Meubles

Meubles de bureau

Bibliothèque

Tables

Rangement

Chaise, Tabouret

Meubles TV

Bancs

Canapé, fauteuil, méridienne et pouf
decozzia.com decozzia.com 2
  • -25%
Expédié sous 9 à 12 jours ouvrés
Chaises avec accoudoirs

Chaise avec accoudoirs gris pierre en microfibre – chaise design vintage pieds métal

L09-38310
147,17 € 196,23 €
Apportez une touche raffinée à votre intérieur avec cette chaise salle à manger avec accoudoirs en microfibre gris pierre. Son style vintage chic et son piétement en métal offrent une parfaite alliance entre élégance et robustesse. Cette chaise confortable avec accoudoirs est idéale pour créer un espace repas moderne et accueillant.
Product added to wishlist
Product added to compare.

Ce site utilise des cookies provenant de Google afin de fournir ses services et d'analyser le trafic. Les informations relatives à votre utilisation du site sont partagées avec Google. En cliquant sur "Accepter", vous acceptez l'utilisation des cookies.

Load Time 435.010 ms
Querying Time 185 ms
Queries 608
Memory Peak Usage 22.6 Mb
Included Files 992 files - 13.24 Mb
PrestaShop Cache - Mb
Global vars 0.61 Mb
PrestaShop Version 8.2.0
PHP Version 8.1.34
MySQL Version 11.4.10-MariaDB
Memory Limit 4048M
Max Execution Time 600s
Smarty Cache enabled
Smarty Compilation auto
  Time Cumulated Time Memory Usage Memory Peak Usage
config 0.591 ms 0.591 ms 3.77 Mb 4.2 Mb
__construct 0.005 ms 0.596 ms - Mb 4.2 Mb
init 5.150 ms 5.746 ms 1.02 Mb 5.0 Mb
checkAccess 0.001 ms 5.747 ms - Mb 5.0 Mb
setMedia 0.881 ms 6.628 ms 0.31 Mb 5.1 Mb
postProcess 0.001 ms 6.629 ms - Mb 5.1 Mb
initHeader 0.002 ms 6.631 ms - Mb 5.1 Mb
initContent 197.399 ms 204.030 ms 10.43 Mb 15.6 Mb
initFooter 0.001 ms 204.031 ms - Mb 15.6 Mb
display 230.979 ms 435.010 ms 6.27 Mb 22.6 Mb
Hook Time Memory Usage
DisplayFooter 203.163 ms 1.04 Mb
displayProductListFunctionalButtons 4.237 ms 0.05 Mb
displayBeforeBodyClosingTag 2.118 ms 0.63 Mb
displayCountDown 1.635 ms 0.09 Mb
DisplayHeader 1.231 ms 0.14 Mb
DisplayBeforeBodyClosingTag 0.901 ms 0.11 Mb
displayNav2 0.569 ms 0.18 Mb
displayNav1 0.393 ms 0.09 Mb
displayFooter 0.335 ms 0.09 Mb
displayMainMenu 0.332 ms 0.17 Mb
displayCategoryElementor 0.312 ms 0.08 Mb
displayCustomerLoginFormAfter 0.289 ms 0.07 Mb
renderWidget 0.261 ms 0.14 Mb
displayAfterBreadcrumb 0.138 ms 0.04 Mb
IsJustElementor 0.101 ms 0.02 Mb
ProductSearchProvider 0.100 ms - Mb
ActionFrontControllerSetMedia 0.054 ms 0.01 Mb
DisplayProductPriceBlock 0.046 ms 0.05 Mb
OverrideLayoutTemplate 0.013 ms - Mb
DisplayTop 0.008 ms - Mb
ModuleRoutes 0.004 ms - Mb
ActionProductSearchAfter 0.003 ms - Mb
ActionDispatcher 0.002 ms - Mb
Header 0.001 ms - Mb
24 hook(s) 216.244 ms 3.01 Mb
Module Time Memory Usage
ph_simpleblog 0.932 ms 0.25 Mb
iqitthemeeditor 0.262 ms 0.15 Mb
ps_emailalerts 0.065 ms 0.10 Mb
facebookconversiontrackingplus 203.655 ms 1.14 Mb
revolutpayment 0.313 ms 0.19 Mb
revsliderprestashop 0.374 ms 0.09 Mb
ps_shoppingcart 0.049 ms 0.03 Mb
ps_googleanalytics 1.092 ms 0.22 Mb
iqitcompare 2.140 ms 0.11 Mb
iqitcontactpage 0.039 ms 0.02 Mb
iqitcookielaw 0.292 ms 0.07 Mb
iqitcountdown 1.709 ms 0.08 Mb
iqitelementor 0.579 ms 0.17 Mb
iqitfreedeliverycount 0.041 ms 0.02 Mb
iqitmegamenu 0.430 ms 0.30 Mb
iqitsizecharts 0.059 ms 0.04 Mb
iqitwishlist 4.503 ms 0.68 Mb
iqitextendedproduct 0.072 ms 0.05 Mb
iqitsociallogin 0.341 ms 0.16 Mb
gmerchantcenterpro 6.221 ms 1.19 Mb
stripe_official 0.260 ms 0.05 Mb
abandonedcart 0.231 ms 0.08 Mb
vivawalletsmartcheckout 0.132 ms - Mb
ps_facetedsearch 0.489 ms 0.18 Mb
iqitlinksmanager 0.617 ms 0.17 Mb
ps_languageselector 0.163 ms 0.13 Mb
ps_currencyselector 0.137 ms 0.06 Mb
iqitsearch 0.064 ms 0.01 Mb
ps_customersignin 0.027 ms 0.02 Mb
iqitproductsnav 0.194 ms 0.06 Mb
ps_emailsubscription 0.296 ms 0.08 Mb
31 module(s) 225.776 ms 5.87 Mb

