272
ORDER BY f.position ASC
0.134 ms 6 Yes /classes/Product.php:6021
241
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6655 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6655 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.134 ms 0 /classes/Cart.php:1430
2
SELECT SQL_NO_CACHE gs.*, s.*, gs.name AS group_name, s.name AS shop_name, s.active, su.domain, su.domain_ssl, su.physical_uri, su.virtual_uri
FROM een_shop_group gs
LEFT JOIN een_shop s
ON s.id_shop_group = gs.id_shop_group
LEFT JOIN een_shop_url su
ON s.id_shop = su.id_shop AND su.main = 1
WHERE s.deleted = 0
AND gs.deleted = 0
ORDER BY gs.name, s.name
0.133 ms 1 Yes /classes/shop/Shop.php:715
219
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 13137 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 13137 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.133 ms 0 /classes/Cart.php:1430
270
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 4495 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.133 ms 1 Yes /classes/SpecificPrice.php:576
292
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 4319 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.133 ms 1 Yes /classes/SpecificPrice.php:576
494
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 573233) AND (b.`id_shop` = 1) LIMIT 1
0.133 ms 1 /src/Adapter/EntityMapper.php:71
253
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 6363 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 6363 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.132 ms 0 /classes/Cart.php:1430
264
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4498 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4498 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.132 ms 0 /classes/Cart.php:1430
281
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 4442 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-05-04 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.132 ms 1 Yes /classes/SpecificPrice.php:576
504
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 544260
ORDER BY `position`
0.132 ms 8 Yes /classes/Product.php:3545
506
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 542487) AND (b.`id_shop` = 1) LIMIT 1
0.132 ms 1 /src/Adapter/EntityMapper.php:71
385
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 544260
ORDER BY f.position ASC
0.132 ms 6 Yes /classes/Product.php:6021
473
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4442) AND (b.`id_shop` = 1) LIMIT 1
0.132 ms 1 /src/Adapter/EntityMapper.php:71
286
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4442 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4442 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.131 ms 0 /classes/Cart.php:1430
491
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 585532) AND (b.`id_shop` = 1) LIMIT 1
0.131 ms 1 /src/Adapter/EntityMapper.php:71
220
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 13137
ORDER BY f.position ASC
0.131 ms 7 Yes /classes/Product.php:6021
229
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 12939 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 12939 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.131 ms 0 /classes/Cart.php:1430
275
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4495 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4495 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.131 ms 0 /classes/Cart.php:1430
525
SELECT SQL_NO_CACHE 1 FROM `een_cart_rule` WHERE ((date_to >= "2026-05-04 00:00:00" AND date_to <= "2026-05-04 23:59:59") OR (date_from >= "2026-05-04 00:00:00" AND date_from <= "2026-05-04 23:59:59") OR (date_from < "2026-05-04 00:00:00" AND date_to > "2026-05-04 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
0.131 ms 2 /classes/CartRule.php:357
571
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (541355) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.131 ms 1 Yes Yes /classes/Product.php:4524
297
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 4319 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 4319 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.130 ms 0 /classes/Cart.php:1430
476
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4319) AND (b.`id_shop` = 1) LIMIT 1
0.130 ms 1 /src/Adapter/EntityMapper.php:71
485
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 600667) AND (b.`id_shop` = 1) LIMIT 1
0.130 ms 1 /src/Adapter/EntityMapper.php:71
518
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 13136) AND (b.`id_shop` = 1) LIMIT 1
0.130 ms 1 /src/Adapter/EntityMapper.php:71
426
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 13135 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 13135 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.129 ms 0 /classes/Cart.php:1430
446
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 604308 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 604308 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.129 ms 0 /classes/Cart.php:1430
479
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 609473) AND (b.`id_shop` = 1) LIMIT 1
0.129 ms 1 /src/Adapter/EntityMapper.php:71
482
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 603687) AND (b.`id_shop` = 1) LIMIT 1
0.129 ms 1 /src/Adapter/EntityMapper.php:71
488
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 596002) AND (b.`id_shop` = 1) LIMIT 1
0.129 ms 1 /src/Adapter/EntityMapper.php:71
503
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 544260) AND (b.`id_shop` = 1) LIMIT 1
0.129 ms 1 /src/Adapter/EntityMapper.php:71
521
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 604308) AND (b.`id_shop` = 1) LIMIT 1
0.129 ms 1 /src/Adapter/EntityMapper.php:71
565
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (585532) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.129 ms 1 Yes Yes /classes/Product.php:4524
308
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 609473 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 609473 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.128 ms 0 /classes/Cart.php:1430
338
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 596002
ORDER BY f.position ASC
0.128 ms 2 Yes /classes/Product.php:6021
437
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 13136 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 13136 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.128 ms 0 /classes/Cart.php:1430
500
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 567392) AND (b.`id_shop` = 1) LIMIT 1
0.128 ms 1 /src/Adapter/EntityMapper.php:71
528
SELECT SQL_NO_CACHE * FROM `een_cart_rule` cr
LEFT JOIN `een_cart_rule_lang` crl 
ON (cr.`id_cart_rule` = crl.`id_cart_rule` AND crl.`id_lang` = 0) WHERE (cr.`id_customer` = 0) AND NOW() BETWEEN cr.date_from AND cr.date_to
AND cr.`active` = 1
AND cr.`quantity` > 0 AND highlight = 1 AND code NOT LIKE "BO_ORDER_%"
0.128 ms 1 /classes/CartRule.php:423
254
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6363
ORDER BY f.position ASC
0.127 ms 5 Yes /classes/Product.php:6021
318
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 603687 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 603687 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.127 ms 0 /classes/Cart.php:1430
375
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 567392 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 567392 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.127 ms 0 /classes/Cart.php:1430
509
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 541355) AND (b.`id_shop` = 1) LIMIT 1
0.127 ms 1 /src/Adapter/EntityMapper.php:71
522
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 604308
ORDER BY `position`
0.127 ms 10 Yes /classes/Product.php:3545
327
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 600667 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 600667 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.127 ms 0 /classes/Cart.php:1430
515
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 13135) AND (b.`id_shop` = 1) LIMIT 1
0.127 ms 1 /src/Adapter/EntityMapper.php:71
566
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (573233) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.127 ms 1 Yes Yes /classes/Product.php:4524
404
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 541355 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 541355 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.126 ms 0 /classes/Cart.php:1430
497
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 572166) AND (b.`id_shop` = 1) LIMIT 1
0.126 ms 1 /src/Adapter/EntityMapper.php:71
567
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (572166) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.126 ms 1 Yes Yes /classes/Product.php:4524
230
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 12939
ORDER BY f.position ASC
0.126 ms 5 Yes /classes/Product.php:6021
242
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 6655
ORDER BY f.position ASC
0.126 ms 5 Yes /classes/Product.php:6021
414
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 571471 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 571471 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.126 ms 0 /classes/Cart.php:1430
438
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 13136
ORDER BY f.position ASC
0.126 ms 7 Yes /classes/Product.php:6021
347
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 585532 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 585532 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.125 ms 0 /classes/Cart.php:1430
572
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (571471) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.125 ms 1 Yes Yes /classes/Product.php:4524
356
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 573233 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 573233 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.125 ms 0 /classes/Cart.php:1430
366
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 572166 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 572166 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.125 ms 0 /classes/Cart.php:1430
427
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 13135
ORDER BY f.position ASC
0.125 ms 7 Yes /classes/Product.php:6021
384
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 544260 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 544260 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.124 ms 0 /classes/Cart.php:1430
394
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 542487 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 542487 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.124 ms 0 /classes/Cart.php:1430
395
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 542487
ORDER BY f.position ASC
0.124 ms 7 Yes /classes/Product.php:6021
573
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (13135) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.124 ms 1 Yes Yes /classes/Product.php:4524
574
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (13136) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.124 ms 1 Yes Yes /classes/Product.php:4524
405
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 541355
ORDER BY f.position ASC
0.123 ms 6 Yes /classes/Product.php:6021
448
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 40036) AND (b.`id_shop` = 1) LIMIT 1
0.122 ms 1 /src/Adapter/EntityMapper.php:71
146
SELECT SQL_NO_CACHE type, id_value, filter_show_limit, filter_type FROM een_layered_category
WHERE controller = 'category'
AND id_category = 2
AND id_shop = 1
GROUP BY `type`, id_value ORDER BY position ASC
0.121 ms 10 Yes Yes /modules/ps_facetedsearch/src/Filters/Provider.php:61
480
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 609473
ORDER BY `position`
0.121 ms 7 Yes /classes/Product.php:3545
489
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 596002
ORDER BY `position`
0.121 ms 10 Yes /classes/Product.php:3545
486
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 600667
ORDER BY `position`
0.121 ms 10 Yes /classes/Product.php:3545
510
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 541355
ORDER BY `position`
0.120 ms 8 Yes /classes/Product.php:3545
471
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4495
ORDER BY `position`
0.119 ms 6 Yes /classes/Product.php:3545
348
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 585532
ORDER BY f.position ASC
0.118 ms 2 Yes /classes/Product.php:6021
492
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 585532
ORDER BY `position`
0.118 ms 7 Yes /classes/Product.php:3545
483
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 603687
ORDER BY `position`
0.117 ms 8 Yes /classes/Product.php:3545
501
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 567392
ORDER BY `position`
0.117 ms 8 Yes /classes/Product.php:3545
415
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 571471
ORDER BY f.position ASC
0.116 ms 2 Yes /classes/Product.php:6021
495
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 573233
ORDER BY `position`
0.116 ms 7 Yes /classes/Product.php:3545
513
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 571471
ORDER BY `position`
0.116 ms 6 Yes /classes/Product.php:3545
1
SELECT SQL_NO_CACHE s.id_shop, CONCAT(su.physical_uri, su.virtual_uri) AS uri, su.domain, su.main
FROM een_shop_url su
LEFT JOIN een_shop s ON (s.id_shop = su.id_shop)
WHERE (su.domain = 'decozzia.com' OR su.domain_ssl = 'decozzia.com')
AND s.active = 1
AND s.deleted = 0
ORDER BY LENGTH(CONCAT(su.physical_uri, su.virtual_uri)) DESC
0.116 ms 1 Yes /classes/shop/Shop.php:1364
376
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 567392
ORDER BY f.position ASC
0.116 ms 3 Yes /classes/Product.php:6021
477
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4319
ORDER BY `position`
0.115 ms 6 Yes /classes/Product.php:3545
309
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 609473
ORDER BY f.position ASC
0.115 ms 2 Yes /classes/Product.php:6021
474
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4442
ORDER BY `position`
0.115 ms 6 Yes /classes/Product.php:3545
498
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 572166
ORDER BY `position`
0.115 ms 8 Yes /classes/Product.php:3545
58
SELECT SQL_NO_CACHE *
FROM `een_category` a0
LEFT JOIN `een_category_lang` `a1` ON (a0.`id_category` = a1.`id_category`)
WHERE (a0.`nleft` < 2) AND (a0.`nright` > 659) AND (a1.`id_lang` = 1) AND (a1.`id_shop` = 1)
ORDER BY a0.`nleft` asc
0.114 ms 1 /classes/PrestaShopCollection.php:383
319
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 603687
ORDER BY f.position ASC
0.114 ms 2 Yes /classes/Product.php:6021
447
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 604308
ORDER BY f.position ASC
0.114 ms 2 Yes /classes/Product.php:6021
328
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 600667
ORDER BY f.position ASC
0.113 ms 2 Yes /classes/Product.php:6021
357
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 573233
ORDER BY f.position ASC
0.113 ms 2 Yes /classes/Product.php:6021
367
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 572166
ORDER BY f.position ASC
0.113 ms 2 Yes /classes/Product.php:6021
507
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 542487
ORDER BY `position`
0.113 ms 5 Yes /classes/Product.php:3545
516
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 13135
ORDER BY `position`
0.113 ms 5 Yes /classes/Product.php:3545
524
SELECT SQL_NO_CACHE c.id_elementor FROM een_iqit_elementor_category c WHERE c.id_category = 2 LIMIT 1
0.111 ms 61 /modules/iqitelementor/src/IqitElementorCategory.php:87
527
SELECT SQL_NO_CACHE 1 FROM `een_cart_rule` WHERE ((date_to >= "2026-05-04 00:00:00" AND date_to <= "2026-05-04 23:59:59") OR (date_from >= "2026-05-04 00:00:00" AND date_from <= "2026-05-04 23:59:59") OR (date_from < "2026-05-04 00:00:00" AND date_to > "2026-05-04 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
0.111 ms 2 /classes/CartRule.php:357
519
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 13136
ORDER BY `position`
0.111 ms 5 Yes /classes/Product.php:3545
452
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 14272) AND (b.`id_shop` = 1) LIMIT 1
0.110 ms 1 /src/Adapter/EntityMapper.php:71
467
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 4498) AND (b.`id_shop` = 1) LIMIT 1
0.109 ms 1 /src/Adapter/EntityMapper.php:71
464
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6363) AND (b.`id_shop` = 1) LIMIT 1
0.108 ms 1 /src/Adapter/EntityMapper.php:71
468
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 4498
ORDER BY `position`
0.108 ms 6 Yes /classes/Product.php:3545
190
SELECT SQL_NO_CACHE tr.*
FROM `een_tax_rule` tr
JOIN `een_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 21
AND tr.`id_tax_rules_group` = 1
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.107 ms 1 /classes/tax/TaxRulesTaxManager.php:109
455
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 13137) AND (b.`id_shop` = 1) LIMIT 1
0.107 ms 1 /src/Adapter/EntityMapper.php:71
449
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 40036
ORDER BY `position`
0.106 ms 6 Yes /classes/Product.php:3545
458
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 12939) AND (b.`id_shop` = 1) LIMIT 1
0.106 ms 1 /src/Adapter/EntityMapper.php:71
461
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 6655) AND (b.`id_shop` = 1) LIMIT 1
0.104 ms 1 /src/Adapter/EntityMapper.php:71
25
SELECT SQL_NO_CACHE *
FROM `een_category` a
LEFT JOIN `een_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `een_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 2) AND (b.`id_shop` = 1) LIMIT 1
0.103 ms 1 /src/Adapter/EntityMapper.php:71
174
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 40036
AND image_shop.`cover` = 1 LIMIT 1
0.102 ms 6 /classes/Product.php:3570
603
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "ps_emailsubscription" LIMIT 1
0.101 ms 1 /classes/module/Module.php:2659
43
SELECT SQL_NO_CACHE *
FROM `een_category` a
LEFT JOIN `een_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `een_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 1000) AND (b.`id_shop` = 1) LIMIT 1
0.099 ms 1 /src/Adapter/EntityMapper.php:71
453
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 14272
ORDER BY `position`
0.098 ms 7 Yes /classes/Product.php:3545
529
SELECT SQL_NO_CACHE COUNT(*) FROM `een_orders` o
LEFT JOIN `een_order_cart_rule` ocr ON (ocr.`id_order` = o.`id_order`)
WHERE o.`id_customer` = 0
AND ocr.`deleted` = 0 AND ocr.`id_cart_rule` = 0 LIMIT 1
0.098 ms 1 /classes/order/Order.php:881
186
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 40036)
0.095 ms 1 /classes/Product.php:3860
221
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 12939
AND image_shop.`cover` = 1 LIMIT 1
0.095 ms 5 /classes/Product.php:3570
203
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 14272)
0.092 ms 1 /classes/Product.php:3860
255
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4498
AND image_shop.`cover` = 1 LIMIT 1
0.092 ms 6 /classes/Product.php:3570
456
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 13137
ORDER BY `position`
0.092 ms 6 Yes /classes/Product.php:3545
462
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6655
ORDER BY `position`
0.091 ms 6 Yes /classes/Product.php:3545
465
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 6363
ORDER BY `position`
0.091 ms 4 Yes /classes/Product.php:3545
459
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 12939
ORDER BY `position`
0.090 ms 5 Yes /classes/Product.php:3545
433
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 13136)
0.089 ms 1 /classes/Product.php:3860
29
SELECT SQL_NO_CACHE *
FROM `een_currency` a
LEFT JOIN `een_currency_lang` `b` ON a.`id_currency` = b.`id_currency` AND b.`id_lang` = 1
LEFT JOIN `een_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
0.087 ms 1 /src/Adapter/EntityMapper.php:71
541
SELECT SQL_NO_CACHE SUM(`quantity`)
FROM `een_cart_product`
WHERE `id_cart` = 0 LIMIT 1
0.087 ms 1 /classes/Cart.php:1303
546
SELECT SQL_NO_CACHE c.id_elementor FROM een_iqit_elementor_category c LEFT JOIN een_iqit_elementor_category_shop s ON c.id_elementor = s.id_elementor WHERE c.id_category = 2 AND s.id_shop = 1 LIMIT 1