Stopwatch SQL - 608 queries

# Query Time (ms) Rows Filesort Group By Location
174 
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (33206, 750009, 751249, 33203, 33210, 33204, 751244, 33209))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=3 AND c.nright<=346 GROUP BY p.id_product) p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((sa.out_of_stock=1) OR (sa.quantity>0)) AND ((fp_1.id_feature_value IN (33206, 750009, 751249, 33203, 33210, 33204, 751244, 33209)))
 14.079 ms 37454400 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
172 
SELECT SQL_NO_CACHE cp.id_category, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (33206, 750009, 751249, 33203, 33210, 33204, 751244, 33209))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=3 AND c.nright<=346 GROUP BY p.id_product) p INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (33206, 750009, 751249, 33203, 33210, 33204, 751244, 33209))) AND cg.id_group='1' AND c.level_depth<=3 AND c.nleft>3 AND c.nright<346 GROUP BY cp.id_category
 13.074 ms 18727200 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
175 
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (33206, 750009, 751249, 33203, 33210, 33204, 751244, 33209))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=3 AND c.nright<=346 GROUP BY p.id_product) p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((sa.quantity>0)) AND ((fp_1.id_feature_value IN (33206, 750009, 751249, 33203, 33210, 33204, 751244, 33209)))
 13.043 ms 37454400 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
162 
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (33206, 750009, 751249, 33203, 33210, 33204, 751244, 33209))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=3 AND c.nright<=346 GROUP BY p.id_product) p INNER JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=10)) AND ((fp_1.id_feature_value IN (33206, 750009, 751249, 33203, 33210, 33204, 751244, 33209))) GROUP BY fp.id_feature_value
 12.660 ms 18727200 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
164 
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (33206, 750009, 751249, 33203, 33210, 33204, 751244, 33209))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=3 AND c.nright<=346 GROUP BY p.id_product) p INNER JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=13)) AND ((fp_1.id_feature_value IN (33206, 750009, 751249, 33203, 33210, 33204, 751244, 33209))) GROUP BY fp.id_feature_value
 12.517 ms 18727200 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
173 
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (33206, 750009, 751249, 33203, 33210, 33204, 751244, 33209))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=3 AND c.nright<=346 GROUP BY p.id_product) p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_stock_available sa_1 ON (p.id_product = sa_1.id_product AND IFNULL(pac.id_product_attribute, 0) = sa_1.id_product_attribute AND sa_1.id_shop = 1  AND sa_1.id_shop_group = 0 ) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((sa.quantity<=0 AND sa_1.out_of_stock IN (0, 2))) AND ((fp_1.id_feature_value IN (33206, 750009, 751249, 33203, 33210, 33204, 751244, 33209)))
 12.287 ms 37454400 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
156 
SELECT SQL_NO_CACHE p.id_product FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (33206, 750009, 751249, 33203, 33210, 33204, 751244, 33209))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=3 AND c.nright<=346 GROUP BY p.id_product) p INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) GROUP BY p.id_product ORDER BY p.position ASC, p.id_product DESC
 12.231 ms 9363600 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
158 
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (33206, 750009, 751249, 33203, 33210, 33204, 751244, 33209))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=3 AND c.nright<=346 GROUP BY p.id_product) p LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((p.on_sale=1)) AND ((fp_1.id_feature_value IN (33206, 750009, 751249, 33203, 33210, 33204, 751244, 33209)))
 12.094 ms 18727200 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
159 
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (33206, 750009, 751249, 33203, 33210, 33204, 751244, 33209))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=3 AND c.nright<=346 GROUP BY p.id_product) p LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (33206, 750009, 751249, 33203, 33210, 33204, 751244, 33209))) AND p.date_add>'2026-01-29 00:00:00'
 11.682 ms 18727200 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
167 
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=3 AND c.nright<=346 GROUP BY p.id_product) p INNER JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature=29)) GROUP BY fp.id_feature_value
 11.482 ms 4681800 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
160 
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (33206, 750009, 751249, 33203, 33210, 33204, 751244, 33209))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=3 AND c.nright<=346 GROUP BY p.id_product) p LEFT JOIN een_specific_price sp ON (
sp.id_product = p.id_product AND 
sp.id_shop IN (0, 1) AND 
sp.id_currency IN (0, 1) AND 
sp.id_country IN (0, 21) AND 
sp.id_group IN (0, 1) AND 
sp.from_quantity = 1 AND
sp.reduction > 0 AND
sp.id_customer = 0 AND
sp.id_cart = 0 AND 
(sp.from = '0000-00-00 00:00:00' OR '2026-04-28 18:47:18' >= sp.from) AND 
(sp.to = '0000-00-00 00:00:00' OR '2026-04-28 18:47:18' <= sp.to) 
) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((sp.reduction>0)) AND ((fp_1.id_feature_value IN (33206, 750009, 751249, 33203, 33210, 33204, 751244, 33209)))
 2.380 ms 4184 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
3 
SELECT SQL_NO_CACHE c.`name`, cl.`id_lang`, IF(cl.`id_lang` IS NULL, c.`value`, cl.`value`) AS value, c.id_shop_group, c.id_shop
FROM `een_configuration` c
LEFT JOIN `een_configuration_lang` cl ON (c.`id_configuration` = cl.`id_configuration`)
 1.518 ms 1696 /classes/Configuration.php:180
176 
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (33206, 750009, 751249, 33203, 33210, 33204, 751244, 33209))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=3 AND c.nright<=346 GROUP BY p.id_product) p INNER JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=17)) AND ((fp_1.id_feature_value IN (33206, 750009, 751249, 33203, 33210, 33204, 751244, 33209))) GROUP BY fp.id_feature_value
 1.489 ms 4536 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
165 
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (33206, 750009, 751249, 33203, 33210, 33204, 751244, 33209))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=3 AND c.nright<=346 GROUP BY p.id_product) p INNER JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=20)) AND ((fp_1.id_feature_value IN (33206, 750009, 751249, 33203, 33210, 33204, 751244, 33209))) GROUP BY fp.id_feature_value
 1.484 ms 2208 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
161 
SELECT SQL_NO_CACHE psi.price_min, MIN(price_min) as min, MAX(price_max) as max FROM een_product p INNER JOIN een_layered_price_index psi ON (psi.id_product = p.id_product AND psi.id_shop = 1 AND psi.id_currency = 1 AND psi.id_country = 21) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (33206, 750009, 751249, 33203, 33210, 33204, 751244, 33209))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=3 AND c.nright<=346
 1.301 ms 3060 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
169 
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (33206, 750009, 751249, 33203, 33210, 33204, 751244, 33209))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=3 AND c.nright<=346 GROUP BY p.id_product) p INNER JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=34)) AND ((fp_1.id_feature_value IN (33206, 750009, 751249, 33203, 33210, 33204, 751244, 33209))) GROUP BY fp.id_feature_value
 0.901 ms 224 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
589 
SELECT SQL_NO_CACHE id_category, id_parent, level_depth, name, is_root_category, active FROM een_category LEFT JOIN een_category_lang AS cl USING (id_category) LEFT JOIN een_category_shop AS cs USING (id_category) WHERE cs.id_shop = 1 AND cl.id_lang = 1 ORDER BY `een_category`.`id_parent` ASC, `een_category`.`id_category` ASC
 0.708 ms 330 Yes /modules/facebookconversiontrackingplus/facebookconversiontrackingplus.php:2945
14 
SELECT SQL_NO_CACHE h.`name` as hook, m.`id_module`, h.`id_hook`, m.`name` as module
FROM `een_module` m
INNER JOIN een_module_shop module_shop
ON (module_shop.id_module = m.id_module AND module_shop.id_shop = 1 AND module_shop.enable_device & 1)
INNER JOIN `een_hook_module` `hm` ON hm.`id_module` = m.`id_module`
INNER JOIN `een_hook` `h` ON hm.`id_hook` = h.`id_hook`
LEFT JOIN `een_module_group` `mg` ON mg.`id_module` = m.`id_module`
WHERE (h.`name` != "paymentOptions") AND (hm.`id_shop` = 1) AND (mg.id_shop = 1 AND  mg.`id_group` IN (1))
GROUP BY hm.id_hook, hm.id_module
ORDER BY hm.`position`
 0.620 ms 244 Yes Yes /classes/Hook.php:1267
192 
SELECT SQL_NO_CACHE `id_hook`, `name`
FROM `een_hook`
UNION
SELECT `id_hook`, ha.`alias` as name
FROM `een_hook_alias` ha
INNER JOIN `een_hook` h ON ha.name = h.name
 0.593 ms 0 /classes/Hook.php:1326
193 
SELECT SQL_NO_CACHE h.id_hook, h.name as h_name, title, description, h.position, hm.position as hm_position, m.id_module, m.name, m.active
FROM `een_hook_module` hm
STRAIGHT_JOIN `een_hook` h ON (h.id_hook = hm.id_hook AND hm.id_shop = 1)
STRAIGHT_JOIN `een_module` as m ON (m.id_module = hm.id_module)
ORDER BY hm.position
 0.548 ms 486 /classes/Hook.php:456
590 
SELECT SQL_NO_CACHE id_category, id_parent, level_depth, name, is_root_category, active FROM een_category LEFT JOIN een_category_lang AS cl USING (id_category) LEFT JOIN een_category_shop AS cs USING (id_category) WHERE cs.id_shop = 1 AND cl.id_lang = 1 ORDER BY `een_category`.`id_parent` ASC, `een_category`.`id_category` ASC
 0.537 ms 330 Yes /modules/facebookconversiontrackingplus/facebookconversiontrackingplus.php:2945
607 
SELECT SQL_NO_CACHE cp.`id_category`, cp.`id_product`, cl.`name` FROM `een_category_product` cp
LEFT JOIN `een_category` c ON (c.id_category = cp.id_category)
LEFT JOIN `een_category_lang` cl ON (cp.`id_category` = cl.`id_category` AND cl.id_shop = 1 )
INNER JOIN een_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
WHERE cp.`id_product` IN (647701,40049,40048,40046,40017,36979,36884,36882,36837,31035,31007,31006,31000,30954,30894,30840,30649,30637,30635,30633,25139,25116,25115,25114) AND cl.`id_lang` = 1
ORDER BY c.`level_depth` DESC
 0.418 ms 73 Yes /modules/ps_googleanalytics/classes/Wrapper/ProductWrapper.php:109
42 
SELECT SQL_NO_CACHE c.*, cl.`id_lang`, cl.`name`, cl.`description`, cl.`additional_description`, cl.`link_rewrite`, cl.`meta_title`, cl.`meta_keywords`, cl.`meta_description`
FROM `een_category` c
INNER JOIN een_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `een_category_lang` cl ON (c.`id_category` = cl.`id_category` AND `id_lang` = 1  AND cl.id_shop = 1 )
LEFT JOIN `een_category_group` cg ON (cg.`id_category` = c.`id_category`)
WHERE `id_parent` = 1000
AND `active` = 1
AND cg.`id_group` =1
GROUP BY c.`id_category`
ORDER BY `level_depth` ASC, category_shop.`position` ASC
 0.414 ms 12 Yes Yes /classes/Category.php:924
177 
REPLACE INTO een_layered_filter_block (hash, data) VALUES ("8c34c32232e7e8ed56a01d1c6aa8fbf4", "a:1:{s:7:\"filters\";a:8:{i:0;a:7:{s:9:\"type_lite\";s:6:\"extras\";s:4:\"type\";s:6:\"extras\";s:6:\"id_key\";i:0;s:4:\"name\";s:10:\"Selections\";s:6:\"values\";a:3:{s:4:\"sale\";a:2:{s:4:\"name\";s:8:\"En promo\";s:3:\"nbr\";i:0;}s:3:\"new\";a:2:{s:4:\"name\";s:15:\"Nouveau produit\";s:3:\"nbr\";i:0;}s:8:\"discount\";a:2:{s:4:\"name\";s:8:\"En promo\";s:3:\"nbr\";i:47;}}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";s:1:\"0\";}i:1;a:12:{s:9:\"type_lite\";s:5:\"price\";s:4:\"type\";s:5:\"price\";s:6:\"id_key\";i:0;s:4:\"name\";s:4:\"Prix\";s:3:\"max\";d:0;s:3:\"min\";d:0;s:4:\"unit\";s:3:\"€\";s:14:\"specifications\";a:11:{s:6:\"symbol\";a:11:{i:0;s:1:\",\";i:1;s:3:\" \";i:2;s:1:\";\";i:3;s:1:\"%\";i:4;s:1:\"-\";i:5;s:1:\"+\";i:6;s:1:\"E\";i:7;s:2:\"×\";i:8;s:3:\"‰\";i:9;s:3:\"∞\";i:10;s:3:\"NaN\";}s:12:\"currencyCode\";s:3:\"EUR\";s:14:\"currencySymbol\";s:3:\"€\";s:13:\"numberSymbols\";a:11:{i:0;s:1:\",\";i:1;s:3:\" \";i:2;s:1:\";\";i:3;s:1:\"%\";i:4;s:1:\"-\";i:5;s:1:\"+\";i:6;s:1:\"E\";i:7;s:2:\"×\";i:8;s:3:\"‰\";i:9;s:3:\"∞\";i:10;s:3:\"NaN\";}s:15:\"positivePattern\";s:12:\"#,##0.00 ¤\";s:15:\"negativePattern\";s:13:\"-#,##0.00 ¤\";s:17:\"maxFractionDigits\";i:2;s:17:\"minFractionDigits\";i:2;s:12:\"groupingUsed\";b:1;s:16:\"primaryGroupSize\";i:3;s:18:\"secondaryGroupSize\";i:3;}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:3;s:3:\"nbr\";i:278;s:5:\"value\";N;}i:2;a:9:{s:9:\"type_lite\";s:10:\"id_feature\";s:4:\"type\";s:10:\"id_feature\";s:6:\"id_key\";s:2:\"10\";s:6:\"values\";a:10:{i:151;a:4:{s:3:\"nbr\";s:2:\"33\";s:4:\"name\";s:11:\"Bois massif\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:146;a:4:{s:3:\"nbr\";s:2:\"42\";s:4:\"name\";s:17:\"Dérivés du bois\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:751276;a:4:{s:3:\"nbr\";s:1:\"1\";s:4:\"name\";s:10:\"Microfibre\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:150;a:4:{s:3:\"nbr\";s:2:\"25\";s:4:\"name\";s:6:\"Métal\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:81988;a:4:{s:3:\"nbr\";s:1:\"4\";s:4:\"name\";s:10:\"Pin massif\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:159601;a:4:{s:3:\"nbr\";s:2:\"30\";s:4:\"name\";s:6:\"Simili\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:143;a:4:{s:3:\"nbr\";s:2:\"18\";s:4:\"name\";s:5:\"Tissu\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:751272;a:4:{s:3:\"nbr\";s:1:\"1\";s:4:\"name\";s:18:\"Tissu bouclé gris\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:232660;a:4:{s:3:\"nbr\";s:2:\"34\";s:4:\"name\";s:7:\"Velours\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:148;a:4:{s:3:\"nbr\";s:2:\"19\";s:4:\"name\";s:5:\"Verre\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}}s:4:\"name\";s:8:\"Matière\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";s:1:\"0\";}i:3;a:9:{s:9:\"type_lite\";s:10:\"id_feature\";s:4:\"type\";s:10:\"id_feature\";s:6:\"id_key\";s:2:\"20\";s:6:\"values\";a:2:{i:526;a:4:{s:3:\"nbr\";s:1:\"4\";s:4:\"name\";s:13:\"Rectangulaire\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:55781;a:4:{s:3:\"nbr\";s:1:\"7\";s:4:\"name\";s:4:\"Rond\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}}s:4:\"name\";s:5:\"Forme\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";s:1:\"0\";}i:4;a:9:{s:9:\"type_lite\";s:10:\"id_feature\";s:4:\"type\";s:10:\"id_feature\";s:6:\"id_key\";s:2:\"29\";s:6:\"values\";a:30:{i:55029;a:4:{s:3:\"nbr\";s:1:\"3\";s:4:\"name\";s:11:\"Anthracite \";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:33207;a:4:{s:3:\"nbr\";s:1:\"4\";s:4:\"name\";s:5:\"Beige\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:33201;a:4:{s:3:\"nbr\";s:3:\"218\";s:4:\"name\";s:5:\"Blanc\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:751256;a:4:{s:3:\"nbr\";s:1:\"1\";s:4:\"name\";s:18:\"blanc effet marbre\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:33206;a:5:{s:3:\"nbr\";s:2:\"13\";s:4:\"name\";s:4:\"Bleu\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:7:\"checked\";b:1;}i:228923;a:4:{s:3:\"nbr\";s:1:\"5\";s:4:\"name\";s:4:\"Bois\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:751233;a:4:{s:3:\"nbr\";s:1:\"1\";s:4:\"name\";s:12:\"bois et noir\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:750009;a:5:{s:3:\"nbr\";s:1:\"1\";s:4:\"name\";s:4:\"Brun\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:7:\"checked\";b:1;}i:751249;a:5:{s:3:\"nbr\";s:1:\"1\";s:4:\"name\";s:4:\"Brun\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:7:\"checked\";b:1;}i:751234;a:4:{s:3:\"nbr\";s:1:\"1\";s:4:\"name\";s:12:\"Brun et Noir\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:751240;a:4:{s:3:\"nbr\";s:1:\"1\";s:4:\"name\";s:12:\"Brun et Noir\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:751226;a:4:{s:3:\"nbr\";s:2:\"19\";s:4:\"name\";s:13:\"Chêne marron\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:751253;a:4:{s:3:\"nbr\";s:1:\"1\";s:4:\"name\";s:14:\"Chêne naturel\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:751258;a:4:{s:3:\"nbr\";s:1:\"1\";s:4:\"name\";s:14:\"Chêne naturel\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:751268;a:4:{s:3:\"nbr\";s:1:\"1\";s:4:\"name\";s:14:\"chêne naturel\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:86888;a:4:{s:3:\"nbr\";s:2:\"48\";s:4:\"name\";s:13:\"Chêne sonoma\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:751231;a:4:{s:3:\"nbr\";s:1:\"1\";s:4:\"name\";s:42:\"Corps miel – Applications et pieds noirs\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:86884;a:4:{s:3:\"nbr\";s:2:\"10\";s:4:\"name\";s:6:\"Crème\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:33203;a:5:{s:3:\"nbr\";s:1:\"2\";s:4:\"name\";s:4:\"Gris\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:7:\"checked\";b:1;}i:33210;a:5:{s:3:\"nbr\";s:1:\"8\";s:4:\"name\";s:5:\"Jaune\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:7:\"checked\";b:1;}i:33202;a:4:{s:3:\"nbr\";s:1:\"2\";s:4:\"name\";s:6:\"Marron\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:751245;a:4:{s:3:\"nbr\";s:1:\"1\";s:4:\"name\";s:7:\"Naturel\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:33204;a:5:{s:3:\"nbr\";s:3:\"247\";s:4:\"name\";s:4:\"Noir\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:7:\"checked\";b:1;}i:751244;a:5:{s:3:\"nbr\";s:1:\"1\";s:4:\"name\";s:13:\"Noir brillant\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:7:\"checked\";b:1;}i:751266;a:4:{s:3:\"nbr\";s:1:\"1\";s:4:\"name\";s:53:\"Plateau : blanc effet marbre Structure : noyer foncé\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:33205;a:4:{s:3:\"nbr\";s:1:\"5\";s:4:\"name\";s:4:\"Rose\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:33209;a:5:{s:3:\"nbr\";s:1:\"7\";s:4:\"name\";s:5:\"Rouge\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:7:\"checked\";b:1;}i:750025;a:4:{s:3:\"nbr\";s:2:\"36\";s:4:\"name\";s:11:\"Sonoma gris\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:86883;a:4:{s:3:\"nbr\";s:1:\"9\";s:4:\"name\";s:6:\"Taupe \";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:33208;a:4:{s:3:\"nbr\";s:2:\"18\";s:4:\"name\";s:4:\"Vert\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}}s:4:\"name\";s:7:\"Couleur\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";s:1:\"0\";}i:5;a:9:{s:9:\"type_lite\";s:10:\"id_feature\";s:4:\"type\";s:10:\"id_feature\";s:6:\"id_key\";s:2:\"34\";s:6:\"values\";a:3:{i:240581;a:4:{s:3:\"nbr\";s:1:\"1\";s:4:\"name\";s:14:\"Chêne sauvage\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:240579;a:4:{s:3:\"nbr\";s:1:\"6\";s:4:\"name\";s:8:\"Manguier\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:240577;a:4:{s:3:\"nbr\";s:1:\"1\";s:4:\"name\";s:8:\"Sheesham\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}}s:4:\"name\";s:15:\"Essence de bois\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";s:1:\"0\";}i:6;a:7:{s:9:\"type_lite\";s:8:\"category\";s:4:\"type\";s:8:\"category\";s:6:\"id_key\";i:0;s:4:\"name\";s:11:\"Catégories\";s:6:\"values\";a:6:{i:411;a:2:{s:4:\"name\";s:5:\"Bancs\";s:3:\"nbr\";s:2:\"12\";}i:1027;a:2:{s:4:\"name\";s:10:\"Meubles TV\";s:3:\"nbr\";s:2:\"11\";}i:1030;a:2:{s:4:\"name\";s:17:\"Meubles de bureau\";s:3:\"nbr\";s:1:\"7\";}i:5723;a:2:{s:4:\"name\";s:16:\"Chaise, Tabouret\";s:3:\"nbr\";s:1:\"5\";}i:5728;a:2:{s:4:\"name\";s:9:\"Rangement\";s:3:\"nbr\";s:1:\"1\";}i:5735;a:2:{s:4:\"name\";s:6:\"Tables\";s:3:\"nbr\";s:1:\"5\";}}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";s:1:\"0\";}i:7;a:7:{s:9:\"type_lite\";s:12:\"availability\";s:4:\"type\";s:12:\"availability\";s:6:\"id_key\";i:0;s:4:\"name\";s:14:\"Disponibilité\";s:6:\"values\";a:2:{i:2;a:2:{s:4:\"name\";s:8:\"En stock\";s:3:\"nbr\";i:270;}i:0;a:2:{s:4:\"name\";s:14:\"Non disponible\";s:3:\"nbr\";i:8;}}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";s:1:\"0\";}}}")