0.087 ms 61 /modules/iqitelementor/src/IqitElementorCategory.php:87
422
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 13135)
0.086 ms 1 /classes/Product.php:3860
243
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6363
AND image_shop.`cover` = 1 LIMIT 1
0.084 ms 4 /classes/Product.php:3570
299
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 609473
AND image_shop.`cover` = 1 LIMIT 1
0.083 ms 7 /classes/Product.php:3570
197
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 14272
AND image_shop.`cover` = 1 LIMIT 1
0.082 ms 7 /classes/Product.php:3570
237
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6655)
0.082 ms 1 /classes/Product.php:3860
215
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 13137)
0.081 ms 1 /classes/Product.php:3860
271
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4495)
0.081 ms 1 /classes/Product.php:3860
277
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4442
AND image_shop.`cover` = 1 LIMIT 1
0.081 ms 6 /classes/Product.php:3570
249
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 6363)
0.080 ms 1 /classes/Product.php:3860
293
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4319)
0.080 ms 1 /classes/Product.php:3860
150
SELECT SQL_NO_CACHE *
FROM `een_category` a
LEFT JOIN `een_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 2) LIMIT 1
0.080 ms 1 /src/Adapter/EntityMapper.php:71
282
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4442)
0.080 ms 1 /classes/Product.php:3860
7
SELECT SQL_NO_CACHE *
FROM `een_country` a
LEFT JOIN `een_country_lang` `b` ON a.`id_country` = b.`id_country` AND b.`id_lang` = 1
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 8) LIMIT 1
0.079 ms 1 /src/Adapter/EntityMapper.php:71
260
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 4498)
0.079 ms 1 /classes/Product.php:3860
329
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 596002
AND image_shop.`cover` = 1 LIMIT 1
0.079 ms 10 /classes/Product.php:3570
19
SELECT SQL_NO_CACHE name, alias FROM `een_hook_alias`
0.078 ms 87 /classes/Hook.php:339
44
SELECT SQL_NO_CACHE *
FROM `een_category` a
LEFT JOIN `een_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `een_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 5816) AND (b.`id_shop` = 1) LIMIT 1
0.078 ms 1 /src/Adapter/EntityMapper.php:71
231
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 6655
AND image_shop.`cover` = 1 LIMIT 1
0.078 ms 6 /classes/Product.php:3570
320
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 600667
AND image_shop.`cover` = 1 LIMIT 1
0.078 ms 10 /classes/Product.php:3570
410
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 571471)
0.078 ms 1 /classes/Product.php:3860
5
SELECT SQL_NO_CACHE su.physical_uri, su.virtual_uri, su.domain, su.domain_ssl
FROM een_shop s
LEFT JOIN een_shop_url su ON (s.id_shop = su.id_shop)
WHERE s.id_shop = 1
AND s.active = 1 AND s.deleted = 0 AND su.main = 1 LIMIT 1
0.077 ms 1 /classes/shop/Shop.php:218
12
SELECT SQL_NO_CACHE COUNT(DISTINCT l.id_lang) FROM `een_lang` l
JOIN een_lang_shop lang_shop ON (lang_shop.id_lang = l.id_lang AND lang_shop.id_shop = 1)
WHERE l.`active` = 1 LIMIT 1
0.077 ms 1 /classes/Language.php:1216
17
SELECT SQL_NO_CACHE value FROM `een_configuration` WHERE `name` = "PS_MULTISHOP_FEATURE_ACTIVE" LIMIT 1
0.077 ms 1 /classes/shop/Shop.php:1183
26
SELECT SQL_NO_CACHE * FROM `een_currency` c ORDER BY `iso_code` ASC
0.077 ms 1 Yes /classes/Currency.php:709
52
SELECT SQL_NO_CACHE * FROM `een_image_type` WHERE 1 AND `products` = 1  ORDER BY `width` DESC, `height` DESC, `name`ASC
0.077 ms 8 Yes /classes/ImageType.php:109
209
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 13137
AND image_shop.`cover` = 1 LIMIT 1
0.077 ms 6 /classes/Product.php:3570
339
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 585532
AND image_shop.`cover` = 1 LIMIT 1
0.077 ms 7 /classes/Product.php:3570
371
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 567392)
0.077 ms 1 /classes/Product.php:3860
377
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 544260
AND image_shop.`cover` = 1 LIMIT 1
0.077 ms 8 /classes/Product.php:3570
439
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 604308
AND image_shop.`cover` = 1 LIMIT 1
0.077 ms 10 /classes/Product.php:3570
532
SELECT SQL_NO_CACHE COUNT(DISTINCT c.id_currency) FROM `een_currency` c
LEFT JOIN een_currency_shop cs ON (cs.id_currency = c.id_currency AND cs.id_shop = 1)
WHERE c.`active` = 1 AND c.`deleted` = 0 LIMIT 1
0.077 ms 1 /classes/Currency.php:1136
47
SELECT SQL_NO_CACHE *
FROM `een_category` a
LEFT JOIN `een_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `een_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 5757) AND (b.`id_shop` = 1) LIMIT 1
0.076 ms 1 /src/Adapter/EntityMapper.php:71
266
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4495
AND image_shop.`cover` = 1 LIMIT 1
0.076 ms 6 /classes/Product.php:3570
288
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 4319
AND image_shop.`cover` = 1 LIMIT 1
0.076 ms 6 /classes/Product.php:3570
368
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 567392
AND image_shop.`cover` = 1 LIMIT 1
0.076 ms 8 /classes/Product.php:3570
349
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 573233
AND image_shop.`cover` = 1 LIMIT 1
0.076 ms 7 /classes/Product.php:3570
396
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 541355
AND image_shop.`cover` = 1 LIMIT 1
0.076 ms 8 /classes/Product.php:3570
45
SELECT SQL_NO_CACHE *
FROM `een_category` a
LEFT JOIN `een_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `een_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 2756) AND (b.`id_shop` = 1) LIMIT 1
0.075 ms 1 /src/Adapter/EntityMapper.php:71
310
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 603687
AND image_shop.`cover` = 1 LIMIT 1
0.075 ms 8 /classes/Product.php:3570
358
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 572166
AND image_shop.`cover` = 1 LIMIT 1
0.075 ms 8 /classes/Product.php:3570
386
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 542487
AND image_shop.`cover` = 1 LIMIT 1
0.075 ms 5 /classes/Product.php:3570
6
SELECT SQL_NO_CACHE l.*, ls.`id_shop`
FROM `een_lang` l
LEFT JOIN `een_lang_shop` ls ON (l.id_lang = ls.id_lang)
0.075 ms 1 /classes/Language.php:1080
406
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 571471
AND image_shop.`cover` = 1 LIMIT 1
0.075 ms 6 /classes/Product.php:3570
15
SELECT SQL_NO_CACHE `name`, `alias` FROM `een_hook_alias`
0.074 ms 87 /classes/Hook.php:287
428
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 13136
AND image_shop.`cover` = 1 LIMIT 1
0.073 ms 5 /classes/Product.php:3570
530
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "iqitlinksmanager" LIMIT 1
0.073 ms 1 /classes/module/Module.php:2659
66
CREATE TABLE IF NOT EXISTS `een_gmcp_reporting` (`id_reporting` int(11) NOT NULL AUTO_INCREMENT,`iso_feed` LONGTEXT NOT NULL,    `reporting_content` LONGTEXT NOT NULL,`id_shop` int(11) NOT NULL,`date_add` datetime NOT NULL,`date_upd` datetime NOT NULL,PRIMARY KEY (`id_reporting`)) ENGINE=' . _MYSQL_ENGINE_ . ' DEFAULT CHARSET=utf8;
0.073 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
224
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 12939)
0.073 ms 1 /classes/Product.php:3860
416
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 13135
AND image_shop.`cover` = 1 LIMIT 1
0.073 ms 5 /classes/Product.php:3570
304
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 609473)
0.072 ms 1 /classes/Product.php:3860
314
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 603687)
0.072 ms 1 /classes/Product.php:3860
442
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 604308)
0.072 ms 1 /classes/Product.php:3860
46
SELECT SQL_NO_CACHE *
FROM `een_category` a
LEFT JOIN `een_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `een_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 5756) AND (b.`id_shop` = 1) LIMIT 1
0.071 ms 1 /src/Adapter/EntityMapper.php:71
333
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 596002)
0.071 ms 1 /classes/Product.php:3860
390
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 542487)
0.071 ms 1 /classes/Product.php:3860
343
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 585532)
0.070 ms 1 /classes/Product.php:3860
352
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 573233)
0.070 ms 1 /classes/Product.php:3860
362
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 572166)
0.070 ms 1 /classes/Product.php:3860
380
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 544260)
0.070 ms 1 /classes/Product.php:3860
400
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 541355)
0.070 ms 1 /classes/Product.php:3860
153
SELECT SQL_NO_CACHE data FROM een_layered_filter_block WHERE hash="df02ce58786285c236079f326d898233" LIMIT 1
0.070 ms 1 /modules/ps_facetedsearch/src/Filters/Block.php:186
323
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 600667)
0.070 ms 1 /classes/Product.php:3860
544
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "iqitelementor" LIMIT 1
0.069 ms 1 /classes/module/Module.php:2659
549
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "iqitcountdown" LIMIT 1
0.069 ms 1 /classes/module/Module.php:2659
505
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 544260
0.069 ms 1 /classes/Product.php:2902
542
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "iqitmegamenu" LIMIT 1
0.068 ms 1 /classes/module/Module.php:2659
547
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "ps_facetedsearch" LIMIT 1
0.068 ms 1 /classes/module/Module.php:2659
32
SELECT SQL_NO_CACHE *
FROM `een_country` a
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 21) LIMIT 1
0.067 ms 1 /src/Adapter/EntityMapper.php:71
48
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "facebookproductsfeed" LIMIT 1
0.066 ms 0 /classes/module/Module.php:2659
533
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "ps_languageselector" LIMIT 1
0.066 ms 1 /classes/module/Module.php:2659
151
SELECT SQL_NO_CACHE *
FROM `een_category_lang`
WHERE `id_category` = 2 AND `id_shop` = 1
0.065 ms 1 /src/Adapter/EntityMapper.php:79
193
SELECT SQL_NO_CACHE tr.*
FROM `een_tax_rule` tr
JOIN `een_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 21
AND tr.`id_tax_rules_group` = 0
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.065 ms 0 /classes/tax/TaxRulesTaxManager.php:109
499
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 572166
0.065 ms 1 /classes/Product.php:2902
539
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "iqitcompare" LIMIT 1
0.064 ms 1 /classes/module/Module.php:2659
0
SELECT SQL_NO_CACHE * FROM een_memcached_servers
0.063 ms 1 /classes/cache/CacheMemcached.php:263
110
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'FR' LIMIT 1
0.063 ms 1 /classes/Country.php:194
114
SELECT SQL_NO_CACHE c.id_currency
FROM `een_currency` c
WHERE (deleted = 0) AND (iso_code = 'EUR') LIMIT 1
0.063 ms 1 /classes/Currency.php:893
112
SELECT SQL_NO_CACHE *
FROM `een_country` a
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 8) LIMIT 1
0.063 ms 1 /src/Adapter/EntityMapper.php:71
576
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "supercheckout" LIMIT 1
0.063 ms 0 /classes/module/Module.php:2659
226
SELECT SQL_NO_CACHE tr.*
FROM `een_tax_rule` tr
JOIN `een_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 21
AND tr.`id_tax_rules_group` = 8
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.061 ms 0 /classes/tax/TaxRulesTaxManager.php:109
472
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 4495
0.061 ms 1 /classes/Product.php:2902
37
SELECT SQL_NO_CACHE *
FROM `een_group` a
LEFT JOIN `een_group_shop` `c` ON a.`id_group` = c.`id_group` AND c.`id_shop` = 1
WHERE (a.`id_group` = 1) LIMIT 1
0.061 ms 1 /src/Adapter/EntityMapper.php:71
481
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 609473
0.060 ms 1 /classes/Product.php:2902
487
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 600667
0.060 ms 1 /classes/Product.php:2902
514
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 571471
0.060 ms 1 /classes/Product.php:2902
523
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 604308
0.060 ms 1 /classes/Product.php:2902
535
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "ps_currencyselector" LIMIT 1
0.060 ms 1 /classes/module/Module.php:2659
511
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 541355
0.060 ms 1 /classes/Product.php:2902
496
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 573233
0.059 ms 1 /classes/Product.php:2902
508
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 542487
0.059 ms 1 /classes/Product.php:2902
517
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 13135
0.059 ms 1 /classes/Product.php:2902
520
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 13136
0.059 ms 1 /classes/Product.php:2902
9
SELECT SQL_NO_CACHE *
FROM `een_lang` a
LEFT JOIN `een_lang_shop` `c` ON a.`id_lang` = c.`id_lang` AND c.`id_shop` = 1
WHERE (a.`id_lang` = 1) LIMIT 1
0.059 ms 1 /src/Adapter/EntityMapper.php:71
144
SELECT SQL_NO_CACHE `name`
FROM `een_hook`
WHERE `id_hook` = 1013 LIMIT 1
0.059 ms 1 /classes/Hook.php:244
475
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 4442
0.059 ms 1 /classes/Product.php:2902
478
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 4319
0.059 ms 1 /classes/Product.php:2902
484
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 603687
0.059 ms 1 /classes/Product.php:2902
490
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 596002
0.059 ms 1 /classes/Product.php:2902
493
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 585532
0.059 ms 1 /classes/Product.php:2902
502
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 567392
0.059 ms 1 /classes/Product.php:2902
31
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'US' LIMIT 1
0.058 ms 1 /classes/Country.php:194
107
SELECT SQL_NO_CACHE id_feed
FROM `een_gmcp_feeds` ff
WHERE (ff.id_shop=1) LIMIT 1
0.058 ms 370 /modules/gmerchantcenterpro/models/Feeds.php:53
28
SELECT SQL_NO_CACHE c.id_currency
FROM `een_currency` c
WHERE (iso_code = 'EUR') LIMIT 1
0.058 ms 1 /classes/Currency.php:893
34
SELECT SQL_NO_CACHE *
FROM `een_currency` a
LEFT JOIN `een_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
0.058 ms 1 /src/Adapter/EntityMapper.php:71
55
SELECT SQL_NO_CACHE *
FROM `een_country` a
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 17) LIMIT 1
0.058 ms 1 /src/Adapter/EntityMapper.php:71
59
SELECT SQL_NO_CACHE * FROM een_revslider_sliders
0.058 ms 1 /modules/revsliderprestashop/includes/revslider_db.class.php:214
63
SELECT SQL_NO_CACHE * FROM `een_image_type`
0.058 ms 8 /classes/ImageType.php:161
605
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "iqitsociallogin" LIMIT 1
0.058 ms 1 /classes/module/Module.php:2659
609
SELECT SQL_NO_CACHE data
FROM `een_ganalytics_data`
WHERE id_cart = 0
AND id_shop = 1 LIMIT 1
0.058 ms 0 /modules/ps_googleanalytics/classes/Repository/GanalyticsDataRepository.php:43
27
SELECT SQL_NO_CACHE `id_lang` FROM `een_lang`
WHERE `locale` = 'fr-fr'
OR `language_code` = 'fr-fr' LIMIT 1
0.057 ms 1 /classes/Language.php:883
11
SELECT SQL_NO_CACHE domain, domain_ssl
FROM een_shop_url
WHERE main = 1
AND id_shop = 1 LIMIT 1
0.057 ms 1 /classes/shop/ShopUrl.php:182
23
SELECT SQL_NO_CACHE * FROM `een_hook_module_exceptions`
WHERE `id_shop` IN (1)
0.057 ms 1 /classes/module/Module.php:2041
594
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "attributewizardpro" LIMIT 1
0.057 ms 0 /classes/module/Module.php:2659
113
SELECT SQL_NO_CACHE *
FROM `een_country_lang`
WHERE `id_country` = 8
0.056 ms 1 /src/Adapter/EntityMapper.php:79
129
SELECT SQL_NO_CACHE *
FROM `een_country` a
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 19) LIMIT 1
0.056 ms 1 /src/Adapter/EntityMapper.php:71
143
SELECT SQL_NO_CACHE id_order
FROM `een_orders` o
WHERE (o.id_cart=0) LIMIT 1
0.056 ms 1 /modules/gmerchantcenterpro/lib/dao/moduleDao.php:450
133
SELECT SQL_NO_CACHE *
FROM `een_country` a
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 4) LIMIT 1
0.055 ms 1 /src/Adapter/EntityMapper.php:71
178
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 0 LIMIT 1
0.055 ms 1 /classes/SpecificPrice.php:426
469
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 4498
0.055 ms 1 /classes/Product.php:2902
531
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 78 AND `id_shop` = 1 LIMIT 1
0.055 ms 1 /classes/module/Module.php:2132
604
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 19 AND `id_shop` = 1 LIMIT 1
0.055 ms 0 /classes/module/Module.php:2132
4
SELECT SQL_NO_CACHE *
FROM `een_shop` a
WHERE (a.`id_shop` = 1) LIMIT 1
0.055 ms 1 /src/Adapter/EntityMapper.php:71
116
SELECT SQL_NO_CACHE c.id_currency
FROM `een_currency` c
WHERE (deleted = 0) AND (iso_code = 'TND') LIMIT 1
0.054 ms 1 /classes/Currency.php:893
123
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'FR' LIMIT 1
0.054 ms 1 /classes/Country.php:194
21
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "ets_superspeed" LIMIT 1
0.053 ms 0 /classes/module/Module.php:2659
124
SELECT SQL_NO_CACHE c.id_currency
FROM `een_currency` c
WHERE (deleted = 0) AND (iso_code = 'MGA') LIMIT 1
0.053 ms 1 /classes/Currency.php:893
139
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'SA' LIMIT 1
0.053 ms 1 /classes/Country.php:194
548
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 24 AND `id_shop` = 1 LIMIT 1
0.053 ms 1 /classes/module/Module.php:2132
194
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 40036) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.053 ms 1 /classes/stock/StockAvailable.php:453
324
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 600667 AND id_shop=1 LIMIT 1
0.053 ms 1 /classes/Product.php:6876
543
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 79 AND `id_shop` = 1 LIMIT 1
0.053 ms 1 /classes/module/Module.php:2132
30
SELECT SQL_NO_CACHE `id_lang` FROM `een_lang`
WHERE `locale` = 'fr-fr'
OR `language_code` = 'fr-fr' LIMIT 1
0.052 ms 1 /classes/Language.php:883
33
SELECT SQL_NO_CACHE *
FROM `een_country_lang`
WHERE `id_country` = 21
0.052 ms 1 /src/Adapter/EntityMapper.php:79
137
SELECT SQL_NO_CACHE *
FROM `een_country` a
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 3) LIMIT 1
0.052 ms 1 /src/Adapter/EntityMapper.php:71
141
SELECT SQL_NO_CACHE *
FROM `een_country` a
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 186) LIMIT 1
0.052 ms 1 /src/Adapter/EntityMapper.php:71
175
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 369 LIMIT 1
0.052 ms 1 /classes/Category.php:1378
200
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 14272 LIMIT 1
0.052 ms 1 /classes/SpecificPrice.php:435
534
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 6 AND `id_shop` = 1 LIMIT 1
0.052 ms 1 /classes/module/Module.php:2132
537
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "iqitwishlist" LIMIT 1
0.052 ms 1 /classes/module/Module.php:2659
545
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 75 AND `id_shop` = 1 LIMIT 1
0.052 ms 1 /classes/module/Module.php:2132
550
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 74 AND `id_shop` = 1 LIMIT 1
0.052 ms 1 /classes/module/Module.php:2132
60
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "pm_advancedpack" LIMIT 1
0.051 ms 0 /classes/module/Module.php:2659
115
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'FR' LIMIT 1
0.051 ms 1 /classes/Country.php:194
118
SELECT SQL_NO_CACHE c.id_currency
FROM `een_currency` c
WHERE (deleted = 0) AND (iso_code = 'DZD') LIMIT 1
0.051 ms 1 /classes/Currency.php:893
122
SELECT SQL_NO_CACHE c.id_currency
FROM `een_currency` c
WHERE (deleted = 0) AND (iso_code = 'XOF') LIMIT 1
0.051 ms 1 /classes/Currency.php:893
126
SELECT SQL_NO_CACHE c.id_currency
FROM `een_currency` c
WHERE (deleted = 0) AND (iso_code = 'MAD') LIMIT 1
0.051 ms 1 /classes/Currency.php:893
460
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 12939
0.051 ms 1 /classes/Product.php:2902
536
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 7 AND `id_shop` = 1 LIMIT 1
0.051 ms 1 /classes/module/Module.php:2132
120