 0.414 ms 1 /modules/ps_facetedsearch/src/Filters/Block.php:211
178 
SELECT SQL_NO_CACHE p.*,
ps.*,
pl.*,
sa.out_of_stock,
IFNULL(sa.quantity, 0) as quantity,
(DATEDIFF(
p.`date_add`,
DATE_SUB(
'2026-04-28 00:00:00',
INTERVAL 90 DAY
)
) > 0) as new
FROM een_product p
LEFT JOIN een_product_lang pl
ON pl.id_product = p.id_product
AND pl.id_shop = 1
AND pl.id_lang = 1
LEFT JOIN een_stock_available sa   ON sa.id_product = p.id_product
AND sa.id_product_attribute = 0
AND sa.id_shop = 1 LEFT JOIN een_product_shop ps
ON ps.id_product = p.id_product
AND ps.id_shop = 1
WHERE p.id_product IN (647701,40049,40048,40046,40017,36979,36884,36882,36837,31035,31007,31006,31000,30954,30894,30840,30649,30637,30635,30633,25139,25116,25115,25114)
 0.405 ms 24 /classes/ProductAssembler.php:95
113 
SELECT SQL_NO_CACHE *
FROM `een_gmcp_feeds` ff
WHERE (ff.id_shop=1)
ORDER BY ff.feed_is_default ASC
 0.402 ms 370 Yes /modules/gmerchantcenterpro/models/Feeds.php:62
171 
SELECT SQL_NO_CACHE c.`id_category`, cl.`name`
FROM `een_category` c
INNER JOIN een_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `een_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
ORDER BY c.nleft, c.position
 0.299 ms 330 Yes /classes/Category.php:724
13 
SELECT SQL_NO_CACHE lower(name) as name
FROM `een_hook` h
WHERE (h.active = 1)
 0.261 ms 1060 /classes/Hook.php:1366
239 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 40017) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.245 ms 2 Yes /classes/SpecificPrice.php:576
152 
SELECT SQL_NO_CACHE DISTINCT f.id_feature, f.*, fl.*, IF(liflv.`url_name` IS NULL OR liflv.`url_name` = "", NULL, liflv.`url_name`) AS url_name, IF(liflv.`meta_title` IS NULL OR liflv.`meta_title` = "", NULL, liflv.`meta_title`) AS meta_title, lif.indexable FROM `een_feature` f  INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1) LEFT JOIN `een_feature_lang` fl ON (f.`id_feature` = fl.`id_feature` AND fl.`id_lang` = 1) LEFT JOIN `een_layered_indexable_feature` lif ON (f.`id_feature` = lif.`id_feature`) LEFT JOIN `een_layered_indexable_feature_lang_value` liflv ON (f.`id_feature` = liflv.`id_feature` AND liflv.`id_lang` = 1) ORDER BY f.`position` ASC
 0.242 ms 29 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:171
153 
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `een_feature_value` v LEFT JOIN `een_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `een_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 29 ORDER BY vl.`value` ASC
 0.227 ms 40 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
555 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (36882) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.218 ms 1 Yes Yes /classes/Product.php:4524
108 
SHOW COLUMNS FROM een_gmcp_feeds LIKE "feed_is_default"
 0.216 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:128
206 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 40049) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.214 ms 2 Yes /classes/SpecificPrice.php:576
189 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 647701) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.213 ms 2 Yes /classes/SpecificPrice.php:576
293 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 31035) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.211 ms 2 Yes /classes/SpecificPrice.php:576
282 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 36837) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.208 ms 2 Yes /classes/SpecificPrice.php:576
163 
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `een_feature_value` v LEFT JOIN `een_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `een_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 10 ORDER BY vl.`value` ASC
 0.207 ms 37 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
304 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 31007) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.205 ms 2 Yes /classes/SpecificPrice.php:576
347 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 30894) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.205 ms 2 Yes /classes/SpecificPrice.php:576
314 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 31006) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.204 ms 2 Yes /classes/SpecificPrice.php:576
250 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 36979) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.201 ms 2 Yes /classes/SpecificPrice.php:576
217 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 40048) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.200 ms 2 Yes /classes/SpecificPrice.php:576
70 
SHOW TABLES LIKE "een_gmcp_1800"
 0.200 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:88
228 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 40046) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.200 ms 2 Yes /classes/SpecificPrice.php:576
556 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (36837) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.200 ms 1 Yes Yes /classes/Product.php:4524
109 
SHOW COLUMNS FROM een_gmcp_discount_association LIKE "channel"
 0.199 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:128
399 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 30633) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.199 ms 2 Yes /classes/SpecificPrice.php:576
168 
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `een_feature_value` v LEFT JOIN `een_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `een_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 29 ORDER BY vl.`value` ASC
 0.196 ms 40 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
110 
SHOW COLUMNS FROM een_gmcp_tags LIKE "custom_label_set_postion"
 0.195 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:128
261 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 36884) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.193 ms 2 Yes /classes/SpecificPrice.php:576
271 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` IN (0, 36882) AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.192 ms 2 Yes /classes/SpecificPrice.php:576
571 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (25114) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.190 ms 1 Yes Yes /classes/Product.php:4524
244 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 40017 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 40017 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.189 ms 0 /classes/Cart.php:1430
588 
SELECT SQL_NO_CACHE product_id as id_product, COUNT(product_id) AS sales
FROM `een_order_detail`
WHERE product_id IN (
SELECT id_product
FROM `een_category_product`
LEFT JOIN een_product USING (id_product)
WHERE id_category = 1000
AND active = 1
)
GROUP BY product_id
ORDER BY sales DESC LIMIT 5
 0.184 ms 37 Yes /modules/facebookconversiontrackingplus/facebookconversiontrackingplus.php:2918
435 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 25115 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 25115 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.181 ms 0 /classes/Cart.php:1430
430 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 0 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.178 ms 1 Yes /classes/SpecificPrice.php:576
426 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 25116
ORDER BY f.position ASC
 0.178 ms 3 Yes /classes/Product.php:6021
16 
SELECT SQL_NO_CACHE `id_hook`, `name` FROM `een_hook`
 0.177 ms 1060 /classes/Hook.php:1326
233 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 40046 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 40046 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.177 ms 0 /classes/Cart.php:1430
77 
SHOW TABLES LIKE "een_gmcp_1900"
 0.175 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:88
440 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 0 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.174 ms 1 Yes /classes/SpecificPrice.php:576
548 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (647701) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.172 ms 1 Yes Yes /classes/Product.php:4524
563 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (30840) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.167 ms 1 Yes Yes /classes/Product.php:4524
199 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 647701 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 647701 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.166 ms 0 /classes/Cart.php:1430
185 
SELECT SQL_NO_CACHE DISTINCT `id_product` FROM `een_specific_price` WHERE `id_product` != 0
 0.165 ms 523 /classes/SpecificPrice.php:310
557 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (31035) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.164 ms 1 Yes Yes /classes/Product.php:4524
558 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (31007) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.164 ms 1 Yes Yes /classes/Product.php:4524
549 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (40049) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.163 ms 1 Yes Yes /classes/Product.php:4524
550 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (40048) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.162 ms 1 Yes Yes /classes/Product.php:4524
551 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (40046) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.162 ms 1 Yes Yes /classes/Product.php:4524
234 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 40046
ORDER BY f.position ASC
 0.158 ms 2 Yes /classes/Product.php:6021
319 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 31006 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 31006 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.158 ms 0 /classes/Cart.php:1430
436 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 25115
ORDER BY f.position ASC
 0.158 ms 3 Yes /classes/Product.php:6021
553 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (36979) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.157 ms 1 Yes Yes /classes/Product.php:4524
200 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 647701
ORDER BY f.position ASC
 0.156 ms 3 Yes /classes/Product.php:6021
561 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (30954) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.155 ms 1 Yes Yes /classes/Product.php:4524
559 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (31006) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.154 ms 1 Yes Yes /classes/Product.php:4524
560 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (31000) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.153 ms 1 Yes Yes /classes/Product.php:4524
20 
SELECT SQL_NO_CACHE m.page, ml.url_rewrite, ml.id_lang
FROM `een_meta` m
LEFT JOIN `een_meta_lang` ml ON (m.id_meta = ml.id_meta AND ml.id_shop = 1 )
ORDER BY LENGTH(ml.url_rewrite) DESC
 0.153 ms 66 Yes /classes/Dispatcher.php:654
552 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (40017) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.152 ms 1 Yes Yes /classes/Product.php:4524
368 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 0 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.151 ms 1 Yes /classes/SpecificPrice.php:576
569 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (25116) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.150 ms 1 Yes Yes /classes/Product.php:4524
564 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (30649) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.149 ms 1 Yes Yes /classes/Product.php:4524
570 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (25115) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.149 ms 1 Yes Yes /classes/Product.php:4524
379 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 0 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.147 ms 1 Yes /classes/SpecificPrice.php:576
425 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 25116 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 25116 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.147 ms 0 /classes/Cart.php:1430
357 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 0 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.146 ms 1 Yes /classes/SpecificPrice.php:576
554 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (36884) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.146 ms 1 Yes Yes /classes/Product.php:4524
565 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (30637) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.145 ms 1 Yes Yes /classes/Product.php:4524
394 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 30635 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 30635 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.145 ms 0 /classes/Cart.php:1430
562 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (30894) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.145 ms 1 Yes Yes /classes/Product.php:4524
298 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 31035 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 31035 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.144 ms 0 /classes/Cart.php:1430
325 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 0 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.144 ms 1 Yes /classes/SpecificPrice.php:576
566 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (30635) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.144 ms 1 Yes Yes /classes/Product.php:4524
114 
SELECT SQL_NO_CACHE *
FROM `een_gmcp_feeds` ff
WHERE (ff.iso_lang="fr") AND (ff.id_shop=1)
ORDER BY ff.feed_is_default ASC
 0.143 ms 370 Yes /modules/gmerchantcenterpro/models/Feeds.php:72
309 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 31007 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 31007 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.143 ms 0 /classes/Cart.php:1430
568 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (25139) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.143 ms 1 Yes Yes /classes/Product.php:4524
599 
SELECT SQL_NO_CACHE product_id as id_product, COUNT(product_id) AS sales
FROM `een_order_detail`
WHERE product_id IN (
SELECT id_product
FROM `een_category_product`
LEFT JOIN een_product USING (id_product)
WHERE id_category = 1000
AND active = 1
)
GROUP BY product_id
ORDER BY sales DESC LIMIT 5
 0.143 ms 37 Yes /modules/facebookconversiontrackingplus/facebookconversiontrackingplus.php:2918
287 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 36837 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 36837 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.142 ms 0 /classes/Cart.php:1430
331 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 31000 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 31000 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.142 ms 0 /classes/Cart.php:1430
245 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 40017
ORDER BY f.position ASC
 0.142 ms 2 Yes /classes/Product.php:6021
567 
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (30633) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
 0.142 ms 1 Yes Yes /classes/Product.php:4524
255 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 36979 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 36979 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.141 ms 0 /classes/Cart.php:1430
337 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 0 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.141 ms 1 Yes /classes/SpecificPrice.php:576
410 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 0 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.140 ms 1 Yes /classes/SpecificPrice.php:576
445 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 25114 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 25114 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.140 ms 0 /classes/Cart.php:1430
384 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 30637 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 30637 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.139 ms 0 /classes/Cart.php:1430
18 
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `een_module` m
LEFT JOIN `een_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
 0.138 ms 104 /classes/module/Module.php:346
342 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 30954 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 30954 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.138 ms 0 /classes/Cart.php:1430
362 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 30840 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 30840 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.138 ms 0 /classes/Cart.php:1430
389 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 0 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.138 ms 1 Yes /classes/SpecificPrice.php:576
211 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 40049 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 40049 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.137 ms 0 /classes/Cart.php:1430
352 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 30894 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 30894 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.137 ms 0 /classes/Cart.php:1430
404 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 30633 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 30633 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.137 ms 0 /classes/Cart.php:1430
416 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 25139
ORDER BY f.position ASC
 0.137 ms 6 Yes /classes/Product.php:6021
2 