SELECT SQL_NO_CACHE c.id_currency
FROM `een_currency` c
WHERE (deleted = 0) AND (iso_code = 'XAF') LIMIT 1
0.051 ms 1 /classes/Currency.php:893
182
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE `from` BETWEEN '2026-05-04 00:00:00' AND '2026-05-04 23:59:59' LIMIT 1
0.050 ms 1 /classes/SpecificPrice.php:377
177
SELECT SQL_NO_CACHE `name`
FROM `een_manufacturer`
WHERE `id_manufacturer` = 1635
AND `active` = 1 LIMIT 1
0.050 ms 1 /classes/Manufacturer.php:316
187
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 40036 AND id_shop=1 LIMIT 1
0.050 ms 1 /classes/Product.php:6876
53
SELECT SQL_NO_CACHE format
FROM `een_address_format`
WHERE `id_country` = 17 LIMIT 1
0.049 ms 1 /classes/AddressFormat.php:656
56
SELECT SQL_NO_CACHE *
FROM `een_country_lang`
WHERE `id_country` = 17
0.049 ms 1 /src/Adapter/EntityMapper.php:79
127
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'CH' LIMIT 1
0.049 ms 1 /classes/Country.php:194
540
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 70 AND `id_shop` = 1 LIMIT 1
0.049 ms 1 /classes/module/Module.php:2132
607
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "iqitcookielaw" LIMIT 1
0.049 ms 1 /classes/module/Module.php:2659
40
SELECT SQL_NO_CACHE `id_category`
FROM `een_category_shop`
WHERE `id_category` = 2
AND `id_shop` = 1 LIMIT 1
0.049 ms 1 /classes/Category.php:2450
180
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE `id_product` != 0 LIMIT 1
0.049 ms 527 /classes/SpecificPrice.php:297
311
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 2368 LIMIT 1
0.049 ms 1 /classes/Category.php:1378
38
SELECT SQL_NO_CACHE *
FROM `een_group_lang`
WHERE `id_group` = 1
0.048 ms 1 /src/Adapter/EntityMapper.php:79
117
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'FR' LIMIT 1
0.048 ms 1 /classes/Country.php:194
131
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'CA' LIMIT 1
0.048 ms 1 /classes/Country.php:194
8
SELECT SQL_NO_CACHE *
FROM `een_shop_group` a
WHERE (a.`id_shop_group` = 1) LIMIT 1
0.048 ms 1 /src/Adapter/EntityMapper.php:71
35
SELECT SQL_NO_CACHE *
FROM `een_currency_lang`
WHERE `id_currency` = 1
0.048 ms 1 /src/Adapter/EntityMapper.php:79
111
SELECT SQL_NO_CACHE `name`
FROM `een_country_lang`
WHERE `id_lang` = 1
AND `id_country` = 8 LIMIT 1
0.048 ms 1 /classes/Country.php:252
450
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 40036
0.048 ms 1 /classes/Product.php:2902
451
SELECT SQL_NO_CACHE state FROM een_feature_flag WHERE name = 'multiple_image_format' LIMIT 1
0.048 ms 1 /classes/FeatureFlag.php:105
434
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 13136 AND id_shop=1 LIMIT 1
0.047 ms 1 /classes/Product.php:6876
130
SELECT SQL_NO_CACHE *
FROM `een_country_lang`
WHERE `id_country` = 19
0.047 ms 1 /src/Adapter/EntityMapper.php:79
135
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'BE' LIMIT 1
0.047 ms 1 /classes/Country.php:194
192
SELECT SQL_NO_CACHE `reduction`
FROM `een_group`
WHERE `id_group` = 1 LIMIT 1
0.047 ms 1 /classes/Group.php:154
210
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 1013 LIMIT 1
0.047 ms 1 /classes/Category.php:1378
256
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1038 LIMIT 1
0.047 ms 1 /classes/Product.php:5659
454
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 14272
0.047 ms 1 /classes/Product.php:2902
538
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 87 AND `id_shop` = 1 LIMIT 1
0.047 ms 1 /classes/module/Module.php:2132
606
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 93 AND `id_shop` = 1 LIMIT 1
0.047 ms 1 /classes/module/Module.php:2132
50
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "ps_legalcompliance" LIMIT 1
0.046 ms 0 /classes/module/Module.php:2659
119
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'FR' LIMIT 1
0.046 ms 1 /classes/Country.php:194
132
SELECT SQL_NO_CACHE `name`
FROM `een_country_lang`
WHERE `id_lang` = 1
AND `id_country` = 4 LIMIT 1
0.046 ms 1 /classes/Country.php:252
134
SELECT SQL_NO_CACHE *
FROM `een_country_lang`
WHERE `id_country` = 4
0.046 ms 1 /src/Adapter/EntityMapper.php:79
138
SELECT SQL_NO_CACHE *
FROM `een_country_lang`
WHERE `id_country` = 3
0.046 ms 1 /src/Adapter/EntityMapper.php:79
142
SELECT SQL_NO_CACHE *
FROM `een_country_lang`
WHERE `id_country` = 186
0.046 ms 1 /src/Adapter/EntityMapper.php:79
145
SELECT SQL_NO_CACHE `id_category`
FROM `een_category_shop`
WHERE `id_category` = 2
AND `id_shop` = 1 LIMIT 1
0.046 ms 1 /classes/Category.php:2450
179
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 40036 LIMIT 1
0.046 ms 1 /classes/SpecificPrice.php:435
191
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 40036 AND `id_group` = 1 LIMIT 1
0.046 ms 0 /classes/GroupReduction.php:156
218
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 13137) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.046 ms 1 /classes/stock/StockAvailable.php:453
232
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 1038 LIMIT 1
0.046 ms 1 /classes/Category.php:1378
234
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 6655 LIMIT 1
0.046 ms 1 /classes/SpecificPrice.php:435
457
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 13137
0.046 ms 1 /classes/Product.php:2902
121
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'FR' LIMIT 1
0.045 ms 1 /classes/Country.php:194
125
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'FR' LIMIT 1
0.045 ms 1 /classes/Country.php:194
378
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 5727 LIMIT 1
0.045 ms 1 /classes/Product.php:5659
463
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 6655
0.045 ms 1 /classes/Product.php:2902
466
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 6363
0.045 ms 1 /classes/Product.php:2902
198
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 1042 LIMIT 1
0.045 ms 1 /classes/Category.php:1378
57
SELECT SQL_NO_CACHE id_required_field, object_name, field_name
FROM een_required_field
0.044 ms 1 /classes/ObjectModel.php:1592
244
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 1043 LIMIT 1
0.044 ms 1 /classes/Category.php:1378
361
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 572166 LIMIT 1
0.044 ms 1 /classes/SpecificPrice.php:435
600
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "blockwishlist" LIMIT 1
0.044 ms 1 /classes/module/Module.php:2659
578
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "onepagecheckout" LIMIT 1
0.043 ms 0 /classes/module/Module.php:2659
41
SELECT SQL_NO_CACHE ctg.`id_group`
FROM een_category_group ctg
WHERE ctg.`id_category` = 2 AND ctg.`id_group` = 1 LIMIT 1
0.043 ms 1 /classes/Category.php:1754
212
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 13137 LIMIT 1
0.043 ms 1 /classes/SpecificPrice.php:435
223
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 12939 LIMIT 1
0.043 ms 1 /classes/SpecificPrice.php:435
359
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 5845 LIMIT 1
0.043 ms 1 /classes/Category.php:1378
374
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 567392) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.043 ms 1 /classes/stock/StockAvailable.php:453
577
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.043 ms 0 /classes/module/Module.php:2132
313
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 603687 LIMIT 1
0.042 ms 1 /classes/SpecificPrice.php:435
36
SELECT SQL_NO_CACHE id_shop
FROM `een_currency_shop`
WHERE `id_currency` = 1
AND id_shop = 1 LIMIT 1
0.042 ms 1 /classes/ObjectModel.php:1729
128
SELECT SQL_NO_CACHE `name`
FROM `een_country_lang`
WHERE `id_lang` = 1
AND `id_country` = 19 LIMIT 1
0.042 ms 1 /classes/Country.php:252
204
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 14272 AND id_shop=1 LIMIT 1
0.042 ms 1 /classes/Product.php:6876
206
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 14272) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.042 ms 1 /classes/stock/StockAvailable.php:453
222
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1042 LIMIT 1
0.042 ms 1 /classes/Product.php:5659
228
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 12939) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.042 ms 1 /classes/stock/StockAvailable.php:453
238
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 6655 AND id_shop=1 LIMIT 1
0.042 ms 1 /classes/Product.php:6876
240
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 6655) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.042 ms 1 /classes/stock/StockAvailable.php:453
246
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 6363 LIMIT 1
0.042 ms 1 /classes/SpecificPrice.php:435
257
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 4498 LIMIT 1
0.042 ms 1 /classes/SpecificPrice.php:435
268
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 4495 LIMIT 1
0.042 ms 1 /classes/SpecificPrice.php:435
279
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 4442 LIMIT 1
0.042 ms 1 /classes/SpecificPrice.php:435
290
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 4319 LIMIT 1
0.042 ms 1 /classes/SpecificPrice.php:435
300
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 1020 LIMIT 1
0.042 ms 1 /classes/Category.php:1378
340
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 5799 LIMIT 1
0.042 ms 1 /classes/Category.php:1378
387
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 441 LIMIT 1
0.042 ms 1 /classes/Category.php:1378
389
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 542487 LIMIT 1
0.042 ms 1 /classes/SpecificPrice.php:435
397
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 1027 LIMIT 1
0.042 ms 1 /classes/Category.php:1378
441
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 604308 LIMIT 1
0.042 ms 1 /classes/SpecificPrice.php:435
140
SELECT SQL_NO_CACHE `name`
FROM `een_country_lang`
WHERE `id_lang` = 1
AND `id_country` = 186 LIMIT 1
0.041 ms 1 /classes/Country.php:252
183
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE `to` BETWEEN '2026-05-04 00:00:00' AND '2026-05-04 23:59:59' LIMIT 1
0.041 ms 1 /classes/SpecificPrice.php:381
216
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 13137 AND id_shop=1 LIMIT 1
0.041 ms 1 /classes/Product.php:6876
233
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1038 LIMIT 1
0.041 ms 1 /classes/Product.php:5659
278
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1038 LIMIT 1
0.041 ms 1 /classes/Product.php:5659
285
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 4442) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.041 ms 1 /classes/stock/StockAvailable.php:453
296
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 4319) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.041 ms 1 /classes/stock/StockAvailable.php:453
307
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 609473) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.041 ms 1 /classes/stock/StockAvailable.php:453
322
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 600667 LIMIT 1
0.041 ms 1 /classes/SpecificPrice.php:435
326
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 600667) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.041 ms 1 /classes/stock/StockAvailable.php:453
330
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 5727 LIMIT 1
0.041 ms 1 /classes/Category.php:1378
342
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 585532 LIMIT 1
0.041 ms 1 /classes/SpecificPrice.php:435
351
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 573233 LIMIT 1
0.041 ms 1 /classes/SpecificPrice.php:435
370
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 567392 LIMIT 1
0.041 ms 1 /classes/SpecificPrice.php:435
379
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 544260 LIMIT 1
0.041 ms 1 /classes/SpecificPrice.php:435
399
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 541355 LIMIT 1
0.041 ms 1 /classes/SpecificPrice.php:435
407
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 1047 LIMIT 1
0.041 ms 1 /classes/Category.php:1378
411
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 571471 AND id_shop=1 LIMIT 1
0.041 ms 1 /classes/Product.php:6876
417
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 1011 LIMIT 1
0.041 ms 1 /classes/Category.php:1378
419
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 13135 LIMIT 1
0.041 ms 1 /classes/SpecificPrice.php:435
423
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 13135 AND id_shop=1 LIMIT 1
0.041 ms 1 /classes/Product.php:6876
430
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 13136 LIMIT 1
0.041 ms 1 /classes/SpecificPrice.php:435
436
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 13136) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.041 ms 1 /classes/stock/StockAvailable.php:453
440
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1013 LIMIT 1
0.041 ms 1 /classes/Product.php:5659
579
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.041 ms 0 /classes/module/Module.php:2132
10
SELECT SQL_NO_CACHE id_shop
FROM `een_lang_shop`
WHERE `id_lang` = 1
AND id_shop = 1 LIMIT 1
0.040 ms 1 /classes/ObjectModel.php:1729
39
SELECT SQL_NO_CACHE id_shop
FROM `een_group_shop`
WHERE `id_group` = 1
AND id_shop = 1 LIMIT 1
0.040 ms 1 /classes/ObjectModel.php:1729
136
SELECT SQL_NO_CACHE `name`
FROM `een_country_lang`
WHERE `id_lang` = 1
AND `id_country` = 3 LIMIT 1
0.040 ms 1 /classes/Country.php:252
225
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 12939 AND id_shop=1 LIMIT 1
0.040 ms 1 /classes/Product.php:6876
250
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 6363 AND id_shop=1 LIMIT 1
0.040 ms 1 /classes/Product.php:6876
252
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 6363) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.040 ms 1 /classes/stock/StockAvailable.php:453
261
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 4498 AND id_shop=1 LIMIT 1
0.040 ms 1 /classes/Product.php:6876
263
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 4498) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.040 ms 1 /classes/stock/StockAvailable.php:453
289
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1042 LIMIT 1
0.040 ms 1 /classes/Product.php:5659
294
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 4319 AND id_shop=1 LIMIT 1
0.040 ms 1 /classes/Product.php:6876
317
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 603687) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.040 ms 1 /classes/stock/StockAvailable.php:453
336
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 596002) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.040 ms 1 /classes/stock/StockAvailable.php:453
346
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 585532) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.040 ms 1 /classes/stock/StockAvailable.php:453
350
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 5727 LIMIT 1
0.040 ms 1 /classes/Product.php:5659
365
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 572166) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.040 ms 1 /classes/stock/StockAvailable.php:453
403
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 541355) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.040 ms 1 /classes/stock/StockAvailable.php:453
409
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 571471 LIMIT 1
0.040 ms 1 /classes/SpecificPrice.php:435
413
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 571471) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.040 ms 1 /classes/stock/StockAvailable.php:453
425
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 13135) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.040 ms 1 /classes/stock/StockAvailable.php:453
22
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.040 ms 0 /classes/module/Module.php:2132
272
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 4495 AND id_shop=1 LIMIT 1
0.040 ms 1 /classes/Product.php:6876
303
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 609473 LIMIT 1
0.040 ms 1 /classes/SpecificPrice.php:435
332
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 596002 LIMIT 1
0.040 ms 1 /classes/SpecificPrice.php:435
355
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 573233) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.040 ms 1 /classes/stock/StockAvailable.php:453
369
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 5727 LIMIT 1
0.040 ms 1 /classes/Product.php:5659
383
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 544260) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.040 ms 1 /classes/stock/StockAvailable.php:453
49
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.039 ms 0 /classes/module/Module.php:2132
267
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1038 LIMIT 1
0.039 ms 1 /classes/Product.php:5659
283
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 4442 AND id_shop=1 LIMIT 1
0.039 ms 1 /classes/Product.php:6876
315
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 603687 AND id_shop=1 LIMIT 1
0.039 ms 1 /classes/Product.php:6876
321
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1020 LIMIT 1
0.039 ms 1 /classes/Product.php:5659
372
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 567392 AND id_shop=1 LIMIT 1
0.039 ms 1 /classes/Product.php:6876
381
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 544260 AND id_shop=1 LIMIT 1
0.039 ms 1 /classes/Product.php:6876
393
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 542487) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.039 ms 1 /classes/stock/StockAvailable.php:453
445
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 604308) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.039 ms 1 /classes/stock/StockAvailable.php:453
608
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 72 AND `id_shop` = 1 LIMIT 1
0.039 ms 1 /classes/module/Module.php:2132
274
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 4495) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.039 ms 1 /classes/stock/StockAvailable.php:453
344
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 585532 AND id_shop=1 LIMIT 1
0.039 ms 1 /classes/Product.php:6876
353
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 573233 AND id_shop=1 LIMIT 1
0.039 ms 1 /classes/Product.php:6876
363
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 572166 AND id_shop=1 LIMIT 1
0.039 ms 1 /classes/Product.php:6876
401
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 541355 AND id_shop=1 LIMIT 1
0.039 ms 1 /classes/Product.php:6876
429
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1011 LIMIT 1
0.039 ms 1 /classes/Product.php:5659
443
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 604308 AND id_shop=1 LIMIT 1
0.039 ms 1 /classes/Product.php:6876
176
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 369 LIMIT 1
0.038 ms 1 /classes/Product.php:5659
334
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 596002 AND id_shop=1 LIMIT 1
0.038 ms 1 /classes/Product.php:6876
305
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 609473 AND id_shop=1 LIMIT 1
0.038 ms 1 /classes/Product.php:6876
391
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 542487 AND id_shop=1 LIMIT 1
0.038 ms 1 /classes/Product.php:6876
73
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_last_product_not_ordered` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `last_product_ordered` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
0.037 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
184
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 40036
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.037 ms 0 /classes/SpecificPrice.php:259
312
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 2368 LIMIT 1
0.037 ms 1 /classes/Product.php:5659
235
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 6655
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.036 ms 0 /classes/SpecificPrice.php:259
258
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 4498
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.036 ms 0 /classes/SpecificPrice.php:259
398
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1027 LIMIT 1
0.036 ms 1 /classes/Product.php:5659
595
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.036 ms 0 /classes/module/Module.php:2132
51
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.035 ms 0 /classes/module/Module.php:2132
54
SELECT SQL_NO_CACHE `need_identification_number`
FROM `een_country`
WHERE `id_country` = 17 LIMIT 1
0.035 ms 1 /classes/Country.php:405
61
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "gsnippetsreviews" LIMIT 1
0.035 ms 0 /classes/module/Module.php:2659
211
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1013 LIMIT 1
0.035 ms 1 /classes/Product.php:5659
201
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 14272
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.035 ms 0 /classes/SpecificPrice.php:259
62
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "gremarketing" LIMIT 1
0.034 ms 0 /classes/module/Module.php:2659
199
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1042 LIMIT 1
0.034 ms 1 /classes/Product.php:5659
245
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1043 LIMIT 1
0.034 ms 1 /classes/Product.php:5659
580
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "onepagecheckoutps" LIMIT 1
0.034 ms 0 /classes/module/Module.php:2659
581
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.034 ms 0 /classes/module/Module.php:2132
213
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 13137
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.034 ms 0 /classes/SpecificPrice.php:259
280
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 4442
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.033 ms 0 /classes/SpecificPrice.php:259
341
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 5799 LIMIT 1
0.033 ms 1 /classes/Product.php:5659
345
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 585532 AND `id_group` = 1 LIMIT 1
0.033 ms 0 /classes/GroupReduction.php:156
408
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1047 LIMIT 1
0.033 ms 1 /classes/Product.php:5659
67
CREATE TABLE IF NOT EXISTS `een_gmcp_feeds` (`id_feed` int(11) NOT NULL AUTO_INCREMENT,`iso_lang` LONGTEXT NOT NULL,`iso_country` LONGTEXT NOT NULL,`iso_currency` LONGTEXT NOT NULL, `taxonomy` LONGTEXT NOT NULL, `id_shop` int(11) NOT NULL,`date_add` datetime NOT NULL,`date_upd` datetime NOT NULL,PRIMARY KEY (`id_feed`)) ENGINE=' . _MYSQL_ENGINE_ . ' DEFAULT CHARSET=utf8;
0.033 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
247
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 6363
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.033 ms 0 /classes/SpecificPrice.php:259
269
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 4495
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.033 ms 0 /classes/SpecificPrice.php:259
291
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 4319
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.033 ms 0 /classes/SpecificPrice.php:259
301
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1020 LIMIT 1
0.033 ms 1 /classes/Product.php:5659
360
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 5845 LIMIT 1
0.033 ms 1 /classes/Product.php:5659
418
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1011 LIMIT 1
0.033 ms 1 /classes/Product.php:5659
420
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 13135
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.033 ms 0 /classes/SpecificPrice.php:259
431
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 13136
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.033 ms 0 /classes/SpecificPrice.php:259
227
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 12939 AND `id_group` = 1 LIMIT 1
0.032 ms 0 /classes/GroupReduction.php:156
302
SELECT SQL_NO_CACHE `name`
FROM `een_manufacturer`
WHERE `id_manufacturer` = 11523
AND `active` = 1 LIMIT 1
0.032 ms 1 /classes/Manufacturer.php:316
239
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 6655 AND `id_group` = 1 LIMIT 1
0.032 ms 0 /classes/GroupReduction.php:156
331
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 5727 LIMIT 1
0.032 ms 1 /classes/Product.php:5659
364
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 572166 AND `id_group` = 1 LIMIT 1
0.032 ms 0 /classes/GroupReduction.php:156
388
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 441 LIMIT 1
0.032 ms 1 /classes/Product.php:5659
583
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.032 ms 0 /classes/module/Module.php:2132
217
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 13137 AND `id_group` = 1 LIMIT 1
0.031 ms 0 /classes/GroupReduction.php:156
68
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_price_range` (`id_tag` int(11) NOT NULL, `price_min` CHAR(255) NOT NULL, `price_max` CHAR(255), `id_product` CHAR(255), UNIQUE KEY `tag_price_range` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
0.031 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
205
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 14272 AND `id_group` = 1 LIMIT 1
0.031 ms 0 /classes/GroupReduction.php:156
284
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 4442 AND `id_group` = 1 LIMIT 1
0.031 ms 0 /classes/GroupReduction.php:156
295
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 4319 AND `id_group` = 1 LIMIT 1
0.031 ms 0 /classes/GroupReduction.php:156
325
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 600667 AND `id_group` = 1 LIMIT 1
0.031 ms 0 /classes/GroupReduction.php:156
354
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 573233 AND `id_group` = 1 LIMIT 1
0.031 ms 0 /classes/GroupReduction.php:156
373
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 567392 AND `id_group` = 1 LIMIT 1
0.031 ms 0 /classes/GroupReduction.php:156
424
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 13135 AND `id_group` = 1 LIMIT 1
0.031 ms 0 /classes/GroupReduction.php:156
582
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "steasycheckout" LIMIT 1
0.031 ms 0 /classes/module/Module.php:2659
585
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.031 ms 0 /classes/module/Module.php:2132
601
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 3 AND `id_shop` = 1 LIMIT 1
0.031 ms 0 /classes/module/Module.php:2132
251
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 6363 AND `id_group` = 1 LIMIT 1
0.030 ms 0 /classes/GroupReduction.php:156
273
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 4495 AND `id_group` = 1 LIMIT 1
0.030 ms 0 /classes/GroupReduction.php:156
335
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 596002 AND `id_group` = 1 LIMIT 1
0.030 ms 0 /classes/GroupReduction.php:156
402
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 541355 AND `id_group` = 1 LIMIT 1
0.030 ms 0 /classes/GroupReduction.php:156
584
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "thecheckout" LIMIT 1
0.030 ms 0 /classes/module/Module.php:2659
586
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "idxropc" LIMIT 1
0.030 ms 0 /classes/module/Module.php:2659
587
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.030 ms 0 /classes/module/Module.php:2132
589
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.030 ms 0 /classes/module/Module.php:2132
591
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.030 ms 0 /classes/module/Module.php:2132
382
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 544260 AND `id_group` = 1 LIMIT 1
0.030 ms 0 /classes/GroupReduction.php:156
435
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 13136 AND `id_group` = 1 LIMIT 1
0.030 ms 0 /classes/GroupReduction.php:156
69
CREATE TABLE IF NOT EXISTS `een_gmcp_tmp_rules`(`id` int(11) NOT NULL AUTO_INCREMENT, `id_shop` int(11) NOT NULL DEFAULT "1",`type` char(255) NOT NULL, `exclusion_values` longtext NOT NULL, PRIMARY KEY (`id`)) ENGINE=InnoDB DEFAULT CHARSET=utf8 AUTO_INCREMENT=1;
0.029 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
262
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 4498 AND `id_group` = 1 LIMIT 1
0.029 ms 0 /classes/GroupReduction.php:156
306
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 609473 AND `id_group` = 1 LIMIT 1
0.029 ms 0 /classes/GroupReduction.php:156
392
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 542487 AND `id_group` = 1 LIMIT 1
0.029 ms 0 /classes/GroupReduction.php:156
412
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 571471 AND `id_group` = 1 LIMIT 1
0.029 ms 0 /classes/GroupReduction.php:156
444
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 604308 AND `id_group` = 1 LIMIT 1
0.029 ms 0 /classes/GroupReduction.php:156
596
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "cdesigner" LIMIT 1
0.029 ms 0 /classes/module/Module.php:2659
316
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 603687 AND `id_group` = 1 LIMIT 1
0.029 ms 0 /classes/GroupReduction.php:156
588
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "pwpaysoncheckout" LIMIT 1
0.029 ms 0 /classes/module/Module.php:2659
590
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "easycheckout" LIMIT 1
0.029 ms 0 /classes/module/Module.php:2659
597
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.029 ms 0 /classes/module/Module.php:2132
76
CREATE TABLE IF NOT EXISTS `een_gmcp_tags` (`id_tag` int(11) NOT NULL AUTO_INCREMENT, `id_shop` int(11) NOT NULL DEFAULT "1", `name` char(255) NOT NULL, `type` char(255) NOT NULL, `active` TINYINT NOT NULL, `position` INT NOT NULL, `end_date` DATE, PRIMARY KEY (`id_tag`)) ENGINE=MyISAM DEFAULT CHARSET=utf8 AUTO_INCREMENT=1 ;
0.028 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
598
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "configurator" LIMIT 1
0.028 ms 0 /classes/module/Module.php:2659
599
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.028 ms 0 /classes/module/Module.php:2132
70
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_last_product_ordered` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `last_product_ordered` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
0.027 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
84
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_products` (`id_tag` int(11) NOT NULL, `id_product` int(11) NOT NULL, product_name VARCHAR (255) NOT NULL, UNIQUE KEY `tag_product` (`id_tag`,`id_product`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
0.027 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
74
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_last_product_not_ordered` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `last_product_ordered` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
0.027 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
75
CREATE TABLE IF NOT EXISTS `een_gmcp_discount_association` (`id_association` int(11) NOT NULL AUTO_INCREMENT, `id_discount` int(11) NOT NULL, `id_product` int(11) NOT NULL, `channel` CHAR(120) NOT NULL DEFAULT "SHOPPING_ADS", PRIMARY KEY (`id_association`) ) ENGINE=MyISAM DEFAULT CHARSET=utf8;
0.027 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
77
CREATE TABLE IF NOT EXISTS `een_gmcp_taxonomy` (`id_taxonomy` int(11) NOT NULL AUTO_INCREMENT, `value` text NOT NULL, `lang` varchar(5) NOT NULL, PRIMARY KEY (`id_taxonomy`), KEY `lang` (`lang`), FULLTEXT KEY `ft_index` (`value`)) ENGINE=MyISAM DEFAULT CHARSET=utf8 AUTO_INCREMENT=1;
0.027 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
83
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_cats` (`id_tag` int(11) NOT NULL, `id_category` int(11) NOT NULL, UNIQUE KEY `tag_cat` (`id_tag`,`id_category`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
0.027 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
64
BEGIN
0.026 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:81
79
CREATE TABLE IF NOT EXISTS `een_gmcp_taxonomy_categories` (`id_category` int(11) NOT NULL, `id_shop` int(3) NOT NULL DEFAULT "1", `txt_taxonomy` text NOT NULL, `lang` char(5) NOT NULL, KEY `id_category` (`id_category`,`lang`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
0.026 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
81
CREATE TABLE IF NOT EXISTS `een_gmcp_tags` (`id_tag` int(11) NOT NULL AUTO_INCREMENT, `id_shop` int(11) NOT NULL DEFAULT "1", `name` char(255) NOT NULL, `type` char(255) NOT NULL, `active` TINYINT NOT NULL, `position` INT NOT NULL, `end_date` DATE, PRIMARY KEY (`id_tag`)) ENGINE=MyISAM DEFAULT CHARSET=utf8 AUTO_INCREMENT=1 ;
0.026 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
71
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_promotion` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `promotion` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
0.025 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
87
CREATE TABLE IF NOT EXISTS `een_gmcp_discount_association` (`id_association` int(11) NOT NULL AUTO_INCREMENT, `id_discount` int(11) NOT NULL, `id_product` int(11) NOT NULL, `channel` CHAR(120) NOT NULL DEFAULT "SHOPPING_ADS", PRIMARY KEY (`id_association`) ) ENGINE=MyISAM DEFAULT CHARSET=utf8;
0.025 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
90
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_new_product` (`id_tag` int(11) NOT NULL,  `from_date` DATETIME, `id_product` int,  `id_shop` int(11) NOT NULL,  UNIQUE KEY `tag_new_product` (`id_tag`, `id_product`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
0.025 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
91
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_best_sale` (`id_tag` int(11) NOT NULL, `amount` CHAR(255) NOT NULL, `unit` CHAR(255) ,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255),  `id_shop` int(11) NOT NULL,  UNIQUE KEY `tag_best_sales` (`id_tag`, `id_product`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
0.025 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
95
CREATE TABLE IF NOT EXISTS `een_gmcp_reporting` (`id_reporting` int(11) NOT NULL AUTO_INCREMENT,`iso_feed` LONGTEXT NOT NULL,    `reporting_content` LONGTEXT NOT NULL,`id_shop` int(11) NOT NULL,`date_add` datetime NOT NULL,`date_upd` datetime NOT NULL,PRIMARY KEY (`id_reporting`)) ENGINE=' . _MYSQL_ENGINE_ . ' DEFAULT CHARSET=utf8;
0.025 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
96
CREATE TABLE IF NOT EXISTS `een_gmcp_feeds` (`id_feed` int(11) NOT NULL AUTO_INCREMENT,`iso_lang` LONGTEXT NOT NULL,`iso_country` LONGTEXT NOT NULL,`iso_currency` LONGTEXT NOT NULL, `taxonomy` LONGTEXT NOT NULL, `id_shop` int(11) NOT NULL,`date_add` datetime NOT NULL,`date_upd` datetime NOT NULL,PRIMARY KEY (`id_feed`)) ENGINE=' . _MYSQL_ENGINE_ . ' DEFAULT CHARSET=utf8;
0.025 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
106
COMMIT
0.025 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:155
78
CREATE TABLE IF NOT EXISTS `een_gmcp_categories` (`id_category` int(11) NOT NULL, `id_shop` int(11) NOT NULL DEFAULT "1",  UNIQUE KEY `id_category` (`id_category`, `id_shop`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
0.025 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
85
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_suppliers` (`id_tag` int(11) NOT NULL, `id_supplier` int(11) NOT NULL, UNIQUE KEY `tag_supplier` (`id_tag`,`id_supplier`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
0.024 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
86
CREATE TABLE IF NOT EXISTS `een_gmcp_features_by_cat` (`id_cat` int(11) NOT NULL DEFAULT '0', `id_shop` int(3) NOT NULL DEFAULT "1", `values` text NOT NULL, PRIMARY KEY (`id_cat`, `id_shop`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
0.024 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
88
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_features` (`id_tag` int(11) NOT NULL, `id_feature` int(11) NOT NULL, `id_shop` int(11) NOT NULL,  UNIQUE KEY `tag_feature` (`id_tag`, `id_feature`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
0.024 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
97
CREATE TABLE IF NOT EXISTS `een_gmcp_advanced_exclusion` (`id` int(11) NOT NULL AUTO_INCREMENT, `status` int(11) NOT NULL DEFAULT "1", `id_shop` int(11) NOT NULL DEFAULT "1", `name` char(255) NOT NULL, `type` char(255) NOT NULL, `exclusion_value` longtext NOT NULL, PRIMARY KEY (`id`)) ENGINE=InnoDB DEFAULT CHARSET=utf8 AUTO_INCREMENT=1;
0.024 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
80
CREATE TABLE IF NOT EXISTS `een_gmcp_brands` (`id_brands` int(11) NOT NULL, `id_shop` int(11) NOT NULL DEFAULT "1",  UNIQUE KEY `id_brands` (`id_brands`, `id_shop`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
0.024 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
89
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_categories` (`id_tag` int(11) NOT NULL, `id_category` int(11) NOT NULL, `id_shop` int(11) NOT NULL,  UNIQUE KEY `tag_feature` (`id_tag`, `id_category`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
0.024 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
93
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_last_product_not_ordered` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `last_product_ordered` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
0.023 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
98
CREATE TABLE IF NOT EXISTS `een_gmcp_product_excluded` (`id_rule` int(11) NOT NULL DEFAULT "0",`id_product` int(11) NOT NULL DEFAULT "0", `id_product_attribute` int(11)) ENGINE=InnoDB DEFAULT CHARSET=utf8 AUTO_INCREMENT=1;
0.023 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
82
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_brands` (`id_tag` int(11) NOT NULL, `id_brand` int(11) NOT NULL, UNIQUE KEY `tag_brand` (`id_tag`,`id_brand`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
0.023 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
100
CREATE TABLE IF NOT EXISTS `een_gmcp_tmp_rules`(`id` int(11) NOT NULL AUTO_INCREMENT, `id_shop` int(11) NOT NULL DEFAULT "1",`type` char(255) NOT NULL, `exclusion_values` longtext NOT NULL, PRIMARY KEY (`id`)) ENGINE=InnoDB DEFAULT CHARSET=utf8 AUTO_INCREMENT=1;
0.023 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
92
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_last_product_ordered` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `last_product_ordered` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
0.022 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
94
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_promotion` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `promotion` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
0.022 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
99
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_price_range` (`id_tag` int(11) NOT NULL, `price_min` CHAR(255) NOT NULL, `price_max` CHAR(255), `id_product` CHAR(255), UNIQUE KEY `tag_price_range` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
0.022 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
101
COMMIT
0.017 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:107
102
BEGIN
0.016 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:121

Doubles

27 queries
SELECT `id_module` FROM `een_module_shop` WHERE `id_module` = XX AND `id_shop` = XX LIMIT XX
26 queries
SELECT XX FROM `een_specific_price` WHERE id_product = XX LIMIT XX
25 queries
SELECT image_shop.`id_image`
                    FROM `een_image` i
                     INNER JOIN een_image_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
                    WHERE i.`id_product` = XX
                    AND image_shop.`cover` = XX LIMIT XX
25 queries
SELECT name FROM een_category_lang WHERE id_shop = XX AND id_lang = XX AND id_category = XX LIMIT XX
25 queries
SELECT product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,XX) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = XX)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = XX)
WHERE (p.`id_product` = XX)
25 queries
                            SELECT `id_tax_rules_group`
                            FROM `een_product_shop`
                            WHERE `id_product` = XX AND id_shop=XX LIMIT XX
25 queries
			SELECT `reduction`
			FROM `een_product_group_reduction_cache`
			WHERE `id_product` = XX AND `id_group` = XX LIMIT XX
25 queries
SELECT SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
25 queries
SELECT
            COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), XX) as deep_quantity,