SELECT SQL_NO_CACHE gs.*, s.*, gs.name AS group_name, s.name AS shop_name, s.active, su.domain, su.domain_ssl, su.physical_uri, su.virtual_uri
FROM een_shop_group gs
LEFT JOIN een_shop s
ON s.id_shop_group = gs.id_shop_group
LEFT JOIN een_shop_url su
ON s.id_shop = su.id_shop AND su.main = 1
WHERE s.deleted = 0
AND gs.deleted = 0
ORDER BY gs.name, s.name
 0.136 ms 1 Yes /classes/shop/Shop.php:715
320 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 31006
ORDER BY f.position ASC
 0.136 ms 3 Yes /classes/Product.php:6021
420 
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 0 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
 0.136 ms 1 Yes /classes/SpecificPrice.php:576
373 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 30649 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 30649 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.135 ms 0 /classes/Cart.php:1430
415 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 25139 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 25139 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.135 ms 0 /classes/Cart.php:1430
166 
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `een_feature_value` v LEFT JOIN `een_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `een_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 20 ORDER BY vl.`value` ASC
 0.134 ms 9 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
266 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 36884 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 36884 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.134 ms 0 /classes/Cart.php:1430
310 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 31007
ORDER BY f.position ASC
 0.134 ms 3 Yes /classes/Product.php:6021
222 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 40048 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 40048 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.133 ms 0 /classes/Cart.php:1430
276 
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 36882 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 36882 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
 0.133 ms 0 /classes/Cart.php:1430
510 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 25116) AND (b.`id_shop` = 1) LIMIT 1
 0.133 ms 1 /src/Adapter/EntityMapper.php:71
523 
SELECT SQL_NO_CACHE * FROM `een_cart_rule` cr
LEFT JOIN `een_cart_rule_lang` crl 
ON (cr.`id_cart_rule` = crl.`id_cart_rule` AND crl.`id_lang` = 0) WHERE (cr.`id_customer` = 0) AND NOW() BETWEEN cr.date_from AND cr.date_to
AND cr.`active` = 1
AND cr.`quantity` > 0 AND highlight = 1 AND code NOT LIKE "BO_ORDER_%"
 0.133 ms 1 /classes/CartRule.php:423
395 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 30635
ORDER BY f.position ASC
 0.132 ms 1 Yes /classes/Product.php:6021
521 
SELECT SQL_NO_CACHE * FROM `een_cart_rule` cr
LEFT JOIN `een_cart_rule_lang` crl 
ON (cr.`id_cart_rule` = crl.`id_cart_rule` AND crl.`id_lang` = 1) WHERE (cr.`id_customer` = 0) AND NOW() BETWEEN cr.date_from AND cr.date_to
AND cr.`active` = 1
AND free_shipping = 1 AND carrier_restriction = 1
 0.130 ms 1 /classes/CartRule.php:423
495 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 30649) AND (b.`id_shop` = 1) LIMIT 1
 0.129 ms 1 /src/Adapter/EntityMapper.php:71
332 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 31000
ORDER BY f.position ASC
 0.128 ms 3 Yes /classes/Product.php:6021
7 
SELECT SQL_NO_CACHE *
FROM `een_country` a
LEFT JOIN `een_country_lang` `b` ON a.`id_country` = b.`id_country` AND b.`id_lang` = 1
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 8) LIMIT 1
 0.126 ms 1 /src/Adapter/EntityMapper.php:71
288 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 36837
ORDER BY f.position ASC
 0.125 ms 2 Yes /classes/Product.php:6021
465 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 36884) AND (b.`id_shop` = 1) LIMIT 1
 0.125 ms 1 /src/Adapter/EntityMapper.php:71
299 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 31035
ORDER BY f.position ASC
 0.125 ms 3 Yes /classes/Product.php:6021
450 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 40049) AND (b.`id_shop` = 1) LIMIT 1
 0.125 ms 1 /src/Adapter/EntityMapper.php:71
405 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 30633
ORDER BY f.position ASC
 0.124 ms 1 Yes /classes/Product.php:6021
446 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 25114
ORDER BY f.position ASC
 0.124 ms 3 Yes /classes/Product.php:6021
462 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 36979) AND (b.`id_shop` = 1) LIMIT 1
 0.124 ms 1 /src/Adapter/EntityMapper.php:71
483 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 31000) AND (b.`id_shop` = 1) LIMIT 1
 0.124 ms 1 /src/Adapter/EntityMapper.php:71
492 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 30840) AND (b.`id_shop` = 1) LIMIT 1
 0.124 ms 1 /src/Adapter/EntityMapper.php:71
170 
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `een_feature_value` v LEFT JOIN `een_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `een_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 34 ORDER BY vl.`value` ASC
 0.123 ms 8 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
212 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 40049
ORDER BY f.position ASC
 0.123 ms 2 Yes /classes/Product.php:6021
459 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 40017) AND (b.`id_shop` = 1) LIMIT 1
 0.123 ms 1 /src/Adapter/EntityMapper.php:71
468 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 36882) AND (b.`id_shop` = 1) LIMIT 1
 0.123 ms 1 /src/Adapter/EntityMapper.php:71
343 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 30954
ORDER BY f.position ASC
 0.122 ms 2 Yes /classes/Product.php:6021
447 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 647701
ORDER BY `position`
 0.122 ms 7 Yes /classes/Product.php:3545
480 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 31006) AND (b.`id_shop` = 1) LIMIT 1
 0.121 ms 1 /src/Adapter/EntityMapper.php:71
513 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 25115) AND (b.`id_shop` = 1) LIMIT 1
 0.121 ms 1 /src/Adapter/EntityMapper.php:71
353 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 30894
ORDER BY f.position ASC
 0.121 ms 2 Yes /classes/Product.php:6021
471 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 36837) AND (b.`id_shop` = 1) LIMIT 1
 0.121 ms 1 /src/Adapter/EntityMapper.php:71
501 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 30635) AND (b.`id_shop` = 1) LIMIT 1
 0.121 ms 1 /src/Adapter/EntityMapper.php:71
486 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 30954) AND (b.`id_shop` = 1) LIMIT 1
 0.119 ms 1 /src/Adapter/EntityMapper.php:71
498 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 30637) AND (b.`id_shop` = 1) LIMIT 1
 0.119 ms 1 /src/Adapter/EntityMapper.php:71
504 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 30633) AND (b.`id_shop` = 1) LIMIT 1
 0.119 ms 1 /src/Adapter/EntityMapper.php:71
520 
SELECT SQL_NO_CACHE 1 FROM `een_cart_rule` WHERE ((date_to >= "2026-04-28 00:00:00" AND date_to <= "2026-04-28 23:59:59") OR (date_from >= "2026-04-28 00:00:00" AND date_from <= "2026-04-28 23:59:59") OR (date_from < "2026-04-28 00:00:00" AND date_to > "2026-04-28 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
 0.119 ms 2 /classes/CartRule.php:357
223 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 40048
ORDER BY f.position ASC
 0.118 ms 2 Yes /classes/Product.php:6021
507 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 25139) AND (b.`id_shop` = 1) LIMIT 1
 0.118 ms 1 /src/Adapter/EntityMapper.php:71
256 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 36979
ORDER BY f.position ASC
 0.117 ms 1 Yes /classes/Product.php:6021
469 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 36882
ORDER BY `position`
 0.117 ms 7 Yes /classes/Product.php:3545
363 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 30840
ORDER BY f.position ASC
 0.116 ms 1 Yes /classes/Product.php:6021
385 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 30637
ORDER BY f.position ASC
 0.116 ms 1 Yes /classes/Product.php:6021
487 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 30954
ORDER BY `position`
 0.116 ms 6 Yes /classes/Product.php:3545
277 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 36882
ORDER BY f.position ASC
 0.116 ms 1 Yes /classes/Product.php:6021
1 
SELECT SQL_NO_CACHE s.id_shop, CONCAT(su.physical_uri, su.virtual_uri) AS uri, su.domain, su.main
FROM een_shop_url su
LEFT JOIN een_shop s ON (s.id_shop = su.id_shop)
WHERE (su.domain = 'decozzia.com' OR su.domain_ssl = 'decozzia.com')
AND s.active = 1
AND s.deleted = 0
ORDER BY LENGTH(CONCAT(su.physical_uri, su.virtual_uri)) DESC
 0.115 ms 1 Yes /classes/shop/Shop.php:1364
267 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 36884
ORDER BY f.position ASC
 0.115 ms 1 Yes /classes/Product.php:6021
374 
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 30649
ORDER BY f.position ASC
 0.114 ms 1 Yes /classes/Product.php:6021
457 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 40046
ORDER BY `position`
 0.114 ms 5 Yes /classes/Product.php:3545
511 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 25116
ORDER BY `position`
 0.114 ms 6 Yes /classes/Product.php:3545
522 
SELECT SQL_NO_CACHE 1 FROM `een_cart_rule` WHERE ((date_to >= "2026-04-28 00:00:00" AND date_to <= "2026-04-28 23:59:59") OR (date_from >= "2026-04-28 00:00:00" AND date_from <= "2026-04-28 23:59:59") OR (date_from < "2026-04-28 00:00:00" AND date_to > "2026-04-28 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
 0.114 ms 2 /classes/CartRule.php:357
463 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 36979
ORDER BY `position`
 0.113 ms 7 Yes /classes/Product.php:3545
484 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 31000
ORDER BY `position`
 0.113 ms 7 Yes /classes/Product.php:3545
151 
SELECT SQL_NO_CACHE type, id_value, filter_show_limit, filter_type FROM een_layered_category
WHERE controller = 'category'
AND id_category = 1000
AND id_shop = 1
GROUP BY `type`, id_value ORDER BY position ASC
 0.112 ms 10 Yes Yes /modules/ps_facetedsearch/src/Filters/Provider.php:61
194 
SELECT SQL_NO_CACHE tr.*
FROM `een_tax_rule` tr
JOIN `een_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 21
AND tr.`id_tax_rules_group` = 1
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
 0.112 ms 1 /classes/tax/TaxRulesTaxManager.php:109
493 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 30840
ORDER BY `position`
 0.112 ms 6 Yes /classes/Product.php:3545
453 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 40048) AND (b.`id_shop` = 1) LIMIT 1
 0.112 ms 1 /src/Adapter/EntityMapper.php:71
460 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 40017
ORDER BY `position`
 0.111 ms 7 Yes /classes/Product.php:3545
466 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 36884
ORDER BY `position`
 0.111 ms 7 Yes /classes/Product.php:3545
456 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 40046) AND (b.`id_shop` = 1) LIMIT 1
 0.111 ms 1 /src/Adapter/EntityMapper.php:71
496 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 30649
ORDER BY `position`
 0.111 ms 6 Yes /classes/Product.php:3545
229 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 40046)
 0.110 ms 1 /classes/Product.php:3860
499 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 30637
ORDER BY `position`
 0.108 ms 6 Yes /classes/Product.php:3545
474 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 31035) AND (b.`id_shop` = 1) LIMIT 1
 0.107 ms 1 /src/Adapter/EntityMapper.php:71
508 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 25139
ORDER BY `position`
 0.107 ms 6 Yes /classes/Product.php:3545
502 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 30635
ORDER BY `position`
 0.107 ms 5 Yes /classes/Product.php:3545
24 
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `een_module` m
LEFT JOIN `een_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
 0.106 ms 104 /classes/module/Module.php:346
182 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 647701) AND (b.`id_shop` = 1) LIMIT 1
 0.106 ms 1 /src/Adapter/EntityMapper.php:71
505 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 30633
ORDER BY `position`
 0.106 ms 5 Yes /classes/Product.php:3545
157 
SELECT SQL_NO_CACHE data FROM een_layered_filter_block WHERE hash="8c34c32232e7e8ed56a01d1c6aa8fbf4" LIMIT 1
 0.105 ms 1 /modules/ps_facetedsearch/src/Filters/Block.php:186
179 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 647701
AND image_shop.`cover` = 1 LIMIT 1
 0.105 ms 7 /classes/Product.php:3570
472 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 36837
ORDER BY `position`
 0.105 ms 5 Yes /classes/Product.php:3545
481 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 31006
ORDER BY `position`
 0.105 ms 5 Yes /classes/Product.php:3545
441 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 25114)
 0.104 ms 1 /classes/Product.php:3860
63 
SELECT SQL_NO_CACHE *
FROM `een_category` a0
LEFT JOIN `een_category_lang` `a1` ON (a0.`id_category` = a1.`id_category`)
WHERE (a0.`nleft` < 3) AND (a0.`nright` > 346) AND (a1.`id_lang` = 1) AND (a1.`id_shop` = 1)
ORDER BY a0.`nleft` asc
 0.104 ms 2 /classes/PrestaShopCollection.php:383
477 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 31007) AND (b.`id_shop` = 1) LIMIT 1
 0.104 ms 1 /src/Adapter/EntityMapper.php:71
431 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 25115)
 0.103 ms 1 /classes/Product.php:3860
130 
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'FR' LIMIT 1
 0.102 ms 1 /classes/Country.php:194
240 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 40017)
 0.101 ms 1 /classes/Product.php:3860
451 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 40049
ORDER BY `position`
 0.101 ms 6 Yes /classes/Product.php:3545
489 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 30894) AND (b.`id_shop` = 1) LIMIT 1
 0.101 ms 1 /src/Adapter/EntityMapper.php:71
516 
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 25114) AND (b.`id_shop` = 1) LIMIT 1
 0.101 ms 1 /src/Adapter/EntityMapper.php:71
427 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 25115
AND image_shop.`cover` = 1 LIMIT 1
 0.098 ms 6 /classes/Product.php:3570
235 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 40017
AND image_shop.`cover` = 1 LIMIT 1
 0.098 ms 7 /classes/Product.php:3570
43 
SELECT SQL_NO_CACHE *
FROM `een_category` a
LEFT JOIN `een_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `een_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 1030) AND (b.`id_shop` = 1) LIMIT 1
 0.097 ms 1 /src/Adapter/EntityMapper.php:71
600 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "ps_emailsubscription" LIMIT 1
 0.097 ms 1 /classes/module/Module.php:2659
454 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 40048
ORDER BY `position`
 0.096 ms 5 Yes /classes/Product.php:3545
478 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 31007
ORDER BY `position`
 0.095 ms 5 Yes /classes/Product.php:3545
514 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 25115
ORDER BY `position`
 0.094 ms 6 Yes /classes/Product.php:3545
6 
SELECT SQL_NO_CACHE l.*, ls.`id_shop`
FROM `een_lang` l
LEFT JOIN `een_lang_shop` ls ON (l.id_lang = ls.id_lang)
 0.094 ms 1 /classes/Language.php:1080
437 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 25114
AND image_shop.`cover` = 1 LIMIT 1
 0.094 ms 5 /classes/Product.php:3570
490 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 30894
ORDER BY `position`
 0.094 ms 8 Yes /classes/Product.php:3545
517 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 25114
ORDER BY `position`
 0.094 ms 5 Yes /classes/Product.php:3545
32 
SELECT SQL_NO_CACHE *
FROM `een_country` a
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 21) LIMIT 1
 0.093 ms 1 /src/Adapter/EntityMapper.php:71
272 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 36882)
 0.093 ms 1 /classes/Product.php:3860
338 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 30954)
 0.092 ms 1 /classes/Product.php:3860
475 
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 31035
ORDER BY `position`
 0.092 ms 5 Yes /classes/Product.php:3545
524 
SELECT SQL_NO_CACHE COUNT(*) FROM `een_orders` o
LEFT JOIN `een_order_cart_rule` ocr ON (ocr.`id_order` = o.`id_order`)
WHERE o.`id_customer` = 0
AND ocr.`deleted` = 0 AND ocr.`id_cart_rule` = 0 LIMIT 1
 0.091 ms 1 /classes/order/Order.php:881
201 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 40049
AND image_shop.`cover` = 1 LIMIT 1
 0.090 ms 6 /classes/Product.php:3570
294 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 31035)
 0.090 ms 1 /classes/Product.php:3860
369 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 30649)
 0.090 ms 1 /classes/Product.php:3860
146 
SELECT SQL_NO_CACHE *
FROM `een_country` a
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 186) LIMIT 1
 0.090 ms 1 /src/Adapter/EntityMapper.php:71
207 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 40049)
 0.090 ms 1 /classes/Product.php:3860
262 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 36884)
 0.089 ms 1 /classes/Product.php:3860
12 
SELECT SQL_NO_CACHE COUNT(DISTINCT l.id_lang) FROM `een_lang` l
JOIN een_lang_shop lang_shop ON (lang_shop.id_lang = l.id_lang AND lang_shop.id_shop = 1)
WHERE l.`active` = 1 LIMIT 1
 0.089 ms 1 /classes/Language.php:1216
348 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 30894)
 0.089 ms 1 /classes/Product.php:3860
190 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 647701)
 0.087 ms 1 /classes/Product.php:3860
283 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 36837)
 0.087 ms 1 /classes/Product.php:3860
305 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 31007)
 0.087 ms 1 /classes/Product.php:3860
380 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 30637)
 0.087 ms 1 /classes/Product.php:3860
396 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 30633
AND image_shop.`cover` = 1 LIMIT 1
 0.087 ms 5 /classes/Product.php:3570
315 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 31006)
 0.086 ms 1 /classes/Product.php:3860
251 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 36979)
 0.085 ms 1 /classes/Product.php:3860
386 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 30635
AND image_shop.`cover` = 1 LIMIT 1
 0.084 ms 5 /classes/Product.php:3570
400 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 30633)
 0.084 ms 1 /classes/Product.php:3860
411 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 25139)
 0.083 ms 1 /classes/Product.php:3860
25 
SELECT SQL_NO_CACHE *
FROM `een_category` a
LEFT JOIN `een_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `een_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 1000) AND (b.`id_shop` = 1) LIMIT 1
 0.083 ms 1 /src/Adapter/EntityMapper.php:71
311 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 31006
AND image_shop.`cover` = 1 LIMIT 1
 0.083 ms 5 /classes/Product.php:3570