            COALESCE(SUM(first_level_quantity), XX) as quantity
          FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, XX as pack_quantity
          FROM `een_cart_product` cp
            WHERE cp.`id_product_attribute` = XX
            
            AND cp.`id_cart` = XX AND cp.`id_product` = XX UNION SELECT XX as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
          FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
            WHERE cp.`id_product_attribute` = XX
            
            AND cp.`id_cart` = XX AND p.`id_product_item` = XX AND (pr.`pack_stock_type` IN (XX,XX) OR (
            pr.`pack_stock_type` = XX
            AND XX = XX
        ))) as q LIMIT XX
25 queries
                SELECT name, value, pf.id_feature, f.position, fvl.id_feature_value
                FROM een_feature_product pf
                LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = XX)
                LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = XX)
                LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = XX)
                 INNER JOIN een_feature_shop feature_shop
        ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = XX)
                WHERE pf.id_product = XX
                ORDER BY f.position ASC
25 queries
SELECT *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = XX
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = XX
WHERE (a.`id_product` = XX) AND (b.`id_shop` = XX) LIMIT XX
25 queries
            SELECT image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
            FROM `een_image` i
             INNER JOIN een_image_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
            LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = XX)
            WHERE i.`id_product` = XX
            ORDER BY `position`
25 queries
SELECT `id_product_attribute`
            FROM `een_product_attribute`
            WHERE `id_product` = XX
25 queries
SELECT pa.`id_product`, a.`color`, pac.`id_product_attribute`, XX qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
            FROM `een_product_attribute` pa
             INNER JOIN een_product_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX)
            JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
            JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
            JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = XX)
            JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
            WHERE pa.`id_product` IN (XX) AND ag.`is_color_group` = XX
            GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
            
            ORDER BY a.`position` ASC;
14 queries
			SELECT cl.`link_rewrite`
			FROM `een_category_lang` cl
			WHERE `id_lang` = XX
			 AND cl.id_shop = XX 
			AND cl.`id_category` = XX LIMIT XX
11 queries
				SELECT `priority`, `id_specific_price_priority`
				FROM `een_specific_price_priority`
				WHERE `id_product` = XX
				ORDER BY `id_specific_price_priority` DESC LIMIT XX
11 queries
			SELECT *, ( IF (`id_shop` = XX, XX, XX) +  IF (`id_country` = XX, XX, XX) +  IF (`id_currency` = XX, XX, XX) +  IF (`id_group` = XX, XX, XX) +  IF (`id_customer` = XX, XX, XX)) AS `score`
				FROM `een_specific_price`
				WHERE
                `id_shop` IN (XX, XX) AND
                `id_currency` IN (XX, XX) AND
                `id_country` IN (XX, XX) AND
                `id_group` IN (XX, XX) AND `id_product` = XX AND `id_customer` = XX AND `id_product_attribute` = XX AND `id_cart` = XX  AND (`from` = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' >= `from`) AND (`to` = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' <= `to`)
				AND IF(`from_quantity` > XX, `from_quantity`, XX) <= XX ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT XX
7 queries
SELECT *
FROM `een_country` a
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = XX
WHERE (a.`id_country` = XX) LIMIT XX
7 queries
SELECT *
							FROM `een_country_lang`
							WHERE `id_country` = XX
7 queries
			SELECT `id_country`
			FROM `een_country`
			WHERE `iso_code` = 'FR' LIMIT XX
6 queries
SELECT *
FROM `een_category` a
LEFT JOIN `een_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = XX
LEFT JOIN `een_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = XX
WHERE (a.`id_category` = XX) AND (b.`id_shop` = XX) LIMIT XX
5 queries
							SELECT `name`
							FROM `een_country_lang`
							WHERE `id_lang` = XX
							AND `id_country` = XX LIMIT XX
5 queries
SELECT v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `een_feature_value` v LEFT JOIN `een_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = XX) LEFT JOIN `een_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = XX) WHERE v.`id_feature` = XX ORDER BY vl.`value` ASC
4 queries
SELECT fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, XX) = sa.id_product_attribute AND sa.id_shop = XX  AND sa.id_shop_group = XX ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = XX AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=XX) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_XX ON (p.id_product = fp_XX.id_product) WHERE ((fp.id_feature_value IN (XX, XX, XX, XX))) AND ((fp_XX.id_feature_value IN (XX, XX))) AND ps.id_shop='XX' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='XX' AND c.nleft>=XX AND c.nright<=XX GROUP BY p.id_product) p INNER JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_XX ON (p.id_product = fp_XX.id_product) LEFT JOIN een_feature_product fp_XX ON (p.id_product = fp_XX.id_product) WHERE ((fp.id_feature=XX)) AND ((fp_XX.id_feature_value IN (XX, XX, XX, XX))) AND ((fp_XX.id_feature_value IN (XX, XX))) GROUP BY fp.id_feature_value
3 queries
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_last_product_not_ordered` (`id_tag` int(XX) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(XX), UNIQUE KEY `last_product_ordered` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utfXX;
3 queries
				SELECT tr.*
				FROM `een_tax_rule` tr
				JOIN `een_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
				WHERE trg.`active` = XX
				AND tr.`id_country` = XX
				AND tr.`id_tax_rules_group` = XX
				AND tr.`id_state` IN (XX, XX)
				AND ('XX' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
					OR (tr.`zipcode_to` = XX AND tr.`zipcode_from` IN(XX, 'XX')))
				ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
2 queries
                SELECT m.`id_module`, m.`name`, ms.`id_module`as `mshop`
                FROM `een_module` m
                LEFT JOIN `een_module_shop` ms
                ON m.`id_module` = ms.`id_module`
                AND ms.`id_shop` = XX
2 queries
SELECT `id_lang` FROM `een_lang`
                    WHERE `locale` = 'fr-fr'
                    OR `language_code` = 'fr-fr' LIMIT XX
2 queries
		SELECT `id_category`
		FROM `een_category_shop`
		WHERE `id_category` = XX
		AND `id_shop` = XX LIMIT XX
2 queries
BEGIN
2 queries
SHOW TABLES LIKE "een_gmcp_XX"
2 queries
CREATE TABLE IF NOT EXISTS `een_gmcp_reporting` (`id_reporting` int(XX) NOT NULL AUTO_INCREMENT,`iso_feed` LONGTEXT NOT NULL,    `reporting_content` LONGTEXT NOT NULL,`id_shop` int(XX) NOT NULL,`date_add` datetime NOT NULL,`date_upd` datetime NOT NULL,PRIMARY KEY (`id_reporting`)) ENGINE=' . _MYSQL_ENGINE_ . ' DEFAULT CHARSET=utfXX;
2 queries
CREATE TABLE IF NOT EXISTS `een_gmcp_feeds` (`id_feed` int(XX) NOT NULL AUTO_INCREMENT,`iso_lang` LONGTEXT NOT NULL,`iso_country` LONGTEXT NOT NULL,`iso_currency` LONGTEXT NOT NULL, `taxonomy` LONGTEXT NOT NULL, `id_shop` int(XX) NOT NULL,`date_add` datetime NOT NULL,`date_upd` datetime NOT NULL,PRIMARY KEY (`id_feed`)) ENGINE=' . _MYSQL_ENGINE_ . ' DEFAULT CHARSET=utfXX;
2 queries
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_price_range` (`id_tag` int(XX) NOT NULL, `price_min` CHAR(XX) NOT NULL, `price_max` CHAR(XX), `id_product` CHAR(XX), UNIQUE KEY `tag_price_range` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utfXX;
2 queries
CREATE TABLE IF NOT EXISTS `een_gmcp_tmp_rules`(`id` int(XX) NOT NULL AUTO_INCREMENT, `id_shop` int(XX) NOT NULL DEFAULT "XX",`type` char(XX) NOT NULL, `exclusion_values` longtext NOT NULL, PRIMARY KEY (`id`)) ENGINE=InnoDB DEFAULT CHARSET=utfXX AUTO_INCREMENT=XX;
2 queries
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_last_product_ordered` (`id_tag` int(XX) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(XX), UNIQUE KEY `last_product_ordered` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utfXX;
2 queries
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_promotion` (`id_tag` int(XX) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(XX), UNIQUE KEY `promotion` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utfXX;
2 queries
CREATE TABLE IF NOT EXISTS `een_gmcp_discount_association` (`id_association` int(XX) NOT NULL AUTO_INCREMENT, `id_discount` int(XX) NOT NULL, `id_product` int(XX) NOT NULL, `channel` CHAR(XX) NOT NULL DEFAULT "SHOPPING_ADS", PRIMARY KEY (`id_association`) ) ENGINE=MyISAM DEFAULT CHARSET=utfXX;
2 queries
CREATE TABLE IF NOT EXISTS `een_gmcp_tags` (`id_tag` int(XX) NOT NULL AUTO_INCREMENT, `id_shop` int(XX) NOT NULL DEFAULT "XX", `name` char(XX) NOT NULL, `type` char(XX) NOT NULL, `active` TINYINT NOT NULL, `position` INT NOT NULL, `end_date` DATE, PRIMARY KEY (`id_tag`)) ENGINE=MyISAM DEFAULT CHARSET=utfXX AUTO_INCREMENT=XX ;
2 queries
COMMIT
2 queries
				SELECT `name`
				FROM `een_manufacturer`
				WHERE `id_manufacturer` = XX
				AND `active` = XX LIMIT XX
2 queries
SELECT XX FROM `een_cart_rule` WHERE ((date_to >= "XX-XX-XX XX:XX:XX" AND date_to <= "XX-XX-XX XX:XX:XX") OR (date_from >= "XX-XX-XX XX:XX:XX" AND date_from <= "XX-XX-XX XX:XX:XX") OR (date_from < "XX-XX-XX XX:XX:XX" AND date_to > "XX-XX-XX XX:XX:XX")) AND `id_customer` IN (XX,XX) LIMIT XX
2 queries
SELECT product_id as id_product, COUNT(product_id) AS sales
            FROM `een_order_detail`
            WHERE product_id IN (
                SELECT id_product
                FROM `een_category_product`
                LEFT JOIN een_product USING (id_product)
                WHERE id_category = XX
                AND active = XX
            )
            GROUP BY product_id
            ORDER BY sales DESC LIMIT XX

Tables stress

93 product
91 product_shop
83 feature_product
67 product_attribute
51 category_lang
51 cart_product
50 image
50 image_shop
50 product_attribute_shop
44 stock_available
42 product_attribute_combination
42 specific_price
34 module
30 module_shop
30 feature_value_lang
28 category
26 feature
26 feature_shop
26 feature_lang
26 product_lang
25 product_group_reduction_cache
25 pack
25 image_lang
25 attribute
25 attribute_lang
25 attribute_group
21 country
20 category_product
18 category_group
14 product_sale
13 country_lang
13 category_shop
12 currency
11 specific_price_priority
8 country_shop
7 hook
5 lang
5 feature_value
5 layered_indexable_feature_value_lang_value
4 shop_url
4 shop
4 lang_shop
4 currency_shop
4 gmcp_feeds
4 cart_rule
3 hook_alias
3 tax_rule
3 tax_rules_group
2 shop_group
2 configuration
2 hook_module
2 currency_lang
2 group
2 group_shop
2 image_type
2 orders
2 manufacturer
2 iqit_elementor_category
2 cart_rule_lang
2 order_detail
1 memcached_servers
1 configuration_lang
1 module_group
1 meta
1 meta_lang
1 hook_module_exceptions
1 group_lang
1 address_format
1 required_field
1 revslider_sliders
1 gmcp_discount_association
1 gmcp_tags
1 layered_category
1 layered_indexable_feature
1 layered_indexable_feature_lang_value
1 layered_filter_block
1 layered_price_index
1 feature_flag
1 order_cart_rule
1 iqit_elementor_category_shop
1 ganalytics_data

ObjectModel instances

Name Instances Source
Product 25 /src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 40036]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 14272]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 13137]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 12939]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6655]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 6363]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4498]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4495]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4442]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 4319]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 609473]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 603687]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 600667]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 596002]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 585532]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 573233]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 572166]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 567392]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 544260]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 542487]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 541355]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 571471]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 13135]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 13136]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 604308]
Country 15 /config/config.inc.php:148 (__construct) [id: 8]
/classes/controller/FrontController.php:946 (__construct) [id: 21]
/classes/AddressFormat.php:404 (__construct) [id: 17]
/classes/controller/FrontController.php:1779 (__construct) [id: 17]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 8]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 8]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 8]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 8]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 8]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 8]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 8]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 19]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 4]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 3]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 186]
Language 13 /config/config.inc.php:213 (__construct) [id: 1]
/classes/Tools.php:560 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
Category 13 /controllers/front/listing/CategoryController.php:78 (__construct) [id: 2]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 1000]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 5816]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 2756]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 5756]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 5757]
/classes/Meta.php:380 (__construct) [id: 2]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/modules/ps_facetedsearch/src/Product/Search.php:365 (__construct) [id: 2]
/modules/ps_facetedsearch/src/Filters/Block.php:157 (__construct) [id: 2]
/modules/facebookconversiontrackingplus/facebookconversiontrackingplus.php:3085 (__construct) [id: 2]
/classes/Link.php:402 (__construct) [id: 2]
/modules/facebookconversiontrackingplus/classes/ConversionApi.php:518 (__construct) [id: 2]
Currency 9 /src/Adapter/Currency/CurrencyDataProvider.php:101 (__construct) [id: 1]
/classes/Tools.php:690 (getCurrencyInstance) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:213 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:213 (__construct) [id: 0]
/modules/gmerchantcenterpro/lib/moduleTools.php:213 (__construct) [id: 0]
/modules/gmerchantcenterpro/lib/moduleTools.php:213 (__construct) [id: 0]
/modules/gmerchantcenterpro/lib/moduleTools.php:213 (__construct) [id: 0]
/modules/gmerchantcenterpro/lib/moduleTools.php:213 (__construct) [id: 0]
/modules/gmerchantcenterpro/lib/moduleTools.php:213 (__construct) [id: 0]
Address 4 /classes/shop/Shop.php:486 (__construct) [id: ]
/classes/Product.php:3694 (initialize) [id: ]
/classes/Product.php:3804 (__construct) [id: ]
/classes/Product.php:5964 (__construct) [id: ]
Cart 2 /classes/controller/FrontController.php:467 (__construct) [id: ]
/classes/controller/FrontController.php:541 (__construct) [id: ]
Shop 1 /config/config.inc.php:119 (initialize) [id: 1]
ShopGroup 1 /classes/shop/Shop.php:561 (__construct) [id: 1]
Customer 1 /config/config.inc.php:266 (__construct) [id: ]
Group 1 /classes/Cart.php:249 (getCurrent) [id: 1]
Gender 1 /classes/controller/FrontController.php:1702 (__construct) [id: 0]
Risk 1 /classes/controller/FrontController.php:1705 (__construct) [id: ]
AddressFormat 1 /classes/controller/FrontController.php:1773 (generateAddress) [id: ]
State 1 /classes/controller/FrontController.php:1778 (__construct) [id: 0]
IqitElementorCategory 1 /modules/iqitelementor/iqitelementor.php:784 (isJustElementor) [id: ]

Included Files

# Filename
0 /index.php
1 /config/config.inc.php
2 /config/defines.inc.php
3 /config/autoload.php
4 /vendor/autoload.php
5 /vendor/composer/autoload_real.php
6 /vendor/composer/platform_check.php
7 /vendor/composer/ClassLoader.php
8 /vendor/composer/include_paths.php
9 /vendor/composer/autoload_static.php
10 /vendor/symfony/polyfill-php72/bootstrap.php
11 /vendor/symfony/polyfill-mbstring/bootstrap.php
12 /vendor/symfony/polyfill-mbstring/bootstrap80.php
13 /vendor/symfony/polyfill-intl-normalizer/bootstrap.php
14 /vendor/symfony/polyfill-intl-normalizer/bootstrap80.php
15 /vendor/symfony/polyfill-intl-idn/bootstrap.php
16 /vendor/symfony/deprecation-contracts/function.php
17 /vendor/ralouphie/getallheaders/src/getallheaders.php
18 /vendor/symfony/polyfill-ctype/bootstrap.php
19 /vendor/symfony/polyfill-ctype/bootstrap80.php
20 /vendor/symfony/polyfill-php80/bootstrap.php
21 /vendor/guzzlehttp/promises/src/functions_include.php
22 /vendor/guzzlehttp/promises/src/functions.php
23 /vendor/guzzlehttp/guzzle/src/functions_include.php
24 /vendor/guzzlehttp/guzzle/src/functions.php
25 /vendor/symfony/polyfill-iconv/bootstrap.php
26 /vendor/ezyang/htmlpurifier/library/HTMLPurifier.composer.php
27 /vendor/jakeasmith/http_build_url/src/http_build_url.php
28 /vendor/lcobucci/jwt/compat/class-aliases.php
29 /vendor/lcobucci/jwt/src/Token.php
30 /vendor/lcobucci/jwt/src/Signature.php
31 /vendor/lcobucci/jwt/compat/json-exception-polyfill.php
32 /vendor/lcobucci/jwt/compat/lcobucci-clock-polyfill.php
33 /vendor/swiftmailer/swiftmailer/lib/swift_required.php
34 /vendor/swiftmailer/swiftmailer/lib/classes/Swift.php
35 /vendor/symfony/polyfill-intl-icu/bootstrap.php
36 /vendor/symfony/polyfill-php73/bootstrap.php
37 /vendor/symfony/polyfill-php81/bootstrap.php
38 /vendor/api-platform/core/src/deprecation.php
39 /vendor/api-platform/core/src/Api/FilterInterface.php
40 /vendor/api-platform/core/src/Api/ResourceClassResolverInterface.php
41 /vendor/api-platform/core/src/deprecated_interfaces.php
42 /vendor/api-platform/core/src/Metadata/Property/Factory/PropertyNameCollectionFactoryInterface.php
43 /vendor/api-platform/core/src/Metadata/Resource/Factory/ResourceNameCollectionFactoryInterface.php
44 /vendor/api-platform/core/src/Metadata/Extractor/ResourceExtractorInterface.php
45 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/DateFilterInterface.php
46 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/ExistsFilterInterface.php
47 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/OrderFilterInterface.php
48 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/RangeFilterInterface.php
49 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/SearchFilterInterface.php
50 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationCollectionExtensionInterface.php
51 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationItemExtensionInterface.php
52 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultCollectionExtensionInterface.php
53 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultItemExtensionInterface.php
54 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Filter/FilterInterface.php
55 /vendor/api-platform/core/src/Doctrine/Orm/QueryAwareInterface.php
56 /vendor/api-platform/core/src/Doctrine/Orm/Util/QueryNameGeneratorInterface.php
57 /vendor/api-platform/core/src/Elasticsearch/Metadata/Document/Factory/DocumentMetadataFactoryInterface.php
58 /vendor/api-platform/core/src/Symfony/Validator/ValidationGroupsGeneratorInterface.php
59 /vendor/api-platform/core/src/Symfony/Validator/Exception/ConstraintViolationListAwareExceptionInterface.php
60 /vendor/api-platform/core/src/Exception/ExceptionInterface.php
61 /vendor/api-platform/core/src/Core/Bridge/Symfony/Validator/Metadata/Property/Restriction/PropertySchemaRestrictionMetadataInterface.php
62 /vendor/api-platform/core/src/State/Pagination/PaginatorInterface.php
63 /vendor/api-platform/core/src/State/Pagination/PartialPaginatorInterface.php
64 /vendor/api-platform/core/src/Documentation/DocumentationInterface.php
65 /vendor/api-platform/core/src/JsonLd/AnonymousContextBuilderInterface.php
66 /vendor/api-platform/core/src/JsonLd/ContextBuilderInterface.php
67 /vendor/api-platform/core/src/Core/JsonSchema/SchemaFactoryInterface.php
68 /vendor/api-platform/core/src/JsonSchema/TypeFactoryInterface.php
69 /vendor/api-platform/core/src/OpenApi/Factory/OpenApiFactoryInterface.php
70 /vendor/api-platform/core/src/PathResolver/OperationPathResolverInterface.php
71 /vendor/api-platform/core/src/Symfony/Security/ResourceAccessCheckerInterface.php
72 /vendor/api-platform/core/src/Serializer/Filter/FilterInterface.php
73 /vendor/api-platform/core/src/Serializer/SerializerContextBuilderInterface.php
74 /vendor/api-platform/core/src/Validator/ValidatorInterface.php
75 /vendor/api-platform/core/src/Api/UrlGeneratorInterface.php
76 /vendor/api-platform/core/src/GraphQl/ExecutorInterface.php
77 /vendor/api-platform/core/src/GraphQl/Error/ErrorHandlerInterface.php
78 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ValidateStageInterface.php
79 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ReadStageInterface.php
80 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityPostDenormalizeStageInterface.php
81 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityStageInterface.php
82 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/WriteStageInterface.php
83 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SerializeStageInterface.php
84 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/DeserializeStageInterface.php
85 /vendor/api-platform/core/src/GraphQl/Resolver/QueryItemResolverInterface.php
86 /vendor/api-platform/core/src/GraphQl/Resolver/QueryCollectionResolverInterface.php
87 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Factory/ResolverFactoryInterface.php
88 /vendor/api-platform/core/src/GraphQl/Resolver/MutationResolverInterface.php
89 /vendor/api-platform/core/src/Core/GraphQl/Subscription/MercureSubscriptionIriGeneratorInterface.php
90 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionIdentifierGeneratorInterface.php
91 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionManagerInterface.php
92 /vendor/api-platform/core/src/Core/GraphQl/Serializer/SerializerContextBuilderInterface.php
93 /vendor/api-platform/core/src/GraphQl/Type/TypesFactoryInterface.php
94 /vendor/api-platform/core/src/GraphQl/Type/Definition/TypeInterface.php
95 /vendor/api-platform/core/src/GraphQl/Type/TypesContainerInterface.php
96 /vendor/psr/container/src/ContainerInterface.php
97 /vendor/api-platform/core/src/Operation/PathSegmentNameGeneratorInterface.php
98 /vendor/ircmaxell/password-compat/lib/password.php
99 /vendor/martinlindhe/php-mb-helpers/src/mb_helpers.php
100 /vendor/prestashop/laminas-code-lts/polyfill/ReflectionEnumPolyfill.php
101 /src/Core/Version.php
102 /config/alias.php
103 /vendor/prestashop/autoload/src/PrestashopAutoload.php
104 /vendor/prestashop/autoload/src/LegacyClassLoader.php
105 /vendor/symfony/symfony/src/Symfony/Component/Filesystem/Filesystem.php
106 /vendor/prestashop/autoload/src/Autoloader.php
107 /config/bootstrap.php
108 /src/Core/ContainerBuilder.php
109 /src/Core/Foundation/IoC/Container.php
110 /src/Adapter/ServiceLocator.php
111 /var/cache/prod/appParameters.php
114 /var/cache/prod/class_index.php
115 /classes/controller/Controller.php
117 /classes/ObjectModel.php
118 /src/Core/Foundation/Database/EntityInterface.php
120 /classes/db/Db.php
122 /classes/Hook.php
124 /classes/module/Module.php
125 /src/Core/Module/Legacy/ModuleInterface.php
127 /classes/Tools.php
128 /classes/Context.php
129 /classes/shop/Shop.php
130 /src/Core/Security/PasswordGenerator.php
131 /classes/db/DbPDO.php
132 /classes/AddressFormat.php
133 /classes/cache/Cache.php
134 /classes/cache/CacheMemcached.php
135 /config/db_slave_server.inc.php
136 /src/Core/Security/Hashing.php
137 /classes/Configuration.php
138 /classes/Validate.php
139 /src/Adapter/EntityMapper.php
140 /classes/db/DbQuery.php
141 /src/Core/Addon/Theme/ThemeManagerBuilder.php
142 /vendor/psr/log/Psr/Log/NullLogger.php
143 /vendor/psr/log/Psr/Log/AbstractLogger.php
144 /vendor/psr/log/Psr/Log/LoggerInterface.php
145 /src/Adapter/Configuration.php
146 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ParameterBag.php
147 /src/Core/Domain/Configuration/ShopConfigurationInterface.php
148 /src/Core/ConfigurationInterface.php
149 /src/Core/Addon/Theme/ThemeRepository.php
150 /src/Core/Addon/AddonRepositoryInterface.php
151 /src/Core/Domain/Shop/ValueObject/ShopConstraint.php
152 /src/Core/Addon/Theme/Theme.php
153 /src/Core/Addon/AddonInterface.php
154 /src/Core/Util/ArrayFinder.php
155 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccess.php
156 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorBuilder.php
157 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessor.php
158 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorInterface.php
159 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPath.php
160 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPathInterface.php
161 /config/defines_uri.inc.php
162 /classes/Language.php
163 /src/Core/Language/LanguageInterface.php
164 /classes/Country.php
165 /classes/PrestaShopCollection.php
166 /classes/shop/ShopGroup.php
167 /classes/Cookie.php
168 /classes/PhpEncryption.php
169 /classes/PhpEncryptionEngine.php
170 /vendor/defuse/php-encryption/src/Key.php
171 /vendor/defuse/php-encryption/src/Encoding.php
172 /vendor/defuse/php-encryption/src/Core.php
173 /vendor/defuse/php-encryption/src/Crypto.php
174 /vendor/defuse/php-encryption/src/KeyOrPassword.php
175 /vendor/defuse/php-encryption/src/RuntimeTests.php
176 /vendor/defuse/php-encryption/src/DerivedKeys.php
177 /vendor/defuse/php-encryption/src/Exception/WrongKeyOrModifiedCiphertextException.php
178 /vendor/defuse/php-encryption/src/Exception/CryptoException.php
179 /src/Core/Session/SessionHandler.php
180 /src/Core/Session/SessionHandlerInterface.php
181 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Session.php
182 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBag.php
183 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBagInterface.php
184 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagInterface.php
185 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBag.php
186 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBagInterface.php
187 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagProxy.php
188 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionInterface.php
189 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/PhpBridgeSessionStorage.php
190 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/NativeSessionStorage.php
191 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/MetadataBag.php
192 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/StrictSessionHandler.php
193 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/AbstractSessionHandler.php
194 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/SessionHandlerProxy.php
195 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/AbstractProxy.php
196 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/SessionStorageInterface.php
197 /config/smarty.config.inc.php
198 /vendor/smarty/smarty/libs/Smarty.class.php
199 /vendor/smarty/smarty/libs/functions.php
200 /vendor/smarty/smarty/libs/Autoloader.php
201 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_data.php
202 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_extension_handler.php
203 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php
204 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php
205 /vendor/smarty/smarty/libs/sysplugins/smarty_resource.php
206 /vendor/smarty/smarty/libs/sysplugins/smarty_variable.php
207 /vendor/smarty/smarty/libs/sysplugins/smarty_template_source.php
208 /vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php
209 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_resource_file.php
210 /config/smartyfront.config.inc.php
211 /classes/Smarty/SmartyResourceModule.php
212 /vendor/smarty/smarty/libs/sysplugins/smarty_resource_custom.php
213 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerresource.php
214 /classes/Smarty/SmartyResourceParent.php
215 /classes/Smarty/SmartyLazyRegister.php
216 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerplugin.php
217 /vendor/smarty/smarty/libs/plugins/modifier.truncate.php
218 /classes/Customer.php
219 /classes/Group.php
220 /override/classes/Link.php
221 /classes/Link.php
222 /classes/shop/ShopUrl.php
223 /override/classes/Dispatcher.php
224 /classes/Dispatcher.php
225 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Request.php
226 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeader.php
227 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeaderItem.php
228 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/FileBag.php
229 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderBag.php
230 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderUtils.php
231 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ServerBag.php
232 /src/Adapter/SymfonyContainer.php
233 /vendor/mobiledetect/mobiledetectlib/Mobile_Detect.php
234 /modules/ph_simpleblog/ph_simpleblog.php
235 /modules/ph_simpleblog/assets/phpthumb/ThumbLib.inc.php
236 /modules/ph_simpleblog/assets/phpthumb/PhpThumb.inc.php
237 /modules/ph_simpleblog/assets/phpthumb/ThumbBase.inc.php
238 /modules/ph_simpleblog/assets/phpthumb/GdThumb.inc.php
239 /modules/ph_simpleblog/vendor/autoload.php
240 /modules/ph_simpleblog/vendor/composer/autoload_real.php
241 /modules/ph_simpleblog/vendor/composer/platform_check.php
242 /modules/ph_simpleblog/vendor/composer/autoload_static.php
243 /modules/ph_simpleblog/models/SimpleBlogCategory.php
244 /modules/ph_simpleblog/models/SimpleBlogPost.php
245 /modules/ph_simpleblog/models/SimpleBlogPostType.php
246 /modules/ph_simpleblog/models/SimpleBlogPostImage.php
247 /modules/ph_simpleblog/models/SimpleBlogTag.php
248 /modules/ph_simpleblog/models/SimpleBlogComment.php
249 /modules/ph_simpleblog/models/SimpleBlogPostAuthor.php
250 /modules/ph_simpleblog/classes/SimpleBlogHelper.php
251 /modules/ph_simpleblog/classes/BlogPostsFinder.php
252 /modules/ph_simpleblog/controllers/front/default_list.php
253 /classes/controller/ModuleFrontController.php
254 /override/classes/controller/FrontController.php
255 /classes/controller/FrontController.php
256 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_createdata.php
257 /vendor/smarty/smarty/libs/sysplugins/smarty_data.php
258 /classes/Translate.php
259 /modules/ph_simpleblog/translations/fr.php
260 /src/PrestaShopBundle/Translation/TranslatorComponent.php
261 /vendor/symfony/symfony/src/Symfony/Component/Translation/Translator.php
262 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorInterface.php
263 /vendor/symfony/contracts/Translation/LocaleAwareInterface.php
264 /vendor/symfony/contracts/Translation/TranslatorInterface.php
265 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorBagInterface.php
266 /src/PrestaShopBundle/Translation/PrestaShopTranslatorTrait.php
267 /src/PrestaShopBundle/Translation/TranslatorLanguageTrait.php
268 /src/PrestaShopBundle/Translation/TranslatorInterface.php
269 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatter.php
270 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatter.php
271 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatterInterface.php
272 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatterInterface.php
273 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/ChoiceMessageFormatterInterface.php
274 /vendor/symfony/symfony/src/Symfony/Component/Translation/IdentityTranslator.php
275 /vendor/symfony/contracts/Translation/TranslatorTrait.php
276 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactory.php
277 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactoryInterface.php
278 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCache.php
279 /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerConfigCache.php
280 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheInterface.php
281 /var/cache/prod/translations/catalogue.fr-FR.NXhscRe.php
282 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogue.php
283 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogueInterface.php
284 /vendor/symfony/symfony/src/Symfony/Component/Translation/MetadataAwareInterface.php
285 /controllers/front/listing/CategoryController.php
286 /classes/controller/ProductListingFrontController.php
287 /classes/controller/ProductPresentingFrontController.php
288 /src/Adapter/Presenter/Object/ObjectPresenter.php
289 /src/Adapter/Presenter/PresenterInterface.php
290 /src/Adapter/Presenter/Cart/CartPresenter.php
291 /src/Adapter/Image/ImageRetriever.php
292 /classes/tax/TaxConfiguration.php
293 /classes/Smarty/TemplateFinder.php
294 /classes/assets/StylesheetManager.php
295 /classes/assets/AbstractAssetManager.php
296 /src/Adapter/Assets/AssetUrlGeneratorTrait.php
297 /classes/assets/JavascriptManager.php
298 /classes/assets/CccReducer.php
299 /modules/iqitthemeeditor/iqitthemeeditor.php
300 /modules/iqitthemeeditor/src/IqitSmartyModifiers.php
301 /modules/iqitthemeeditor/translations/fr.php
302 /classes/Category.php
303 /classes/webservice/WebserviceRequest.php
304 /src/Adapter/ContainerBuilder.php
305 /src/Adapter/Environment.php
306 /src/Core/EnvironmentInterface.php
307 /vendor/symfony/symfony/src/Symfony/Component/Cache/DoctrineProvider.php
308 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/CacheProvider.php
309 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Cache.php
310 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/FlushableCache.php
311 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/ClearableCache.php
312 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiOperationCache.php
313 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiGetCache.php
314 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiDeleteCache.php
315 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiPutCache.php
316 /vendor/symfony/symfony/src/Symfony/Component/Cache/PruneableInterface.php
317 /vendor/symfony/symfony/src/Symfony/Component/Cache/ResettableInterface.php
318 /vendor/symfony/contracts/Service/ResetInterface.php
319 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/ArrayAdapter.php
320 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ArrayTrait.php
321 /vendor/psr/log/Psr/Log/LoggerAwareTrait.php
322 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AdapterInterface.php
323 /vendor/symfony/symfony/src/Symfony/Component/Cache/CacheItem.php
324 /vendor/symfony/contracts/Cache/ItemInterface.php
325 /vendor/psr/cache/src/CacheItemInterface.php
326 /vendor/psr/cache/src/CacheItemPoolInterface.php
327 /vendor/symfony/contracts/Cache/CacheInterface.php
328 /vendor/psr/log/Psr/Log/LoggerAwareInterface.php
329 /vendor/doctrine/orm/lib/Doctrine/ORM/Tools/Setup.php
330 /vendor/doctrine/deprecations/lib/Doctrine/Deprecations/Deprecation.php
331 /vendor/doctrine/orm/lib/Doctrine/ORM/Configuration.php
332 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Configuration.php
333 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/CacheAdapter.php
334 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/DoctrineProvider.php
335 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationReader.php
336 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Reader.php
337 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationRegistry.php
338 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/DoctrineAnnotations.php
339 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Annotation.php
340 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Entity.php
341 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embeddable.php
342 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embedded.php
343 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/MappedSuperclass.php
344 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/InheritanceType.php
345 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorColumn.php
346 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorMap.php
347 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Id.php
348 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/GeneratedValue.php
349 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Version.php
350 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumn.php
351 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumns.php
352 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Column.php
353 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToOne.php
354 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToMany.php
355 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToOne.php
356 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToMany.php
357 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Table.php
358 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/UniqueConstraint.php
359 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Index.php
360 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinTable.php
361 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SequenceGenerator.php
362 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/CustomIdGenerator.php
363 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ChangeTrackingPolicy.php
364 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OrderBy.php
365 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQueries.php
366 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQuery.php
367 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/HasLifecycleCallbacks.php
368 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PrePersist.php
369 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostPersist.php
370 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreUpdate.php
371 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostUpdate.php
372 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreRemove.php
373 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostRemove.php
374 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostLoad.php
375 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreFlush.php
376 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/FieldResult.php
377 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ColumnResult.php
378 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityResult.php
379 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQuery.php
380 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQueries.php
381 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMapping.php
382 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMappings.php
383 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverride.php
384 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverrides.php
385 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverride.php
386 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverrides.php
387 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityListeners.php
388 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Cache.php
389 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/SimpleAnnotationReader.php
390 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocParser.php
391 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocLexer.php
392 /vendor/doctrine/lexer/lib/Doctrine/Common/Lexer/AbstractLexer.php
393 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Target.php