326 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 31000)
 0.083 ms 1 /classes/Product.php:3860
358 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 30840)
 0.083 ms 1 /classes/Product.php:3860
390 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 30635)
 0.082 ms 1 /classes/Product.php:3860
417 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 25116
AND image_shop.`cover` = 1 LIMIT 1
 0.082 ms 6 /classes/Product.php:3570
246 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 36979
AND image_shop.`cover` = 1 LIMIT 1
 0.081 ms 7 /classes/Product.php:3570
344 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 30894
AND image_shop.`cover` = 1 LIMIT 1
 0.081 ms 8 /classes/Product.php:3570
421 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 25116)
 0.081 ms 1 /classes/Product.php:3860
218 
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 40048)
 0.081 ms 1 /classes/Product.php:3860
333 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 30954
AND image_shop.`cover` = 1 LIMIT 1
 0.080 ms 6 /classes/Product.php:3570
321 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 31000
AND image_shop.`cover` = 1 LIMIT 1
 0.080 ms 7 /classes/Product.php:3570
213 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 40048
AND image_shop.`cover` = 1 LIMIT 1
 0.079 ms 5 /classes/Product.php:3570
354 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 30840
AND image_shop.`cover` = 1 LIMIT 1
 0.079 ms 6 /classes/Product.php:3570
300 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 31007
AND image_shop.`cover` = 1 LIMIT 1
 0.078 ms 5 /classes/Product.php:3570
406 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 25139
AND image_shop.`cover` = 1 LIMIT 1
 0.078 ms 6 /classes/Product.php:3570
257 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 36884
AND image_shop.`cover` = 1 LIMIT 1
 0.078 ms 7 /classes/Product.php:3570
364 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 30649
AND image_shop.`cover` = 1 LIMIT 1
 0.078 ms 6 /classes/Product.php:3570
44 
SELECT SQL_NO_CACHE *
FROM `een_category` a
LEFT JOIN `een_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `een_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 1031) AND (b.`id_shop` = 1) LIMIT 1
 0.077 ms 1 /src/Adapter/EntityMapper.php:71
131 
SELECT SQL_NO_CACHE c.id_currency
FROM `een_currency` c
WHERE (deleted = 0) AND (iso_code = 'MAD') LIMIT 1
 0.077 ms 1 /classes/Currency.php:893
154 
SELECT SQL_NO_CACHE *
FROM `een_category` a
LEFT JOIN `een_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 1000) LIMIT 1
 0.077 ms 1 /src/Adapter/EntityMapper.php:71
230 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 40046 AND id_shop=1 LIMIT 1
 0.077 ms 1 /classes/Product.php:6876
289 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 31035
AND image_shop.`cover` = 1 LIMIT 1
 0.077 ms 5 /classes/Product.php:3570
29 
SELECT SQL_NO_CACHE *
FROM `een_currency` a
LEFT JOIN `een_currency_lang` `b` ON a.`id_currency` = b.`id_currency` AND b.`id_lang` = 1
LEFT JOIN `een_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
 0.077 ms 1 /src/Adapter/EntityMapper.php:71
5 
SELECT SQL_NO_CACHE su.physical_uri, su.virtual_uri, su.domain, su.domain_ssl
FROM een_shop s
LEFT JOIN een_shop_url su ON (s.id_shop = su.id_shop)
WHERE s.id_shop = 1
AND s.active = 1 AND s.deleted = 0 AND su.main = 1 LIMIT 1
 0.076 ms 1 /classes/shop/Shop.php:218
224 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 40046
AND image_shop.`cover` = 1 LIMIT 1
 0.076 ms 5 /classes/Product.php:3570
268 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 36882
AND image_shop.`cover` = 1 LIMIT 1
 0.076 ms 7 /classes/Product.php:3570
375 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 30637
AND image_shop.`cover` = 1 LIMIT 1
 0.076 ms 6 /classes/Product.php:3570
278 
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 36837
AND image_shop.`cover` = 1 LIMIT 1
 0.075 ms 5 /classes/Product.php:3570
57 
SELECT SQL_NO_CACHE * FROM `een_image_type` WHERE 1 AND `products` = 1  ORDER BY `width` DESC, `height` DESC, `name`ASC
 0.073 ms 8 Yes /classes/ImageType.php:109
543 
SELECT SQL_NO_CACHE c.id_elementor FROM een_iqit_elementor_category c LEFT JOIN een_iqit_elementor_category_shop s ON c.id_elementor = s.id_elementor WHERE c.id_category = 1000 AND s.id_shop = 1 LIMIT 1
 0.071 ms 62 /modules/iqitelementor/src/IqitElementorCategory.php:87
112 
SELECT SQL_NO_CACHE id_feed
FROM `een_gmcp_feeds` ff
WHERE (ff.id_shop=1) LIMIT 1
 0.071 ms 370 /modules/gmerchantcenterpro/models/Feeds.php:53
33 
SELECT SQL_NO_CACHE *
FROM `een_country_lang`
WHERE `id_country` = 21
 0.070 ms 1 /src/Adapter/EntityMapper.php:79
45 
SELECT SQL_NO_CACHE *
FROM `een_category` a
LEFT JOIN `een_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `een_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 5735) AND (b.`id_shop` = 1) LIMIT 1
 0.070 ms 1 /src/Adapter/EntityMapper.php:71
134 
SELECT SQL_NO_CACHE *
FROM `een_country` a
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 19) LIMIT 1
 0.069 ms 1 /src/Adapter/EntityMapper.php:71
17 
SELECT SQL_NO_CACHE value FROM `een_configuration` WHERE `name` = "PS_MULTISHOP_FEATURE_ACTIVE" LIMIT 1
 0.069 ms 1 /classes/shop/Shop.php:1183
49 
SELECT SQL_NO_CACHE *
FROM `een_category` a
LEFT JOIN `een_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `een_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 411) AND (b.`id_shop` = 1) LIMIT 1
 0.068 ms 1 /src/Adapter/EntityMapper.php:71
328 
SELECT SQL_NO_CACHE tr.*
FROM `een_tax_rule` tr
JOIN `een_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 21
AND tr.`id_tax_rules_group` = 8
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
 0.068 ms 0 /classes/tax/TaxRulesTaxManager.php:109
26 
SELECT SQL_NO_CACHE * FROM `een_currency` c ORDER BY `iso_code` ASC
 0.068 ms 1 Yes /classes/Currency.php:709
34 
SELECT SQL_NO_CACHE *
FROM `een_currency` a
LEFT JOIN `een_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
 0.067 ms 1 /src/Adapter/EntityMapper.php:71
527 
SELECT SQL_NO_CACHE COUNT(DISTINCT c.id_currency) FROM `een_currency` c
LEFT JOIN een_currency_shop cs ON (cs.id_currency = c.id_currency AND cs.id_shop = 1)
WHERE c.`active` = 1 AND c.`deleted` = 0 LIMIT 1
 0.067 ms 1 /classes/Currency.php:1136
0 
SELECT SQL_NO_CACHE * FROM een_memcached_servers
 0.065 ms 1 /classes/cache/CacheMemcached.php:263
15 
SELECT SQL_NO_CACHE `name`, `alias` FROM `een_hook_alias`
 0.065 ms 87 /classes/Hook.php:287
48 
SELECT SQL_NO_CACHE *
FROM `een_category` a
LEFT JOIN `een_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `een_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 1027) AND (b.`id_shop` = 1) LIMIT 1
 0.065 ms 1 /src/Adapter/EntityMapper.php:71
46 
SELECT SQL_NO_CACHE *
FROM `een_category` a
LEFT JOIN `een_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `een_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 5728) AND (b.`id_shop` = 1) LIMIT 1
 0.065 ms 1 /src/Adapter/EntityMapper.php:71
4 
SELECT SQL_NO_CACHE *
FROM `een_shop` a
WHERE (a.`id_shop` = 1) LIMIT 1
 0.064 ms 1 /src/Adapter/EntityMapper.php:71
183 
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 0 LIMIT 1
 0.064 ms 1 /classes/SpecificPrice.php:426
155 
SELECT SQL_NO_CACHE *
FROM `een_category_lang`
WHERE `id_category` = 1000 AND `id_shop` = 1
 0.063 ms 1 /src/Adapter/EntityMapper.php:79
9 
SELECT SQL_NO_CACHE *
FROM `een_lang` a
LEFT JOIN `een_lang_shop` `c` ON a.`id_lang` = c.`id_lang` AND c.`id_shop` = 1
WHERE (a.`id_lang` = 1) LIMIT 1
 0.063 ms 1 /src/Adapter/EntityMapper.php:71
47 
SELECT SQL_NO_CACHE *
FROM `een_category` a
LEFT JOIN `een_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `een_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 5723) AND (b.`id_shop` = 1) LIMIT 1
 0.063 ms 1 /src/Adapter/EntityMapper.php:71
50 
SELECT SQL_NO_CACHE *
FROM `een_category` a
LEFT JOIN `een_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `een_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 426) AND (b.`id_shop` = 1) LIMIT 1
 0.063 ms 1 /src/Adapter/EntityMapper.php:71
602 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "iqitsociallogin" LIMIT 1
 0.063 ms 1 /classes/module/Module.php:2659
197 
SELECT SQL_NO_CACHE tr.*
FROM `een_tax_rule` tr
JOIN `een_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 21
AND tr.`id_tax_rules_group` = 0
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
 0.062 ms 0 /classes/tax/TaxRulesTaxManager.php:109
8 
SELECT SQL_NO_CACHE *
FROM `een_shop_group` a
WHERE (a.`id_shop_group` = 1) LIMIT 1
 0.062 ms 1 /src/Adapter/EntityMapper.php:71
19 
SELECT SQL_NO_CACHE name, alias FROM `een_hook_alias`
 0.062 ms 87 /classes/Hook.php:339
53 
CREATE TABLE IF NOT EXISTS `een_revolut_payment_orders` (
`id` INT NOT NULL AUTO_INCREMENT,
`id_order` INT NULL ,
`id_cart` INT NULL ,
`id_revolut_order` VARCHAR(250) NOT NULL ,
`public_id` VARCHAR(250) NOT NULL ,
`save_card` TINYINT NOT NULL DEFAULT "0" ,
PRIMARY KEY (`id`),
UNIQUE (`id_revolut_order`),
UNIQUE (`id_order`)
) ENGINE = InnoDB;
 0.062 ms 1 /modules/revolutpayment/revolutpayment.php:320
138 
SELECT SQL_NO_CACHE *
FROM `een_country` a
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 4) LIMIT 1
 0.062 ms 1 /src/Adapter/EntityMapper.php:71
280 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1020 LIMIT 1
 0.062 ms 1 /classes/Product.php:5659
519 
SELECT SQL_NO_CACHE c.id_elementor FROM een_iqit_elementor_category c WHERE c.id_category = 1000 LIMIT 1
 0.062 ms 62 /modules/iqitelementor/src/IqitElementorCategory.php:87
572 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "supercheckout" LIMIT 1
 0.061 ms 0 /classes/module/Module.php:2659
11 
SELECT SQL_NO_CACHE domain, domain_ssl
FROM een_shop_url
WHERE main = 1
AND id_shop = 1 LIMIT 1
 0.061 ms 1 /classes/shop/ShopUrl.php:182
536 
SELECT SQL_NO_CACHE SUM(`quantity`)
FROM `een_cart_product`
WHERE `id_cart` = 0 LIMIT 1
 0.061 ms 1 /classes/Cart.php:1303
37 
SELECT SQL_NO_CACHE *
FROM `een_group` a
LEFT JOIN `een_group_shop` `c` ON a.`id_group` = c.`id_group` AND c.`id_shop` = 1
WHERE (a.`id_group` = 1) LIMIT 1
 0.060 ms 1 /src/Adapter/EntityMapper.php:71
544 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "ps_facetedsearch" LIMIT 1
 0.060 ms 1 /classes/module/Module.php:2659
525 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "iqitlinksmanager" LIMIT 1
 0.059 ms 1 /classes/module/Module.php:2659
132 
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'CH' LIMIT 1
 0.058 ms 1 /classes/Country.php:194
64 
SELECT SQL_NO_CACHE * FROM een_revslider_sliders
 0.058 ms 1 /modules/revsliderprestashop/includes/revslider_db.class.php:214
142 
SELECT SQL_NO_CACHE *
FROM `een_country` a
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 3) LIMIT 1
 0.058 ms 1 /src/Adapter/EntityMapper.php:71
461 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 40017
 0.058 ms 1 /classes/Product.php:2902
60 
SELECT SQL_NO_CACHE *
FROM `een_country` a
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 17) LIMIT 1
 0.057 ms 1 /src/Adapter/EntityMapper.php:71
148 
SELECT SQL_NO_CACHE id_order
FROM `een_orders` o
WHERE (o.id_cart=0) LIMIT 1
 0.057 ms 1 /modules/gmerchantcenterpro/lib/dao/moduleDao.php:450
135 
SELECT SQL_NO_CACHE *
FROM `een_country_lang`
WHERE `id_country` = 19
 0.056 ms 1 /src/Adapter/EntityMapper.php:79
136 
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'CA' LIMIT 1
 0.056 ms 1 /classes/Country.php:194
500 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 30637
 0.056 ms 1 /classes/Product.php:2902
601 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 19 AND `id_shop` = 1 LIMIT 1
 0.056 ms 0 /classes/module/Module.php:2132
198 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 647701) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.055 ms 1 /classes/stock/StockAvailable.php:453
488 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 30954
 0.055 ms 1 /classes/Product.php:2902
442 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 25114 AND id_shop=1 LIMIT 1
 0.055 ms 1 /classes/Product.php:6876
31 
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'US' LIMIT 1
 0.054 ms 1 /classes/Country.php:194
497 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 30649
 0.054 ms 1 /classes/Product.php:2902
512 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 25116
 0.054 ms 1 /classes/Product.php:2902
28 
SELECT SQL_NO_CACHE c.id_currency
FROM `een_currency` c
WHERE (iso_code = 'EUR') LIMIT 1
 0.054 ms 1 /classes/Currency.php:893
140 
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'BE' LIMIT 1
 0.054 ms 1 /classes/Country.php:194
458 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 40046
 0.054 ms 1 /classes/Product.php:2902
470 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 36882
 0.054 ms 1 /classes/Product.php:2902
506 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 30633
 0.054 ms 1 /classes/Product.php:2902
117 
SELECT SQL_NO_CACHE *
FROM `een_country` a
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 8) LIMIT 1
 0.053 ms 1 /src/Adapter/EntityMapper.php:71
467 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 36884
 0.053 ms 1 /classes/Product.php:2902
485 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 31000
 0.053 ms 1 /classes/Product.php:2902
591 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "attributewizardpro" LIMIT 1
 0.053 ms 0 /classes/module/Module.php:2659
27 
SELECT SQL_NO_CACHE `id_lang` FROM `een_lang`
WHERE `locale` = 'fr-fr'
OR `language_code` = 'fr-fr' LIMIT 1
 0.053 ms 1 /classes/Language.php:883
139 
SELECT SQL_NO_CACHE *
FROM `een_country_lang`
WHERE `id_country` = 4
 0.053 ms 1 /src/Adapter/EntityMapper.php:79
232 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 40046) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.053 ms 1 /classes/stock/StockAvailable.php:453
434 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 25115) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.053 ms 1 /classes/stock/StockAvailable.php:453
482 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 31006
 0.053 ms 1 /classes/Product.php:2902
494 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 30840
 0.053 ms 1 /classes/Product.php:2902
503 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 30635
 0.053 ms 1 /classes/Product.php:2902
464 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 36979
 0.052 ms 1 /classes/Product.php:2902
473 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 36837
 0.052 ms 1 /classes/Product.php:2902
71 
CREATE TABLE IF NOT EXISTS `een_gmcp_reporting` (`id_reporting` int(11) NOT NULL AUTO_INCREMENT,`iso_feed` LONGTEXT NOT NULL,    `reporting_content` LONGTEXT NOT NULL,`id_shop` int(11) NOT NULL,`date_add` datetime NOT NULL,`date_upd` datetime NOT NULL,PRIMARY KEY (`id_reporting`)) ENGINE=' . _MYSQL_ENGINE_ . ' DEFAULT CHARSET=utf8;
 0.052 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
149 
SELECT SQL_NO_CACHE `name`
FROM `een_hook`
WHERE `id_hook` = 1013 LIMIT 1
 0.052 ms 1 /classes/Hook.php:244
184 
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE `id_product` != 0 LIMIT 1
 0.052 ms 523 /classes/SpecificPrice.php:297
316 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 31006 AND id_shop=1 LIMIT 1
 0.052 ms 1 /classes/Product.php:6876
428 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1015 LIMIT 1
 0.052 ms 1 /classes/Product.php:5659
509 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 25139
 0.052 ms 1 /classes/Product.php:2902
528 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "ps_languageselector" LIMIT 1
 0.052 ms 1 /classes/module/Module.php:2659
115 
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'FR' LIMIT 1
 0.051 ms 1 /classes/Country.php:194
133 
SELECT SQL_NO_CACHE `name`
FROM `een_country_lang`
WHERE `id_lang` = 1
AND `id_country` = 19 LIMIT 1
 0.051 ms 1 /classes/Country.php:252
143 
SELECT SQL_NO_CACHE *
FROM `een_country_lang`
WHERE `id_country` = 3
 0.051 ms 1 /src/Adapter/EntityMapper.php:79
147 
SELECT SQL_NO_CACHE *
FROM `een_country_lang`
WHERE `id_country` = 186
 0.051 ms 1 /src/Adapter/EntityMapper.php:79
438 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 2368 LIMIT 1
 0.051 ms 1 /classes/Product.php:5659
23 
SELECT SQL_NO_CACHE * FROM `een_hook_module_exceptions`
WHERE `id_shop` IN (1)
 0.050 ms 1 /classes/module/Module.php:2041
35 
SELECT SQL_NO_CACHE *
FROM `een_currency_lang`
WHERE `id_currency` = 1
 0.050 ms 1 /src/Adapter/EntityMapper.php:79
58 
SELECT SQL_NO_CACHE format
FROM `een_address_format`
WHERE `id_country` = 17 LIMIT 1
 0.050 ms 1 /classes/AddressFormat.php:656
119 
SELECT SQL_NO_CACHE c.id_currency
FROM `een_currency` c
WHERE (deleted = 0) AND (iso_code = 'EUR') LIMIT 1
 0.050 ms 1 /classes/Currency.php:893
318 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 31006) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.050 ms 1 /classes/stock/StockAvailable.php:453
432 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 25115 AND id_shop=1 LIMIT 1
 0.050 ms 1 /classes/Product.php:6876
449 
SELECT SQL_NO_CACHE state FROM een_feature_flag WHERE name = 'multiple_image_format' LIMIT 1
 0.050 ms 1 /classes/FeatureFlag.php:105
537 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "iqitmegamenu" LIMIT 1
 0.050 ms 1 /classes/module/Module.php:2659
541 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "iqitelementor" LIMIT 1
 0.050 ms 1 /classes/module/Module.php:2659
186 
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE `from` BETWEEN '2026-04-28 00:00:00' AND '2026-04-28 23:59:59' LIMIT 1
 0.050 ms 1 /classes/SpecificPrice.php:377
252 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 36979 AND id_shop=1 LIMIT 1
 0.050 ms 1 /classes/Product.php:6876
448 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 647701
 0.050 ms 1 /classes/Product.php:2902
30 
SELECT SQL_NO_CACHE `id_lang` FROM `een_lang`
WHERE `locale` = 'fr-fr'
OR `language_code` = 'fr-fr' LIMIT 1
 0.049 ms 1 /classes/Language.php:883
61 
SELECT SQL_NO_CACHE *
FROM `een_country_lang`
WHERE `id_country` = 17
 0.049 ms 1 /src/Adapter/EntityMapper.php:79
180 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 2750 LIMIT 1
 0.049 ms 1 /classes/Category.php:1378
236 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 1022 LIMIT 1
 0.049 ms 1 /classes/Category.php:1378
452 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 40049
 0.049 ms 1 /classes/Product.php:2902
546 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "iqitcountdown" LIMIT 1
 0.049 ms 1 /classes/module/Module.php:2659
604 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "iqitcookielaw" LIMIT 1
 0.049 ms 1 /classes/module/Module.php:2659
21 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "ets_superspeed" LIMIT 1
 0.049 ms 0 /classes/module/Module.php:2659
51 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "facebookproductsfeed" LIMIT 1
 0.049 ms 0 /classes/module/Module.php:2659
279 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 1020 LIMIT 1