394 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/AnnotationDriver.php
395 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/CompatibilityAnnotationDriver.php
396 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/MappingDriver.php
397 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/ColocatedMappingDriver.php
398 /var/cache/prod/FrontContainer.php
399 /src/Adapter/Container/LegacyContainer.php
400 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Container.php
401 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/RewindableGenerator.php
402 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/ServiceLocator.php
403 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ServiceLocator.php
404 /vendor/symfony/contracts/Service/ServiceLocatorTrait.php
405 /vendor/psr/container/src/ContainerExceptionInterface.php
406 /vendor/psr/container/src/NotFoundExceptionInterface.php
407 /vendor/symfony/contracts/Service/ServiceProviderInterface.php
408 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ResettableContainerInterface.php
409 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ContainerInterface.php
410 /src/Adapter/Container/LegacyContainerInterface.php
411 /modules/ps_categorytree/vendor/autoload.php
412 /modules/ps_categorytree/vendor/composer/autoload_real.php
413 /modules/ps_categorytree/vendor/composer/platform_check.php
414 /modules/ps_categorytree/vendor/composer/autoload_static.php
415 /modules/ps_facetedsearch/vendor/autoload.php
416 /modules/ps_facetedsearch/vendor/composer/autoload_real.php
417 /modules/ps_facetedsearch/vendor/composer/platform_check.php
418 /modules/ps_facetedsearch/vendor/composer/autoload_static.php
419 /modules/contactform/vendor/autoload.php
420 /modules/contactform/vendor/composer/autoload_real.php
421 /modules/contactform/vendor/composer/platform_check.php
422 /modules/contactform/vendor/composer/autoload_static.php
423 /modules/ps_sharebuttons/vendor/autoload.php
424 /modules/ps_sharebuttons/vendor/composer/autoload_real.php
425 /modules/ps_sharebuttons/vendor/composer/platform_check.php
426 /modules/ps_sharebuttons/vendor/composer/autoload_static.php
427 /modules/gsitemap/vendor/autoload.php
428 /modules/gsitemap/vendor/composer/autoload_real.php
429 /modules/gsitemap/vendor/composer/platform_check.php
430 /modules/gsitemap/vendor/composer/autoload_static.php
431 /modules/ps_crossselling/vendor/autoload.php
432 /modules/ps_crossselling/vendor/composer/autoload_real.php
433 /modules/ps_crossselling/vendor/composer/platform_check.php
434 /modules/ps_crossselling/vendor/composer/autoload_static.php
435 /modules/ps_themecusto/vendor/autoload.php
436 /modules/ps_themecusto/vendor/composer/autoload_real.php
437 /modules/ps_themecusto/vendor/composer/platform_check.php
438 /modules/ps_themecusto/vendor/composer/autoload_static.php
439 /modules/ps_supplierlist/vendor/autoload.php
440 /modules/ps_supplierlist/vendor/composer/autoload_real.php
441 /modules/ps_supplierlist/vendor/composer/platform_check.php
442 /modules/ps_supplierlist/vendor/composer/autoload_static.php
443 /modules/ps_googleanalytics/vendor/autoload.php
444 /modules/ps_googleanalytics/vendor/composer/autoload_real.php
445 /modules/ps_googleanalytics/vendor/composer/platform_check.php
446 /modules/ps_googleanalytics/vendor/composer/autoload_static.php
447 /modules/statssearch/vendor/autoload.php
448 /modules/statssearch/vendor/composer/autoload_real.php
449 /modules/statssearch/vendor/composer/platform_check.php
450 /modules/statssearch/vendor/composer/autoload_static.php
451 /modules/ps_categoryproducts/vendor/autoload.php
452 /modules/ps_categoryproducts/vendor/composer/autoload_real.php
453 /modules/ps_categoryproducts/vendor/composer/platform_check.php
454 /modules/ps_categoryproducts/vendor/composer/autoload_static.php
455 /modules/ps_wirepayment/vendor/autoload.php
456 /modules/ps_wirepayment/vendor/composer/autoload_real.php
457 /modules/ps_wirepayment/vendor/composer/platform_check.php
458 /modules/ps_wirepayment/vendor/composer/autoload_static.php
459 /modules/statsregistrations/vendor/autoload.php
460 /modules/statsregistrations/vendor/composer/autoload_real.php
461 /modules/statsregistrations/vendor/composer/platform_check.php
462 /modules/statsregistrations/vendor/composer/autoload_static.php
463 /modules/ps_distributionapiclient/vendor/autoload.php
464 /modules/ps_distributionapiclient/vendor/composer/autoload_real.php
465 /modules/ps_distributionapiclient/vendor/composer/platform_check.php
466 /modules/ps_distributionapiclient/vendor/composer/autoload_static.php
467 /modules/ps_distributionapiclient/vendor/symfony/polyfill-intl-grapheme/bootstrap.php
468 /modules/ps_distributionapiclient/vendor/symfony/string/Resources/functions.php
469 /modules/ps_emailalerts/vendor/autoload.php
470 /modules/ps_emailalerts/vendor/composer/autoload_real.php
471 /modules/ps_emailalerts/vendor/composer/platform_check.php
472 /modules/ps_emailalerts/vendor/composer/autoload_static.php
473 /modules/ps_brandlist/vendor/autoload.php
474 /modules/ps_brandlist/vendor/composer/autoload_real.php
475 /modules/ps_brandlist/vendor/composer/platform_check.php
476 /modules/ps_brandlist/vendor/composer/autoload_static.php
477 /modules/ps_viewedproduct/vendor/autoload.php
478 /modules/ps_viewedproduct/vendor/composer/autoload_real.php
479 /modules/ps_viewedproduct/vendor/composer/platform_check.php
480 /modules/ps_viewedproduct/vendor/composer/autoload_static.php
481 /modules/iqitsociallogin/vendor/autoload.php
482 /modules/iqitsociallogin/vendor/composer/autoload_real.php
483 /modules/iqitsociallogin/vendor/composer/platform_check.php
484 /modules/iqitsociallogin/vendor/composer/autoload_static.php
485 /modules/gmerchantcenterpro/vendor/autoload.php
486 /modules/gmerchantcenterpro/vendor/composer/autoload_real.php
487 /modules/gmerchantcenterpro/vendor/composer/platform_check.php
488 /modules/gmerchantcenterpro/vendor/composer/autoload_static.php
489 /modules/wizardai/vendor/autoload.php
490 /modules/wizardai/vendor/composer/autoload_real.php
491 /modules/wizardai/vendor/composer/platform_check.php
492 /modules/wizardai/vendor/composer/autoload_static.php
493 /modules/wizardai/vendor/clue/stream-filter/src/functions_include.php
494 /modules/wizardai/vendor/clue/stream-filter/src/functions.php
495 /modules/wizardai/vendor/guzzlehttp/psr7/src/functions_include.php
496 /modules/wizardai/vendor/guzzlehttp/psr7/src/functions.php
497 /modules/wizardai/vendor/php-http/message/src/filters.php
498 /modules/wizardai/vendor/symfony/polyfill-apcu/bootstrap.php
499 /modules/stripe_official/vendor/autoload.php
500 /modules/stripe_official/vendor/composer/autoload_real.php
501 /modules/stripe_official/vendor/composer/platform_check.php
502 /modules/stripe_official/vendor/composer/autoload_static.php
503 /modules/vivawalletsmartcheckout/vendor/autoload.php
504 /modules/vivawalletsmartcheckout/vendor/composer/autoload_real.php
505 /modules/vivawalletsmartcheckout/vendor/composer/autoload_static.php
506 /modules/autoupgrade/vendor/autoload.php
507 /modules/autoupgrade/vendor/composer/autoload_real.php
508 /modules/autoupgrade/vendor/composer/autoload_static.php
509 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment.php
510 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Client.php
511 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer.php
512 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/QueueConsumer.php
513 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/File.php
514 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/ForkCurl.php
515 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/LibCurl.php
516 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/Socket.php
517 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Version.php
518 /modules/ps_faviconnotificationbo/vendor/autoload.php
519 /modules/ps_faviconnotificationbo/vendor/composer/autoload_real.php
520 /modules/ps_faviconnotificationbo/vendor/composer/platform_check.php
521 /modules/ps_faviconnotificationbo/vendor/composer/autoload_static.php
522 /src/Core/Localization/Locale/Repository.php
523 /src/Core/Localization/Locale/RepositoryInterface.php
524 /src/Core/Localization/CLDR/LocaleRepository.php
525 /src/Core/Localization/CLDR/LocaleDataSource.php
526 /src/Core/Localization/CLDR/DataLayer/LocaleCache.php
527 /src/Core/Data/Layer/AbstractDataLayer.php
528 /src/Core/Localization/CLDR/LocaleDataLayerInterface.php
529 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/FilesystemAdapter.php
530 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AbstractAdapter.php
531 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractAdapterTrait.php
532 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractTrait.php
533 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ContractsTrait.php
534 /vendor/symfony/contracts/Cache/CacheTrait.php
535 /vendor/psr/cache/src/InvalidArgumentException.php
536 /vendor/psr/cache/src/CacheException.php
537 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemTrait.php
538 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemCommonTrait.php
539 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/DefaultMarshaller.php
540 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/MarshallerInterface.php
541 /src/Core/Localization/CLDR/DataLayer/LocaleReference.php
542 /src/Core/Localization/CLDR/Reader.php
543 /src/Core/Localization/CLDR/ReaderInterface.php
544 /src/Core/Localization/Currency/Repository.php
545 /src/Core/Localization/Currency/RepositoryInterface.php
546 /src/Core/Localization/Currency/CurrencyDataSource.php
547 /src/Core/Localization/Currency/DataSourceInterface.php
548 /src/Core/Localization/Currency/DataLayer/CurrencyCache.php
549 /src/Core/Localization/Currency/CurrencyDataLayerInterface.php
550 /src/Core/Localization/Currency/DataLayer/CurrencyDatabase.php
551 /src/Adapter/Currency/CurrencyDataProvider.php
552 /src/Core/Currency/CurrencyDataProviderInterface.php
553 /src/Adapter/LegacyContext.php
554 /src/Adapter/Tools.php
555 /src/Core/Localization/Currency/DataLayer/CurrencyReference.php
556 /src/Core/Localization/Currency/DataLayer/CurrencyInstalled.php
557 /vendor/prestashop/decimal/src/Operation/Rounding.php
558 /src/Core/Localization/Locale.php
559 /src/Core/Localization/LocaleInterface.php
560 /src/Core/Localization/Specification/Price.php
561 /src/Core/Localization/Specification/Number.php
562 /src/Core/Localization/Specification/NumberInterface.php
563 /src/Core/Localization/Specification/Factory.php
564 /src/Core/Localization/CLDR/LocaleData.php
565 /src/Core/Localization/CLDR/NumberSymbolsData.php
566 /src/Core/Localization/CLDR/CurrencyData.php
567 /src/Core/Localization/CLDR/Locale.php
568 /src/Core/Localization/CLDR/LocaleInterface.php
569 /src/Core/Localization/Specification/NumberSymbolList.php
570 /classes/Currency.php
571 /src/Core/Localization/Currency/LocalizedCurrencyId.php
572 /src/Core/Localization/Currency/CurrencyData.php
573 /src/Core/Localization/Currency/CurrencyCollection.php
574 /src/Core/Localization/Currency.php
575 /src/Core/Localization/CurrencyInterface.php
576 /src/Core/Localization/Specification/NumberCollection.php
577 /src/Core/Localization/Number/Formatter.php
578 /classes/Cart.php
579 /src/Adapter/AddressFactory.php
580 /override/classes/CartRule.php
581 /classes/CartRule.php
582 /classes/Product.php
583 /src/Core/Domain/Product/ValueObject/RedirectType.php
584 /src/Core/Util/DateTime/DateTime.php
585 /src/Core/Domain/Product/Stock/ValueObject/OutOfStockType.php
586 /src/Core/Domain/Product/Pack/ValueObject/PackStockType.php
587 /src/Core/Domain/Product/ValueObject/ProductType.php
588 /src/Core/Domain/Product/ValueObject/Reference.php
589 /src/Core/Domain/Product/ValueObject/Ean13.php
590 /src/Core/Domain/Product/ValueObject/Isbn.php
591 /src/Core/Domain/Product/ValueObject/Upc.php
592 /src/Core/Domain/Product/ProductSettings.php
593 /src/Core/Domain/Shop/ValueObject/ShopId.php
594 /src/Core/Domain/Shop/ValueObject/ShopIdInterface.php
595 /modules/ps_emailalerts/ps_emailalerts.php
596 /modules/ps_emailalerts/MailAlert.php
597 /src/PrestaShopBundle/Translation/DomainNormalizer.php
598 /modules/facebookconversiontrackingplus/facebookconversiontrackingplus.php
599 /modules/facebookconversiontrackingplus/classes/autoload.php
600 /modules/facebookconversiontrackingplus/translations/fr.php
601 /modules/facebookconversiontrackingplus/classes/ConversionApi.php
602 /modules/facebookconversiontrackingplus/classes/PixelTools.php
603 /modules/facebookconversiontrackingplus/classes/IpGeolocation.php
604 /src/Core/Security/OpenSsl/OpenSSL.php
605 /src/Core/Security/OpenSsl/OpenSSLInterface.php
606 /modules/facebookconversiontrackingplus/classes/SmartForm.php
607 /override/classes/Media.php
608 /classes/Media.php
609 /src/Adapter/Presenter/Cart/CartLazyArray.php
610 /src/Adapter/Presenter/AbstractLazyArray.php
611 /src/Adapter/Product/PriceFormatter.php
612 /src/Core/Util/Inflector.php
613 /vendor/doctrine/inflector/lib/Doctrine/Inflector/InflectorFactory.php
614 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Language.php
615 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/InflectorFactory.php
616 /vendor/doctrine/inflector/lib/Doctrine/Inflector/GenericLanguageInflectorFactory.php
617 /vendor/doctrine/inflector/lib/Doctrine/Inflector/LanguageInflectorFactory.php
618 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Rules.php
619 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Ruleset.php
620 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformations.php
621 /vendor/doctrine/inflector/lib/Doctrine/Inflector/WordInflector.php
622 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Inflectible.php
623 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformation.php
624 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Pattern.php
625 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Patterns.php
626 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Uninflected.php
627 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitutions.php
628 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitution.php
629 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Word.php
630 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Inflector.php
631 /vendor/doctrine/inflector/lib/Doctrine/Inflector/CachedWordInflector.php
632 /vendor/doctrine/inflector/lib/Doctrine/Inflector/RulesetInflector.php
633 /classes/Gender.php
634 /classes/Risk.php
635 /classes/Meta.php
636 /modules/revsliderprestashop/revsliderprestashop.php
637 /modules/revsliderprestashop/rev-loader.php
638 /modules/revsliderprestashop/includes/revslider_db.class.php
639 /modules/revsliderprestashop/includes/data.class.php
640 /modules/revsliderprestashop/includes/functions.class.php
641 /modules/revsliderprestashop/includes/em-integration.class.php
642 /modules/revsliderprestashop/includes/cssparser.class.php
643 /modules/revsliderprestashop/includes/woocommerce.class.php
644 /modules/revsliderprestashop/includes/wpml.class.php
645 /modules/revsliderprestashop/includes/colorpicker.class.php
646 /modules/revsliderprestashop/includes/navigation.class.php
647 /modules/revsliderprestashop/includes/object-library.class.php
648 /modules/revsliderprestashop/admin/includes/loadbalancer.class.php
649 /modules/revsliderprestashop/admin/includes/plugin-update.class.php
650 /modules/revsliderprestashop/includes/extension.class.php
651 /modules/revsliderprestashop/includes/favorite.class.php
652 /modules/revsliderprestashop/includes/aq-resizer.class.php
653 /modules/revsliderprestashop/includes/external-sources.class.php
654 /modules/revsliderprestashop/includes/page-template.class.php
655 /modules/revsliderprestashop/includes/slider.class.php
656 /modules/revsliderprestashop/includes/slide.class.php
657 /modules/revsliderprestashop/includes/output.class.php
658 /modules/revsliderprestashop/public/revslider-front.class.php
659 /modules/revsliderprestashop/includes/backwards.php
660 /modules/revsliderprestashop/admin/includes/class-pclzip.php
661 /modules/revsliderprestashop/admin/includes/license.class.php
662 /modules/revsliderprestashop/admin/includes/addons.class.php
663 /modules/revsliderprestashop/admin/includes/template.class.php
664 /modules/revsliderprestashop/admin/includes/functions-admin.class.php
665 /modules/revsliderprestashop/admin/includes/folder.class.php
666 /modules/revsliderprestashop/admin/includes/import.class.php
667 /modules/revsliderprestashop/admin/includes/export.class.php
668 /modules/revsliderprestashop/admin/includes/export-html.class.php
669 /modules/revsliderprestashop/admin/includes/newsletter.class.php
670 /modules/revsliderprestashop/admin/revslider-admin.class.php
671 /modules/revsliderprestashop/includes/update.class.php
672 /modules/revsliderprestashop/includes/resize-imag.php
673 /modules/revsliderprestashop/translations/fr.php
674 /classes/Address.php
675 /classes/ImageType.php
676 /classes/State.php
677 /src/Core/Security/PasswordPolicyConfiguration.php
678 /src/Core/Configuration/DataConfigurationInterface.php
679 /src/Core/Filter/FrontEndObject/MainFilter.php
680 /src/Core/Filter/FilterInterface.php
681 /src/Core/Filter/FrontEndObject/CartFilter.php
682 /src/Core/Filter/HashMapWhitelistFilter.php
683 /src/Core/Filter/CollectionFilter.php
684 /src/Core/Filter/FrontEndObject/ProductFilter.php
685 /src/Core/Filter/FrontEndObject/EmbeddedAttributesFilter.php
686 /src/Core/Filter/FrontEndObject/CustomerFilter.php
687 /src/Core/Filter/FrontEndObject/ShopFilter.php
688 /src/Core/Filter/FrontEndObject/ConfigurationFilter.php
689 /modules/ps_shoppingcart/ps_shoppingcart.php
690 /src/Core/Module/WidgetInterface.php
691 /modules/ps_googleanalytics/ps_googleanalytics.php
692 /modules/ps_googleanalytics/classes/Hook/HookDisplayHeader.php
693 /modules/ps_googleanalytics/classes/Hook/HookInterface.php
694 /vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php
695 /var/cache/prod/smarty/compile/warehouse/ee/78/8a/ee788a7ffa4b95e0a488ef6dc4b9f3c8b40ce111_2.file.ps_googleanalytics.tpl.php
696 /vendor/smarty/smarty/libs/plugins/modifier.escape.php
697 /modules/iqitcompare/iqitcompare.php
698 /modules/iqitcompare/translations/fr.php
699 /modules/iqitcontactpage/iqitcontactpage.php
700 /modules/iqitcontactpage/translations/fr.php
701 /modules/iqitcookielaw/iqitcookielaw.php
702 /modules/iqitcookielaw/translations/fr.php
703 /modules/iqitcountdown/iqitcountdown.php
704 /modules/iqitcountdown/translations/fr.php
705 /modules/iqitelementor/iqitelementor.php
706 /modules/iqitelementor/src/IqitElementorLanding.php
707 /modules/iqitelementor/src/IqitElementorTemplate.php
708 /modules/iqitelementor/src/IqitElementorProduct.php
709 /modules/iqitelementor/src/IqitElementorCategory.php
710 /modules/iqitelementor/src/IqitElementorContent.php
711 /modules/iqitelementor/src/iqitElementorWpHelper.php
712 /modules/iqitelementor/includes/plugin-elementor.php
713 /modules/iqitelementor/src/widgets/IqitElementorWidget_Brands.php
714 /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsList.php
715 /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsListTabs.php
716 /modules/iqitelementor/src/widgets/IqitElementorWidget_Modules.php
717 /modules/iqitelementor/src/widgets/IqitElementorWidget_CustomTpl.php
718 /modules/iqitelementor/src/widgets/IqitElementorWidget_Menu.php
719 /modules/iqitelementor/src/widgets/IqitElementorWidget_RevolutionSlider.php
720 /modules/iqitelementor/src/widgets/IqitElementorWidget_Newsletter.php
721 /modules/iqitelementor/src/widgets/IqitElementorWidget_Blog.php
722 /modules/iqitelementor/src/widgets/IqitElementorWidget_Search.php
723 /modules/iqitelementor/src/widgets/IqitElementorWidget_Links.php
724 /modules/iqitelementor/src/widgets/IqitElementorWidget_ContactForm.php
725 /modules/iqitelementor/translations/fr.php
726 /modules/iqitfreedeliverycount/iqitfreedeliverycount.php
727 /modules/iqitfreedeliverycount/translations/fr.php
728 /modules/iqitmegamenu/iqitmegamenu.php
729 /modules/iqitmegamenu/models/IqitMenuTab.php