 0.048 ms 1 /classes/Category.php:1378
195 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 647701 AND `id_group` = 1 LIMIT 1
 0.048 ms 0 /classes/GroupReduction.php:156
241 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 40017 AND id_shop=1 LIMIT 1
 0.048 ms 1 /classes/Product.php:6876
243 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 40017) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.048 ms 1 /classes/stock/StockAvailable.php:453
38 
SELECT SQL_NO_CACHE *
FROM `een_group_lang`
WHERE `id_group` = 1
 0.047 ms 1 /src/Adapter/EntityMapper.php:79
137 
SELECT SQL_NO_CACHE `name`
FROM `een_country_lang`
WHERE `id_lang` = 1
AND `id_country` = 4 LIMIT 1
 0.047 ms 1 /classes/Country.php:252
144 
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'SA' LIMIT 1
 0.047 ms 1 /classes/Country.php:194
455 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 40048
 0.047 ms 1 /classes/Product.php:2902
479 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 31007
 0.047 ms 1 /classes/Product.php:2902
518 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 25114
 0.047 ms 1 /classes/Product.php:2902
526 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 78 AND `id_shop` = 1 LIMIT 1
 0.047 ms 1 /classes/module/Module.php:2132
606 
SELECT SQL_NO_CACHE data
FROM `een_ganalytics_data`
WHERE id_cart = 0
AND id_shop = 1 LIMIT 1
 0.047 ms 0 /modules/ps_googleanalytics/classes/Repository/GanalyticsDataRepository.php:43
55 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "ps_legalcompliance" LIMIT 1
 0.046 ms 0 /classes/module/Module.php:2659
317 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 31006 AND `id_group` = 1 LIMIT 1
 0.046 ms 0 /classes/GroupReduction.php:156
65 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "pm_advancedpack" LIMIT 1
 0.045 ms 0 /classes/module/Module.php:2659
121 
SELECT SQL_NO_CACHE c.id_currency
FROM `een_currency` c
WHERE (deleted = 0) AND (iso_code = 'TND') LIMIT 1
 0.045 ms 1 /classes/Currency.php:893
141 
SELECT SQL_NO_CACHE `name`
FROM `een_country_lang`
WHERE `id_lang` = 1
AND `id_country` = 3 LIMIT 1
 0.045 ms 1 /classes/Country.php:252
297 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 31035) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.045 ms 1 /classes/stock/StockAvailable.php:453
301 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 2788 LIMIT 1
 0.045 ms 1 /classes/Category.php:1378
322 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 443 LIMIT 1
 0.045 ms 1 /classes/Category.php:1378
334 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 411 LIMIT 1
 0.045 ms 1 /classes/Category.php:1378
359 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 30840 AND id_shop=1 LIMIT 1
 0.045 ms 1 /classes/Product.php:6876
383 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 30637) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.045 ms 1 /classes/stock/StockAvailable.php:453
387 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 2754 LIMIT 1
 0.045 ms 1 /classes/Product.php:5659
476 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 31035
 0.045 ms 1 /classes/Product.php:2902
491 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 30894
 0.045 ms 1 /classes/Product.php:2902
515 
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 25115
 0.045 ms 1 /classes/Product.php:2902
540 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 81 AND `id_shop` = 1 LIMIT 1
 0.045 ms 1 /classes/module/Module.php:2132
202 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 1014 LIMIT 1
 0.045 ms 1 /classes/Category.php:1378
381 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 30637 AND id_shop=1 LIMIT 1
 0.045 ms 1 /classes/Product.php:6876
123 
SELECT SQL_NO_CACHE c.id_currency
FROM `een_currency` c
WHERE (deleted = 0) AND (iso_code = 'DZD') LIMIT 1
 0.044 ms 1 /classes/Currency.php:893
150 
SELECT SQL_NO_CACHE `id_category`
FROM `een_category_shop`
WHERE `id_category` = 1000
AND `id_shop` = 1 LIMIT 1
 0.044 ms 1 /classes/Category.php:2450
247 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 435 LIMIT 1
 0.044 ms 1 /classes/Category.php:1378
254 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 36979) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.044 ms 1 /classes/stock/StockAvailable.php:453
339 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 30954 AND id_shop=1 LIMIT 1
 0.044 ms 1 /classes/Product.php:6876
365 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 1021 LIMIT 1
 0.044 ms 1 /classes/Category.php:1378
603 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 93 AND `id_shop` = 1 LIMIT 1
 0.044 ms 1 /classes/module/Module.php:2132
191 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 647701 AND id_shop=1 LIMIT 1
 0.044 ms 1 /classes/Product.php:6876
330 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 31000) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.044 ms 1 /classes/stock/StockAvailable.php:453
341 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 30954) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.044 ms 1 /classes/stock/StockAvailable.php:453
36 
SELECT SQL_NO_CACHE id_shop
FROM `een_currency_shop`
WHERE `id_currency` = 1
AND id_shop = 1 LIMIT 1
 0.043 ms 1 /classes/ObjectModel.php:1729
62 
SELECT SQL_NO_CACHE id_required_field, object_name, field_name
FROM een_required_field
 0.043 ms 1 /classes/ObjectModel.php:1592
345 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1014 LIMIT 1
 0.043 ms 1 /classes/Product.php:5659
370 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 30649 AND id_shop=1 LIMIT 1
 0.043 ms 1 /classes/Product.php:6876
376 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 2368 LIMIT 1
 0.043 ms 1 /classes/Category.php:1378
407 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 367 LIMIT 1
 0.043 ms 1 /classes/Category.php:1378
444 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 25114) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.043 ms 1 /classes/stock/StockAvailable.php:453
10 
SELECT SQL_NO_CACHE id_shop
FROM `een_lang_shop`
WHERE `id_lang` = 1
AND id_shop = 1 LIMIT 1
 0.043 ms 1 /classes/ObjectModel.php:1729
120 
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'FR' LIMIT 1
 0.043 ms 1 /classes/Country.php:194
125 
SELECT SQL_NO_CACHE c.id_currency
FROM `een_currency` c
WHERE (deleted = 0) AND (iso_code = 'XAF') LIMIT 1
 0.043 ms 1 /classes/Currency.php:893
127 
SELECT SQL_NO_CACHE c.id_currency
FROM `een_currency` c
WHERE (deleted = 0) AND (iso_code = 'XOF') LIMIT 1
 0.043 ms 1 /classes/Currency.php:893
210 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 40049) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.043 ms 1 /classes/stock/StockAvailable.php:453
286 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 36837) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.043 ms 1 /classes/stock/StockAvailable.php:453
295 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 31035 AND id_shop=1 LIMIT 1
 0.043 ms 1 /classes/Product.php:6876
312 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 2788 LIMIT 1
 0.043 ms 1 /classes/Product.php:5659
539 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "iqitproductsnav" LIMIT 1
 0.043 ms 1 /classes/module/Module.php:2659
129 
SELECT SQL_NO_CACHE c.id_currency
FROM `een_currency` c
WHERE (deleted = 0) AND (iso_code = 'MGA') LIMIT 1
 0.042 ms 1 /classes/Currency.php:893
214 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 1013 LIMIT 1
 0.042 ms 1 /classes/Category.php:1378
258 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 2754 LIMIT 1
 0.042 ms 1 /classes/Category.php:1378
306 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 31007 AND id_shop=1 LIMIT 1
 0.042 ms 1 /classes/Product.php:6876
308 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 31007) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.042 ms 1 /classes/stock/StockAvailable.php:453
372 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 30649) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.042 ms 1 /classes/stock/StockAvailable.php:453
429 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 25115
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.042 ms 0 /classes/SpecificPrice.php:259
118 
SELECT SQL_NO_CACHE *
FROM `een_country_lang`
WHERE `id_country` = 8
 0.042 ms 1 /src/Adapter/EntityMapper.php:79
284 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 36837 AND id_shop=1 LIMIT 1
 0.042 ms 1 /classes/Product.php:6876
290 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 1015 LIMIT 1
 0.042 ms 1 /classes/Category.php:1378
327 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 31000 AND id_shop=1 LIMIT 1
 0.042 ms 1 /classes/Product.php:6876
355 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1015 LIMIT 1
 0.042 ms 1 /classes/Product.php:5659
361 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 30840) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.042 ms 1 /classes/stock/StockAvailable.php:453
397 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 2368 LIMIT 1
 0.042 ms 1 /classes/Product.php:5659
412 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 25139 AND id_shop=1 LIMIT 1
 0.042 ms 1 /classes/Product.php:6876
418 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1013 LIMIT 1
 0.042 ms 1 /classes/Product.php:5659
439 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 25114
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.042 ms 0 /classes/SpecificPrice.php:259
545 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 24 AND `id_shop` = 1 LIMIT 1
 0.042 ms 1 /classes/module/Module.php:2132
40 
SELECT SQL_NO_CACHE `id_category`
FROM `een_category_shop`
WHERE `id_category` = 1000
AND `id_shop` = 1 LIMIT 1
 0.041 ms 1 /classes/Category.php:2450
208 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 40049 AND id_shop=1 LIMIT 1
 0.041 ms 1 /classes/Product.php:6876
221 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 40048) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.041 ms 1 /classes/stock/StockAvailable.php:453
231 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 40046 AND `id_group` = 1 LIMIT 1
 0.041 ms 0 /classes/GroupReduction.php:156
263 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 36884 AND id_shop=1 LIMIT 1
 0.041 ms 1 /classes/Product.php:6876
265 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 36884) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.041 ms 1 /classes/stock/StockAvailable.php:453
269 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1013 LIMIT 1
 0.041 ms 1 /classes/Product.php:5659
275 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 36882) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.041 ms 1 /classes/stock/StockAvailable.php:453
329 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 31000 AND `id_group` = 1 LIMIT 1
 0.041 ms 0 /classes/GroupReduction.php:156
349 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 30894 AND id_shop=1 LIMIT 1
 0.041 ms 1 /classes/Product.php:6876
351 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 30894) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.041 ms 1 /classes/stock/StockAvailable.php:453
391 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 30635 AND id_shop=1 LIMIT 1
 0.041 ms 1 /classes/Product.php:6876
393 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 30635) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.041 ms 1 /classes/stock/StockAvailable.php:453
401 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 30633 AND id_shop=1 LIMIT 1
 0.041 ms 1 /classes/Product.php:6876
403 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 30633) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.041 ms 1 /classes/stock/StockAvailable.php:453
414 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 25139) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.041 ms 1 /classes/stock/StockAvailable.php:453
422 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 25116 AND id_shop=1 LIMIT 1
 0.041 ms 1 /classes/Product.php:6876
573 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.041 ms 0 /classes/module/Module.php:2132
597 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "blockwishlist" LIMIT 1
 0.041 ms 1 /classes/module/Module.php:2659
225 
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 1011 LIMIT 1
 0.041 ms 1 /classes/Category.php:1378
41 
SELECT SQL_NO_CACHE ctg.`id_group`
FROM een_category_group ctg
WHERE ctg.`id_category` = 1000 AND ctg.`id_group` = 1 LIMIT 1
 0.040 ms 1 /classes/Category.php:1754
56 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.040 ms 0 /classes/module/Module.php:2132
111 
COMMIT
 0.040 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:155
145 
SELECT SQL_NO_CACHE `name`
FROM `een_country_lang`
WHERE `id_lang` = 1
AND `id_country` = 186 LIMIT 1
 0.040 ms 1 /classes/Country.php:252
424 
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 25116) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
 0.040 ms 1 /classes/stock/StockAvailable.php:453
534 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "iqitcompare" LIMIT 1
 0.040 ms 1 /classes/module/Module.php:2659
122 
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'FR' LIMIT 1
 0.040 ms 1 /classes/Country.php:194
219 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 40048 AND id_shop=1 LIMIT 1
 0.040 ms 1 /classes/Product.php:6876
273 
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 36882 AND id_shop=1 LIMIT 1
 0.040 ms 1 /classes/Product.php:6876
39 
SELECT SQL_NO_CACHE id_shop
FROM `een_group_shop`
WHERE `id_group` = 1
AND id_shop = 1 LIMIT 1
 0.039 ms 1 /classes/ObjectModel.php:1729
187 
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE `to` BETWEEN '2026-04-28 00:00:00' AND '2026-04-28 23:59:59' LIMIT 1
 0.039 ms 1 /classes/SpecificPrice.php:381
281 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 36837
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.039 ms 0 /classes/SpecificPrice.php:259
529 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 6 AND `id_shop` = 1 LIMIT 1
 0.039 ms 1 /classes/module/Module.php:2132
542 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 75 AND `id_shop` = 1 LIMIT 1
 0.039 ms 1 /classes/module/Module.php:2132
366 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1021 LIMIT 1
 0.039 ms 1 /classes/Product.php:5659
530 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "ps_currencyselector" LIMIT 1
 0.039 ms 1 /classes/module/Module.php:2659
116 
SELECT SQL_NO_CACHE `name`
FROM `een_country_lang`
WHERE `id_lang` = 1
AND `id_country` = 8 LIMIT 1
 0.038 ms 1 /classes/Country.php:252
124 
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'FR' LIMIT 1
 0.038 ms 1 /classes/Country.php:194
126 
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'FR' LIMIT 1
 0.038 ms 1 /classes/Country.php:194
128 
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'FR' LIMIT 1
 0.038 ms 1 /classes/Country.php:194
237 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1022 LIMIT 1
 0.038 ms 1 /classes/Product.php:5659
433 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 25115 AND `id_group` = 1 LIMIT 1
 0.038 ms 0 /classes/GroupReduction.php:156
538 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 79 AND `id_shop` = 1 LIMIT 1
 0.038 ms 1 /classes/module/Module.php:2132
547 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 74 AND `id_shop` = 1 LIMIT 1
 0.038 ms 1 /classes/module/Module.php:2132
605 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 72 AND `id_shop` = 1 LIMIT 1
 0.038 ms 1 /classes/module/Module.php:2132
181 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 2750 LIMIT 1
 0.037 ms 1 /classes/Product.php:5659
188 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 647701
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.037 ms 0 /classes/SpecificPrice.php:259
238 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 40017
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.037 ms 0 /classes/SpecificPrice.php:259
378 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 30637
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.037 ms 0 /classes/SpecificPrice.php:259
204 
SELECT SQL_NO_CACHE `name`
FROM `een_manufacturer`
WHERE `id_manufacturer` = 1635
AND `active` = 1 LIMIT 1
 0.037 ms 1 /classes/Manufacturer.php:316
303 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 31007
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.037 ms 0 /classes/SpecificPrice.php:259
356 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 30840
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.037 ms 0 /classes/SpecificPrice.php:259
443 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 25114 AND `id_group` = 1 LIMIT 1
 0.037 ms 0 /classes/GroupReduction.php:156
52 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.036 ms 0 /classes/module/Module.php:2132
68 
SELECT SQL_NO_CACHE * FROM `een_image_type`
 0.036 ms 8 /classes/ImageType.php:161
292 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 31035
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.036 ms 0 /classes/SpecificPrice.php:259
59 
SELECT SQL_NO_CACHE `need_identification_number`
FROM `een_country`
WHERE `id_country` = 17 LIMIT 1
 0.035 ms 1 /classes/Country.php:405
203 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1014 LIMIT 1
 0.035 ms 1 /classes/Product.php:5659
242 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 40017 AND `id_group` = 1 LIMIT 1
 0.035 ms 0 /classes/GroupReduction.php:156
253 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 36979 AND `id_group` = 1 LIMIT 1
 0.035 ms 0 /classes/GroupReduction.php:156
323 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 443 LIMIT 1
 0.035 ms 1 /classes/Product.php:5659
346 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 30894
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.035 ms 0 /classes/SpecificPrice.php:259
382 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 30637 AND `id_group` = 1 LIMIT 1
 0.035 ms 0 /classes/GroupReduction.php:156
398 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 30633
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.035 ms 0 /classes/SpecificPrice.php:259
419 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 25116
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.035 ms 0 /classes/SpecificPrice.php:259
531 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 7 AND `id_shop` = 1 LIMIT 1
 0.035 ms 1 /classes/module/Module.php:2132
574 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "onepagecheckout" LIMIT 1
 0.035 ms 0 /classes/module/Module.php:2659
584 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "pwpaysoncheckout" LIMIT 1
 0.035 ms 0 /classes/module/Module.php:2659
592 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.035 ms 0 /classes/module/Module.php:2132
96 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_best_sale` (`id_tag` int(11) NOT NULL, `amount` CHAR(255) NOT NULL, `unit` CHAR(255) ,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255),  `id_shop` int(11) NOT NULL,  UNIQUE KEY `tag_best_sales` (`id_tag`, `id_product`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
 0.035 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
220 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 40048 AND `id_group` = 1 LIMIT 1
 0.035 ms 0 /classes/GroupReduction.php:156
313 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 31006
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.034 ms 0 /classes/SpecificPrice.php:259
335 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 411 LIMIT 1
 0.034 ms 1 /classes/Product.php:5659
377 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 2368 LIMIT 1
 0.034 ms 1 /classes/Product.php:5659
408 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 367 LIMIT 1
 0.034 ms 1 /classes/Product.php:5659
535 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 70 AND `id_shop` = 1 LIMIT 1
 0.034 ms 1 /classes/module/Module.php:2132
196 
SELECT SQL_NO_CACHE `reduction`
FROM `een_group`
WHERE `id_group` = 1 LIMIT 1
 0.034 ms 1 /classes/Group.php:154
248 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 435 LIMIT 1
 0.034 ms 1 /classes/Product.php:5659
336 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 30954
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.034 ms 0 /classes/SpecificPrice.php:259
532 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "iqitwishlist" LIMIT 1
 0.034 ms 1 /classes/module/Module.php:2659
249 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 36979
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.033 ms 0 /classes/SpecificPrice.php:259
259 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 2754 LIMIT 1
 0.033 ms 1 /classes/Product.php:5659
324 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 31000
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.033 ms 0 /classes/SpecificPrice.php:259
367 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 30649
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.033 ms 0 /classes/SpecificPrice.php:259
388 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 30635
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.033 ms 0 /classes/SpecificPrice.php:259
533 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 87 AND `id_shop` = 1 LIMIT 1
 0.033 ms 1 /classes/module/Module.php:2132
575 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.033 ms 0 /classes/module/Module.php:2132
205 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 40049
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.033 ms 0 /classes/SpecificPrice.php:259
226 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1011 LIMIT 1
 0.033 ms 1 /classes/Product.php:5659
302 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 2788 LIMIT 1
 0.033 ms 1 /classes/Product.php:5659
22 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.032 ms 0 /classes/module/Module.php:2132
215 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1013 LIMIT 1
 0.032 ms 1 /classes/Product.php:5659
291 
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1015 LIMIT 1
 0.032 ms 1 /classes/Product.php:5659
340 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 30954 AND `id_group` = 1 LIMIT 1
 0.032 ms 0 /classes/GroupReduction.php:156
371 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 30649 AND `id_group` = 1 LIMIT 1
 0.032 ms 0 /classes/GroupReduction.php:156
423 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 25116 AND `id_group` = 1 LIMIT 1
 0.032 ms 0 /classes/GroupReduction.php:156
260 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 36884
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.032 ms 0 /classes/SpecificPrice.php:259
270 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 36882
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.032 ms 0 /classes/SpecificPrice.php:259
285 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 36837 AND `id_group` = 1 LIMIT 1
 0.032 ms 0 /classes/GroupReduction.php:156
409 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 25139
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.032 ms 0 /classes/SpecificPrice.php:259
598 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 3 AND `id_shop` = 1 LIMIT 1
 0.032 ms 0 /classes/module/Module.php:2132
78 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_last_product_not_ordered` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `last_product_ordered` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
 0.031 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
216 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 40048
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.031 ms 0 /classes/SpecificPrice.php:259
227 
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 40046
ORDER BY `id_specific_price_priority` DESC LIMIT 1
 0.031 ms 0 /classes/SpecificPrice.php:259
296 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 31035 AND `id_group` = 1 LIMIT 1
 0.031 ms 0 /classes/GroupReduction.php:156
307 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 31007 AND `id_group` = 1 LIMIT 1
 0.031 ms 0 /classes/GroupReduction.php:156
350 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 30894 AND `id_group` = 1 LIMIT 1
 0.031 ms 0 /classes/GroupReduction.php:156
360 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 30840 AND `id_group` = 1 LIMIT 1
 0.031 ms 0 /classes/GroupReduction.php:156
392 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 30635 AND `id_group` = 1 LIMIT 1
 0.031 ms 0 /classes/GroupReduction.php:156
402 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 30633 AND `id_group` = 1 LIMIT 1
 0.031 ms 0 /classes/GroupReduction.php:156
413 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 25139 AND `id_group` = 1 LIMIT 1
 0.031 ms 0 /classes/GroupReduction.php:156
576 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "onepagecheckoutps" LIMIT 1
 0.031 ms 0 /classes/module/Module.php:2659
577 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.031 ms 0 /classes/module/Module.php:2132
578 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "steasycheckout" LIMIT 1
 0.031 ms 0 /classes/module/Module.php:2659
585 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.031 ms 0 /classes/module/Module.php:2132
66 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "gsnippetsreviews" LIMIT 1
 0.030 ms 0 /classes/module/Module.php:2659
209 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 40049 AND `id_group` = 1 LIMIT 1
 0.030 ms 0 /classes/GroupReduction.php:156
264 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 36884 AND `id_group` = 1 LIMIT 1
 0.030 ms 0 /classes/GroupReduction.php:156
579 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.030 ms 0 /classes/module/Module.php:2132
580 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "thecheckout" LIMIT 1
 0.030 ms 0 /classes/module/Module.php:2659
581 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.030 ms 0 /classes/module/Module.php:2132
587 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.030 ms 0 /classes/module/Module.php:2132
593 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "cdesigner" LIMIT 1
 0.030 ms 0 /classes/module/Module.php:2659
594 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.030 ms 0 /classes/module/Module.php:2132
274 
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 36882 AND `id_group` = 1 LIMIT 1
 0.030 ms 0 /classes/GroupReduction.php:156
72 
CREATE TABLE IF NOT EXISTS `een_gmcp_feeds` (`id_feed` int(11) NOT NULL AUTO_INCREMENT,`iso_lang` LONGTEXT NOT NULL,`iso_country` LONGTEXT NOT NULL,`iso_currency` LONGTEXT NOT NULL, `taxonomy` LONGTEXT NOT NULL, `id_shop` int(11) NOT NULL,`date_add` datetime NOT NULL,`date_upd` datetime NOT NULL,PRIMARY KEY (`id_feed`)) ENGINE=' . _MYSQL_ENGINE_ . ' DEFAULT CHARSET=utf8;
 0.029 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
595 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "configurator" LIMIT 1
 0.029 ms 0 /classes/module/Module.php:2659
583 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.029 ms 0 /classes/module/Module.php:2132
54 
CREATE TABLE IF NOT EXISTS `een_revolut_cards` (
`id` INT NOT NULL AUTO_INCREMENT,
`customer_id` INT NOT NULL ,
`card_number` VARCHAR(25) NOT NULL,
`expire_month` INT NOT NULL ,
`expire_year` INT NOT NULL ,
PRIMARY KEY (`id`)
) ENGINE=InnoDB;
 0.028 ms 1 /modules/revolutpayment/revolutpayment.php:331
582 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "idxropc" LIMIT 1
 0.028 ms 0 /classes/module/Module.php:2659
586 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "easycheckout" LIMIT 1
 0.028 ms 0 /classes/module/Module.php:2659
596 
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
 0.028 ms 0 /classes/module/Module.php:2132
102 
CREATE TABLE IF NOT EXISTS `een_gmcp_advanced_exclusion` (`id` int(11) NOT NULL AUTO_INCREMENT, `status` int(11) NOT NULL DEFAULT "1", `id_shop` int(11) NOT NULL DEFAULT "1", `name` char(255) NOT NULL, `type` char(255) NOT NULL, `exclusion_value` longtext NOT NULL, PRIMARY KEY (`id`)) ENGINE=InnoDB DEFAULT CHARSET=utf8 AUTO_INCREMENT=1;
 0.027 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
97 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_last_product_ordered` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `last_product_ordered` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
 0.027 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
101 
CREATE TABLE IF NOT EXISTS `een_gmcp_feeds` (`id_feed` int(11) NOT NULL AUTO_INCREMENT,`iso_lang` LONGTEXT NOT NULL,`iso_country` LONGTEXT NOT NULL,`iso_currency` LONGTEXT NOT NULL, `taxonomy` LONGTEXT NOT NULL, `id_shop` int(11) NOT NULL,`date_add` datetime NOT NULL,`date_upd` datetime NOT NULL,PRIMARY KEY (`id_feed`)) ENGINE=' . _MYSQL_ENGINE_ . ' DEFAULT CHARSET=utf8;
 0.027 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
67 
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "gremarketing" LIMIT 1
 0.026 ms 0 /classes/module/Module.php:2659
95 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_new_product` (`id_tag` int(11) NOT NULL,  `from_date` DATETIME, `id_product` int,  `id_shop` int(11) NOT NULL,  UNIQUE KEY `tag_new_product` (`id_tag`, `id_product`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
 0.026 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
100 
CREATE TABLE IF NOT EXISTS `een_gmcp_reporting` (`id_reporting` int(11) NOT NULL AUTO_INCREMENT,`iso_feed` LONGTEXT NOT NULL,    `reporting_content` LONGTEXT NOT NULL,`id_shop` int(11) NOT NULL,`date_add` datetime NOT NULL,`date_upd` datetime NOT NULL,PRIMARY KEY (`id_reporting`)) ENGINE=' . _MYSQL_ENGINE_ . ' DEFAULT CHARSET=utf8;
 0.026 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
73 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_price_range` (`id_tag` int(11) NOT NULL, `price_min` CHAR(255) NOT NULL, `price_max` CHAR(255), `id_product` CHAR(255), UNIQUE KEY `tag_price_range` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
 0.025 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
74 
CREATE TABLE IF NOT EXISTS `een_gmcp_tmp_rules`(`id` int(11) NOT NULL AUTO_INCREMENT, `id_shop` int(11) NOT NULL DEFAULT "1",`type` char(255) NOT NULL, `exclusion_values` longtext NOT NULL, PRIMARY KEY (`id`)) ENGINE=InnoDB DEFAULT CHARSET=utf8 AUTO_INCREMENT=1;
 0.025 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
80 
CREATE TABLE IF NOT EXISTS `een_gmcp_discount_association` (`id_association` int(11) NOT NULL AUTO_INCREMENT, `id_discount` int(11) NOT NULL, `id_product` int(11) NOT NULL, `channel` CHAR(120) NOT NULL DEFAULT "SHOPPING_ADS", PRIMARY KEY (`id_association`) ) ENGINE=MyISAM DEFAULT CHARSET=utf8;
 0.025 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
81 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags` (`id_tag` int(11) NOT NULL AUTO_INCREMENT, `id_shop` int(11) NOT NULL DEFAULT "1", `name` char(255) NOT NULL, `type` char(255) NOT NULL, `active` TINYINT NOT NULL, `position` INT NOT NULL, `end_date` DATE, PRIMARY KEY (`id_tag`)) ENGINE=MyISAM DEFAULT CHARSET=utf8 AUTO_INCREMENT=1 ;
 0.025 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
82 
CREATE TABLE IF NOT EXISTS `een_gmcp_taxonomy` (`id_taxonomy` int(11) NOT NULL AUTO_INCREMENT, `value` text NOT NULL, `lang` varchar(5) NOT NULL, PRIMARY KEY (`id_taxonomy`), KEY `lang` (`lang`), FULLTEXT KEY `ft_index` (`value`)) ENGINE=MyISAM DEFAULT CHARSET=utf8 AUTO_INCREMENT=1;
 0.025 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
93 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_features` (`id_tag` int(11) NOT NULL, `id_feature` int(11) NOT NULL, `id_shop` int(11) NOT NULL,  UNIQUE KEY `tag_feature` (`id_tag`, `id_feature`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
 0.025 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
94 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_categories` (`id_tag` int(11) NOT NULL, `id_category` int(11) NOT NULL, `id_shop` int(11) NOT NULL,  UNIQUE KEY `tag_feature` (`id_tag`, `id_category`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
 0.025 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
98 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_last_product_not_ordered` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `last_product_ordered` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
 0.025 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
103 
CREATE TABLE IF NOT EXISTS `een_gmcp_product_excluded` (`id_rule` int(11) NOT NULL DEFAULT "0",`id_product` int(11) NOT NULL DEFAULT "0", `id_product_attribute` int(11)) ENGINE=InnoDB DEFAULT CHARSET=utf8 AUTO_INCREMENT=1;
 0.025 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
104 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_price_range` (`id_tag` int(11) NOT NULL, `price_min` CHAR(255) NOT NULL, `price_max` CHAR(255), `id_product` CHAR(255), UNIQUE KEY `tag_price_range` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
 0.025 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
105 
CREATE TABLE IF NOT EXISTS `een_gmcp_tmp_rules`(`id` int(11) NOT NULL AUTO_INCREMENT, `id_shop` int(11) NOT NULL DEFAULT "1",`type` char(255) NOT NULL, `exclusion_values` longtext NOT NULL, PRIMARY KEY (`id`)) ENGINE=InnoDB DEFAULT CHARSET=utf8 AUTO_INCREMENT=1;
 0.025 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
79 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_last_product_not_ordered` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `last_product_ordered` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
 0.024 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
99 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_promotion` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `promotion` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
 0.024 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
75 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_last_product_ordered` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `last_product_ordered` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
 0.023 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
84 
CREATE TABLE IF NOT EXISTS `een_gmcp_taxonomy_categories` (`id_category` int(11) NOT NULL, `id_shop` int(3) NOT NULL DEFAULT "1", `txt_taxonomy` text NOT NULL, `lang` char(5) NOT NULL, KEY `id_category` (`id_category`,`lang`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
 0.023 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
86 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags` (`id_tag` int(11) NOT NULL AUTO_INCREMENT, `id_shop` int(11) NOT NULL DEFAULT "1", `name` char(255) NOT NULL, `type` char(255) NOT NULL, `active` TINYINT NOT NULL, `position` INT NOT NULL, `end_date` DATE, PRIMARY KEY (`id_tag`)) ENGINE=MyISAM DEFAULT CHARSET=utf8 AUTO_INCREMENT=1 ;
 0.023 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
89 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_products` (`id_tag` int(11) NOT NULL, `id_product` int(11) NOT NULL, product_name VARCHAR (255) NOT NULL, UNIQUE KEY `tag_product` (`id_tag`,`id_product`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
 0.023 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
76 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_promotion` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `promotion` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
 0.022 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
85 
CREATE TABLE IF NOT EXISTS `een_gmcp_brands` (`id_brands` int(11) NOT NULL, `id_shop` int(11) NOT NULL DEFAULT "1",  UNIQUE KEY `id_brands` (`id_brands`, `id_shop`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
 0.022 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
91 
CREATE TABLE IF NOT EXISTS `een_gmcp_features_by_cat` (`id_cat` int(11) NOT NULL DEFAULT '0', `id_shop` int(3) NOT NULL DEFAULT "1", `values` text NOT NULL, PRIMARY KEY (`id_cat`, `id_shop`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
 0.022 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
83 
CREATE TABLE IF NOT EXISTS `een_gmcp_categories` (`id_category` int(11) NOT NULL, `id_shop` int(11) NOT NULL DEFAULT "1",  UNIQUE KEY `id_category` (`id_category`, `id_shop`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
 0.022 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
90 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_suppliers` (`id_tag` int(11) NOT NULL, `id_supplier` int(11) NOT NULL, UNIQUE KEY `tag_supplier` (`id_tag`,`id_supplier`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
 0.022 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
92 
CREATE TABLE IF NOT EXISTS `een_gmcp_discount_association` (`id_association` int(11) NOT NULL AUTO_INCREMENT, `id_discount` int(11) NOT NULL, `id_product` int(11) NOT NULL, `channel` CHAR(120) NOT NULL DEFAULT "SHOPPING_ADS", PRIMARY KEY (`id_association`) ) ENGINE=MyISAM DEFAULT CHARSET=utf8;
 0.022 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
87 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_brands` (`id_tag` int(11) NOT NULL, `id_brand` int(11) NOT NULL, UNIQUE KEY `tag_brand` (`id_tag`,`id_brand`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
 0.021 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
88 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_cats` (`id_tag` int(11) NOT NULL, `id_category` int(11) NOT NULL, UNIQUE KEY `tag_cat` (`id_tag`,`id_category`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
 0.021 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
69 
BEGIN
 0.020 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:81
106 
COMMIT
 0.017 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:107
107 
BEGIN
 0.016 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:121