730 /modules/iqitmegamenu/models/IqitMenuHtml.php
731 /modules/iqitmegamenu/models/IqitMenuLinks.php
732 /modules/iqitmegamenu/translations/fr.php
733 /modules/iqitsizecharts/iqitsizecharts.php
734 /modules/iqitsizecharts/src/IqitSizeCharts.php
735 /modules/iqitsizecharts/translations/fr.php
736 /modules/iqitwishlist/iqitwishlist.php
737 /modules/iqitwishlist/src/IqitWishlistProduct.php
738 /modules/iqitwishlist/translations/fr.php
739 /modules/iqitextendedproduct/iqitextendedproduct.php
740 /modules/iqitextendedproduct/src/IqitThreeSixty.php
741 /modules/iqitextendedproduct/src/IqitProductVideo.php
742 /modules/iqitextendedproduct/translations/fr.php
743 /classes/assets/PrestashopAssetsLibraries.php
744 /modules/iqitsociallogin/iqitsociallogin.php
745 /modules/iqitsociallogin/translations/fr.php
746 /modules/gmerchantcenterpro/gmerchantcenterpro.php
747 /modules/gmerchantcenterpro/translations/fr.php
748 /modules/gmerchantcenterpro/lib/moduleTools.php
749 /modules/gmerchantcenterpro/conf/moduleConfiguration.php
750 /modules/gmerchantcenterpro/lib/moduleUpdate.php
751 /modules/gmerchantcenterpro/lib/install/installController.php
752 /modules/gmerchantcenterpro/lib/install/installSql.php
753 /modules/gmerchantcenterpro/lib/install/installInterface.php
754 /modules/gmerchantcenterpro/models/Feeds.php
755 /modules/gmerchantcenterpro/lib/hook/hookController.php
756 /modules/gmerchantcenterpro/lib/hook/hookDisplay.php
757 /modules/gmerchantcenterpro/lib/hook/hookBase.php
758 /modules/gmerchantcenterpro/lib/dao/moduleDao.php
759 /var/cache/prod/smarty/compile/warehouse/f7/5f/75/f75f75b788ebecd0995da205f357ac74693f8076_2.file.header.tpl.php
760 /modules/stripe_official/stripe_official.php
761 /classes/PaymentModule.php
762 /modules/stripe_official/vendor/stripe/stripe-php/lib/Event.php
763 /modules/stripe_official/vendor/stripe/stripe-php/lib/ApiResource.php
764 /modules/stripe_official/vendor/stripe/stripe-php/lib/StripeObject.php
765 /modules/stripe_official/vendor/stripe/stripe-php/lib/ApiOperations/Request.php
766 /modules/stripe_official/classes/services/PrestashopTranslationService.php
767 /src/Adapter/Localization/LegacyTranslator.php
768 /modules/stripe_official/smarty/plugins/modifier.stripelreplace.php
769 /modules/stripe_official/vendor/stripe/stripe-php/lib/Stripe.php
770 /modules/stripe_official/vendor/stripe/stripe-php/lib/Util/ApiVersion.php
771 /modules/wizardai/vendor/prestashop/module-lib-service-container/src/DependencyInjection/ServiceContainer.php
772 /modules/stripe_official/classes/services/StripeDisplayHeaderService.php
773 /modules/abandonedcart/abandonedcart.php
774 /modules/abandonedcart/classes/abandonedcart_core.php
775 /modules/abandonedcart/translations/fr.php
776 /var/cache/prod/smarty/compile/warehouse/7f/09/a0/7f09a045a9b3f592faaac1a3835665419330db11_2.file.abandonedcart_front.tpl.php
777 /modules/vivawalletsmartcheckout/vivawalletsmartcheckout.php
778 /modules/vivawalletsmartcheckout/src/Helpers/Config.php
779 /modules/vivawalletsmartcheckout/config/app.php
780 /modules/vivawalletsmartcheckout/src/Helpers/General.php
781 /modules/vivawalletsmartcheckout/translations/fr.php
782 /modules/vivawalletsmartcheckout/vendor/vivawallet/vivawallet-php/lib/Application.php
783 /src/Core/Product/Search/ProductSearchContext.php
784 /src/Core/Product/Search/ProductSearchQuery.php
785 /src/Core/Product/Search/SortOrder.php
786 /modules/ps_facetedsearch/ps_facetedsearch.php
787 /modules/ps_facetedsearch/src/HookDispatcher.php
788 /modules/ps_facetedsearch/src/Hook/Attribute.php
789 /modules/ps_facetedsearch/src/Hook/AbstractHook.php
790 /modules/ps_facetedsearch/src/Hook/AttributeGroup.php
791 /modules/ps_facetedsearch/src/Hook/Category.php
792 /modules/ps_facetedsearch/src/Hook/Configuration.php
793 /modules/ps_facetedsearch/src/Hook/Design.php
794 /modules/ps_facetedsearch/src/Hook/Feature.php
795 /modules/ps_facetedsearch/src/Form/Feature/FormModifier.php
796 /modules/ps_facetedsearch/src/Form/Feature/FormDataProvider.php
797 /modules/ps_facetedsearch/src/Hook/FeatureValue.php
798 /modules/ps_facetedsearch/src/Form/FeatureValue/FormModifier.php
799 /modules/ps_facetedsearch/src/Form/FeatureValue/FormDataProvider.php
800 /modules/ps_facetedsearch/src/Hook/Product.php
801 /modules/ps_facetedsearch/src/Hook/ProductSearch.php
802 /modules/ps_facetedsearch/src/Hook/SpecificPrice.php
803 /modules/ps_facetedsearch/src/Filters/Provider.php
804 /modules/ps_facetedsearch/src/URLSerializer.php
805 /modules/ps_facetedsearch/src/Filters/DataAccessor.php
806 /modules/ps_facetedsearch/src/Product/SearchProvider.php
807 /src/Core/Product/Search/FacetsRendererInterface.php
808 /src/Core/Product/Search/ProductSearchProviderInterface.php
809 /modules/ps_facetedsearch/src/Filters/Converter.php
810 /modules/ps_facetedsearch/src/Product/SearchFactory.php
811 /src/Core/Product/Search/ProductSearchResult.php
812 /modules/ps_facetedsearch/src/Product/Search.php
813 /modules/ps_facetedsearch/src/Adapter/MySQL.php
814 /modules/ps_facetedsearch/src/Adapter/AbstractAdapter.php
815 /modules/ps_facetedsearch/src/Adapter/InterfaceAdapter.php
816 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ArrayCollection.php
817 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Collection.php
818 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ReadableCollection.php
819 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Selectable.php
820 /modules/ps_facetedsearch/src/Filters/Products.php
821 /classes/stock/StockAvailable.php
822 /modules/ps_facetedsearch/src/Filters/Block.php
823 /modules/ps_facetedsearch/src/Definition/Availability.php
824 /src/Core/Product/Search/Facet.php
825 /src/Core/Product/Search/Filter.php
826 /vendor/prestashop/decimal/src/DecimalNumber.php
827 /vendor/prestashop/decimal/src/Builder.php
828 /src/Core/Product/Search/FacetCollection.php
829 /classes/ProductAssembler.php
830 /classes/Combination.php
831 /classes/tax/Tax.php
832 /classes/Manufacturer.php
833 /classes/SpecificPrice.php
834 /classes/tax/TaxManagerFactory.php
835 /classes/tax/TaxRulesTaxManager.php
836 /classes/tax/TaxManagerInterface.php
837 /classes/tax/TaxCalculator.php
838 /classes/GroupReduction.php
839 /src/Core/Localization/CLDR/ComputingPrecision.php
840 /src/Core/Localization/CLDR/ComputingPrecisionInterface.php
841 /classes/Pack.php
842 /override/classes/order/Order.php
843 /classes/order/Order.php
844 /classes/Feature.php
845 /classes/ProductPresenterFactory.php
846 /src/Adapter/Presenter/Product/ProductListingPresenter.php
847 /src/Adapter/Presenter/Product/ProductPresenter.php
848 /src/Adapter/Product/ProductColorsRetriever.php
849 /src/Adapter/HookManager.php
850 /src/Core/Product/ProductPresentationSettings.php
851 /src/Adapter/Presenter/Product/ProductListingLazyArray.php
852 /src/Adapter/Presenter/Product/ProductLazyArray.php
853 /classes/Image.php
854 /src/Core/Image/ImageFormatConfiguration.php
855 /src/Core/Image/ImageFormatConfigurationInterface.php
856 /classes/FeatureFlag.php
857 /src/Core/FeatureFlag/FeatureFlagSettings.php
858 /vendor/prestashop/decimal/src/Operation/Multiplication.php
859 /vendor/prestashop/decimal/src/Operation/Addition.php
860 /var/cache/prod/smarty/compile/warehouse/d4/1d/65/d41d65d76b9471b5d365fe06cf1737c89a53af9f_2.module.ps_facetedsearchviewstemplatesfrontcatalogfacets.tpl.php
861 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_block.php
862 /vendor/smarty/smarty/libs/plugins/modifier.count.php
863 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php
864 /var/cache/prod/smarty/compile/warehouse/fb/ea/98/fbea98a84e509d7477392fb3e2519b1e908ae1d0_2.module.ps_facetedsearchviewstemplatesfrontcatalogfacetsdropdown.tpl.php
865 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_foreach.php
866 /var/cache/prod/smarty/compile/warehouse/2e/80/73/2e807335546cfa2360c36327ac89dd2fcb054379_2.module.ps_facetedsearchviewstemplatesfrontcatalogactivefilters.tpl.php
867 /src/Core/Product/Search/Pagination.php
868 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/a7/2d/dc/a72ddcc3457e523238167bfb787364e010571602_2.file.category.tpl.php
869 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_capture.php
870 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/90/cf/46/90cf4679dc49439c314d4747bbab91e7cd883211_2.file.product-list.tpl.php
871 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/20/1d/59/201d594b12ddb0579e97d2d00a38f32349d7f8e2_2.file.layout-full-width.tpl.php
872 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/9f/c0/0d/9fc00de9dab18af4bad561c5978e37a5cf7ba8dc_2.file.layout-both-columns.tpl.php
873 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/cb/45/38/cb4538e80db186323bd2c849a93c3a874eb9fa44_2.file.helpers.tpl.php
874 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_tplfunction.php
875 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/a3/5d/99/a35d9996c0259409d557b9de6f17182667bd08c0_2.file.head.tpl.php
876 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/d8/66/63/d8666378896e3199131756b2a049789ce82f9145_2.file.head-jsonld.tpl.php
877 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/8e/7c/ff/8e7cff5cfb78f6670e25ee2a2964eb6ccbe1b9d5_2.file.product-list-jsonld.tpl.php
878 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/b5/08/e2/b508e285f88ade9f85c8711af34aa86844c85366_2.file.pagination-seo.tpl.php
879 /vendor/smarty/smarty/libs/plugins/modifier.replace.php
880 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/52/ed/5b/52ed5bf4088d07f918e31ad1872568dff1a15122_2.file.stylesheets.tpl.php
881 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/2a/77/40/2a7740ed942475bcc06c5e40d5346b6b574f1441_2.file.javascript.tpl.php
882 /classes/ProductDownload.php
883 /src/Core/Cart/Calculator.php
884 /src/Core/Cart/CartRowCollection.php
885 /src/Core/Cart/Fees.php
886 /src/Core/Cart/AmountImmutable.php
887 /src/Core/Cart/CartRuleCollection.php
888 /src/Core/Cart/CartRuleCalculator.php
889 /src/Adapter/Product/PriceCalculator.php
890 /src/Core/Cart/CartRow.php
891 /vendor/symfony/symfony/src/Symfony/Component/Translation/PluralizationRules.php
892 /src/Core/Util/String/StringModifier.php
893 /src/Core/Util/String/StringModifierInterface.php
894 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/05/ac/4e/05ac4e59da39afc94ba29fd4c5bed100b6b3da19_2.file.product-activation.tpl.php
895 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/05/4d/41/054d41abc5a541ea4fd30d63caa94ec106d2993b_2.file.header.tpl.php
896 /modules/iqitlinksmanager/iqitlinksmanager.php
897 /modules/iqitlinksmanager/src/IqitLinkBlockRepository.php
898 /modules/iqitlinksmanager/src/IqitLinkBlock.php
899 /modules/iqitlinksmanager/src/IqitLinkBlockPresenter.php
900 /modules/iqitlinksmanager/translations/fr.php
901 /vendor/smarty/smarty/libs/sysplugins/smarty_template_cached.php
902 /vendor/smarty/smarty/libs/sysplugins/smarty_cacheresource.php
903 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_cacheresource_file.php
904 /var/cache/prod/smarty/cache/iqitlinksmanager/1/1/1/21/displayNav1/warehouse/a9/f2/c1/a9f2c1869604c8c628073c46891a26fcf1453e27.iqitlinksmanagerviewstemplateshookiqitlinksmanager.tpl.php
905 /modules/ps_languageselector/ps_languageselector.php
906 /modules/ps_currencyselector/ps_currencyselector.php
907 /var/cache/prod/smarty/compile/warehouse/73/27/77/73277702161b17505d668b28b8368941cf42c568_2.module.iqitwishlistviewstemplateshookdisplaynav.tpl.php
908 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/03/c2/a5/03c2a55aa51a9b7d61e7f129a111606f12475287_2.file.header-3.tpl.php
909 /modules/iqitsearch/iqitsearch.php
910 /modules/iqitsearch/translations/fr.php
911 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_gettemplatevars.php
912 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/d9/9b/94/d99b947421dcff226f28b1d6cb674c91f17399db_2.module.iqitsearchviewstemplateshookiqitsearchbtn.tpl.php
913 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/46/29/db/4629dbb3c4efa13c090c633dc2e46e5f2b42bed3_2.module.iqitsearchviewstemplateshooksearchbar.tpl.php
914 /modules/ps_customersignin/ps_customersignin.php
915 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/72/be/19/72be192e406191c1cad554abe284e159adeb4234_2.module.ps_customersigninps_customersigninbtn.tpl.php
916 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/b4/a4/76/b4a476e0a8201677b298f7c0f8ca1ac698e1bac3_2.module.ps_shoppingcartps_shoppingcartbtn.tpl.php
917 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/35/65/5e/35655e6409b6198f29dd6e732ef9598dec599880_2.module.ps_shoppingcartps_shoppingcart.tpl.php
918 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/f6/e9/f2/f6e9f2b1680a466582d2199d038efe2cfa3a83f7_2.module.ps_shoppingcartps_shoppingcartcontent.tpl.php
919 /var/cache/prod/smarty/cache/iqitmegamenu/index/1/1/1/21/warehouse/70/ca/47/70ca47640f8f16a0dd1dc3b1fce177bbeed38257.iqitmegamenuviewstemplateshookhorizontal.tpl.php
920 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/ce/2d/19/ce2d19cd13f5f27943d104183b745be20e3618a6_2.file.mobile-header-1.tpl.php
921 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/7a/30/38/7a3038780284d52e9fcd7a66e51e5b86a166106b_2.module.iqitsearchviewstemplateshooksearchbarmobile.tpl.php
922 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/be/ee/e6/beeee6f3d87613010f8af1cabc4c4562f8cf600a_2.module.ps_customersigninps_customersigninmobile.tpl.php
923 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/d4/e1/57/d4e1571b6b210795247564db06deb17061778b51_2.module.ps_shoppingcartps_shoppingcartmqty.tpl.php
924 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/28/b8/a6/28b8a6fb36f22bef1e0b5c53910267c19ceae859_2.file.breadcrumb.tpl.php
925 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/f1/e6/1e/f1e61e7ca59d67ddb45735d3ba11885aabdcd7c1_2.file.notifications.tpl.php
926 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/1d/15/44/1d154420732e4f5ec7164570156b8e82b8e743cc_2.file.category-header.tpl.php
927 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/08/3f/fe/083ffef0b3aeb82a59679210de0513024cfa645a_2.file.category-subcategories.tpl.php
928 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/8f/2c/f2/8f2cf264e8ef24eff54cdc3881bd1071ff6abcc5_2.file.products-top.tpl.php
929 /vendor/smarty/smarty/libs/plugins/modifier.regex_replace.php
930 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/ca/43/26/ca432646d2c581a6631dbab0f8a0ded19562cc5d_2.file.sort-orders.tpl.php
931 /var/cache/prod/smarty/compile/warehouse/81/a1/04/81a1040ed0eeab6f58198f9907167c7fced628c5_2.module.ps_facetedsearchps_facetedsearch.tpl.php
932 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/52/57/07/52570740bcdee3193f952d35d0d11ce53ff537f4_2.file.products.tpl.php
933 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/45/91/09/4591095b1d399add495fc541674f2fceb9d0f0e3_2.file.product.tpl.php
934 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/cb/91/6c/cb916c508b6fcc743788f1d7f95631e94668cb9d_2.file.product-miniature-1.tpl.php
935 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/31/03/a9/3103a9a485af7d714612ac0c47dbcfbc05c4fd95_2.file.product-miniature-thumb.tpl.php
936 /var/cache/prod/smarty/compile/warehouse/e9/21/d5/e921d51c062189725606e51308456f33ad945843_2.module.iqitwishlistviewstemplateshookproductminiature.tpl.php
937 /var/cache/prod/smarty/compile/warehouse/90/53/a0/9053a0dd520a39bef75969a0e9efeeae750df91b_2.module.iqitcompareviewstemplateshookproductminiature.tpl.php
938 /var/cache/prod/smarty/compile/warehouse/55/c7/a8/55c7a89f423f7f64b1b84881dcb668e4d788f013_2.module.iqitcountdownviewstemplateshookproduct.tpl.php
939 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/6c/98/2d/6c982d5090ff11db9654f1a7f6945865bc19603f_2.file.product-miniature-btn.tpl.php
940 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/8f/7a/83/8f7a832567456fbcc9b33e35ba7ca0da997b29d7_2.file.pagination.tpl.php
941 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/b1/d3/1b/b1d31b2d2e40bf3996d3350fd9793c705dd5bee6_2.file.products-bottom.tpl.php
942 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/e8/79/87/e87987b9e84bb947f6c535f03253877e87b62912_2.file.category-footer.tpl.php
943 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/99/9e/63/999e637a129f69005ecaa1ec5a360060ed703447_2.file.footer.tpl.php
944 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/7b/ea/10/7bea10cca96ef6b28b8f036ef026a7c11e3bde56_2.file.footer-1.tpl.php
945 /var/cache/prod/smarty/cache/iqitlinksmanager/1/1/1/21/displayFooter/warehouse/a9/f2/c1/a9f2c1869604c8c628073c46891a26fcf1453e27.iqitlinksmanagerviewstemplateshookiqitlinksmanager.tpl.php
946 /var/cache/prod/smarty/compile/warehouse/47/ac/57/47ac57039d904771d1de42366e1791900bdd2c2f_2.file.pixelheader.tpl.php
947 /vendor/smarty/smarty/libs/plugins/shared.mb_str_replace.php
948 /var/cache/prod/smarty/compile/warehouse/d5/a3/51/d5a351153329745771ab994e1aac2c50a2871ed1_2.file.pages_viewed.tpl.php
949 /var/cache/prod/smarty/compile/warehouse/e8/03/5a/e8035a8d1c12c085b510041163fece5592f47256_2.file.addtocart17.tpl.php
950 /var/cache/prod/smarty/compile/warehouse/77/34/89/773489e70d2bbbc33a3532f583f69463b9e8d34b_2.file.wishlist-iqitwishlist.tpl.php
951 /var/cache/prod/smarty/compile/warehouse/d8/97/09/d897090b6df2dbd807e718e356ae88dacdc94b72_2.file.category.tpl.php
952 /var/cache/prod/smarty/compile/warehouse/0b/1e/ae/0b1eae8b95d210de6545ab4d36ef1e0da4a2995c_2.file.newsletter.tpl.php
953 /var/cache/prod/smarty/compile/warehouse/bb/a9/2e/bba92e35e07193f35df4d88c25fef9c1ee267db4_2.file.page_time_event.tpl.php
954 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/2f/e6/59/2fe659ce5c8a3b849eecceed2fd2484c04ba6f2b_2.file.social-links.tpl.php
955 /modules/ps_emailsubscription/ps_emailsubscription.php
956 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/ca/11/75/ca1175f42cce659c415ef88a938d72e6064791dd_2.file.footer-copyrights-1.tpl.php
957 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/b2/b4/18/b2b418437d59a5c40ab3bf79b4a0534fdfc59e9d_2.file.password-policy-template.tpl.php
958 /classes/form/CustomerLoginForm.php
959 /classes/form/AbstractForm.php
960 /classes/form/FormInterface.php
961 /src/Core/Foundation/Templating/RenderableInterface.php
962 /classes/form/CustomerLoginFormatter.php
963 /classes/form/FormFormatterInterface.php
964 /classes/ValidateConstraintTranslator.php
965 /src/Core/Util/InternationalizedDomainNameConverter.php
966 /src/Core/Foundation/Templating/RenderableProxy.php
967 /var/cache/prod/smarty/compile/warehouse/52/f1/b8/52f1b8b385d74962f57df5c0ac1b0e91d62e4760_2.module.iqitwishlistviewstemplateshookdisplaymodal.tpl.php
968 /classes/form/FormField.php
969 /var/cache/prod/smarty/compile/warehouse/30/f5/ac/30f5acd1c8eb485e903c518c39df62f6dab88d7e_2.file.login-form.tpl.php
970 /var/cache/prod/smarty/compile/warehouse/21/f2/27/21f227e16d661dac3c649c0ff89b74dcf6812c75_2.file.form-errors.tpl.php
971 /var/cache/prod/smarty/compile/08/dc/b1/08dcb1adde6be40af6fcc0544d63eb4badcd22a6_2.file.form-fields.tpl.php
972 /var/cache/prod/smarty/compile/21/f2/27/21f227e16d661dac3c649c0ff89b74dcf6812c75_2.file.form-errors.tpl.php
973 /var/cache/prod/smarty/cache/iqitsociallogin/1/1/1/21/warehouse/7b/d5/c3/7bd5c305fe941e7514c4da4c50a911312eb62349.iqitsocialloginviewstemplateshookauthentication.tpl.php
974 /var/cache/prod/smarty/compile/warehouse/d4/a2/00/d4a200912ea9e133f46cf39b7eadc37ea7dd3d2f_2.module.iqitcompareviewstemplateshookdisplaymodal.tpl.php
975 /var/cache/prod/smarty/cache/iqitcookielaw/1/1/1/21/warehouse/6c/9a/c7/6c9ac7fc236180074d341c4bb3247222ad3545d0.iqitcookielawviewstemplateshookiqitcookielaw.tpl.php
976 /modules/ps_googleanalytics/classes/Hook/HookDisplayBeforeBodyClosingTag.php
977 /modules/ps_googleanalytics/classes/Handler/GanalyticsJsHandler.php
978 /modules/ps_googleanalytics/classes/Handler/GanalyticsDataHandler.php
979 /modules/ps_googleanalytics/classes/Repository/GanalyticsDataRepository.php
980 /modules/ps_googleanalytics/classes/Wrapper/ProductWrapper.php
981 /modules/ps_googleanalytics/classes/GoogleAnalyticsTools.php
982 /var/cache/prod/smarty/compile/warehouse/5c/93/46/5c93465cfee83ad9edb76aeff8896d92c35ee986_2.file.ga_tag.tpl.php