Doubles

28 queries 
SELECT `id_module` FROM `een_module_shop` WHERE `id_module` = XX AND `id_shop` = XX LIMIT XX
24 queries 
SELECT image_shop.`id_image`
                    FROM `een_image` i
                     INNER JOIN een_image_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
                    WHERE i.`id_product` = XX
                    AND image_shop.`cover` = XX LIMIT XX
24 queries 
SELECT name FROM een_category_lang WHERE id_shop = XX AND id_lang = XX AND id_category = XX LIMIT XX
24 queries 
SELECT *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = XX
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = XX
WHERE (a.`id_product` = XX) AND (b.`id_shop` = XX) LIMIT XX
24 queries 
				SELECT `priority`, `id_specific_price_priority`
				FROM `een_specific_price_priority`
				WHERE `id_product` = XX
				ORDER BY `id_specific_price_priority` DESC LIMIT XX
24 queries 
SELECT product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,XX) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = XX)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = XX)
WHERE (p.`id_product` = XX)
24 queries 
                            SELECT `id_tax_rules_group`
                            FROM `een_product_shop`
                            WHERE `id_product` = XX AND id_shop=XX LIMIT XX
24 queries 
			SELECT `reduction`
			FROM `een_product_group_reduction_cache`
			WHERE `id_product` = XX AND `id_group` = XX LIMIT XX
24 queries 
SELECT SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
24 queries 
SELECT
            COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), XX) as deep_quantity,
            COALESCE(SUM(first_level_quantity), XX) as quantity
          FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, XX as pack_quantity
          FROM `een_cart_product` cp
            WHERE cp.`id_product_attribute` = XX
            
            AND cp.`id_cart` = XX AND cp.`id_product` = XX UNION SELECT XX as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
          FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
            WHERE cp.`id_product_attribute` = XX
            
            AND cp.`id_cart` = XX AND p.`id_product_item` = XX AND (pr.`pack_stock_type` IN (XX,XX) OR (
            pr.`pack_stock_type` = XX
            AND XX = XX
        ))) as q LIMIT XX
24 queries 
                SELECT name, value, pf.id_feature, f.position, fvl.id_feature_value
                FROM een_feature_product pf
                LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = XX)
                LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = XX)
                LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = XX)
                 INNER JOIN een_feature_shop feature_shop
        ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = XX)
                WHERE pf.id_product = XX
                ORDER BY f.position ASC
24 queries 
            SELECT image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
            FROM `een_image` i
             INNER JOIN een_image_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
            LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = XX)
            WHERE i.`id_product` = XX
            ORDER BY `position`
24 queries 
SELECT `id_product_attribute`
            FROM `een_product_attribute`
            WHERE `id_product` = XX
24 queries 
SELECT pa.`id_product`, a.`color`, pac.`id_product_attribute`, XX qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
            FROM `een_product_attribute` pa
             INNER JOIN een_product_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX)
            JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
            JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
            JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = XX)
            JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
            WHERE pa.`id_product` IN (XX) AND ag.`is_color_group` = XX
            GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
            
            ORDER BY a.`position` ASC;
15 queries 
			SELECT cl.`link_rewrite`
			FROM `een_category_lang` cl
			WHERE `id_lang` = XX
			 AND cl.id_shop = XX 
			AND cl.`id_category` = XX LIMIT XX
14 queries 
			SELECT *, ( IF (`id_shop` = XX, XX, XX) +  IF (`id_country` = XX, XX, XX) +  IF (`id_currency` = XX, XX, XX) +  IF (`id_group` = XX, XX, XX) +  IF (`id_customer` = XX, XX, XX)) AS `score`
				FROM `een_specific_price`
				WHERE
                `id_shop` IN (XX, XX) AND
                `id_currency` IN (XX, XX) AND
                `id_country` IN (XX, XX) AND
                `id_group` IN (XX, XX) AND `id_product` IN (XX, XX) AND `id_customer` = XX AND `id_product_attribute` = XX AND `id_cart` = XX  AND (`from` = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' >= `from`) AND (`to` = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' <= `to`)
				AND IF(`from_quantity` > XX, `from_quantity`, XX) <= XX ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT XX
10 queries 
			SELECT *, ( IF (`id_shop` = XX, XX, XX) +  IF (`id_country` = XX, XX, XX) +  IF (`id_currency` = XX, XX, XX) +  IF (`id_group` = XX, XX, XX) +  IF (`id_customer` = XX, XX, XX)) AS `score`
				FROM `een_specific_price`
				WHERE
                `id_shop` IN (XX, XX) AND
                `id_currency` IN (XX, XX) AND
                `id_country` IN (XX, XX) AND
                `id_group` IN (XX, XX) AND `id_product` = XX AND `id_customer` = XX AND `id_product_attribute` = XX AND `id_cart` = XX  AND (`from` = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' >= `from`) AND (`to` = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' <= `to`)
				AND IF(`from_quantity` > XX, `from_quantity`, XX) <= XX ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT XX
9 queries 
SELECT *
FROM `een_category` a
LEFT JOIN `een_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = XX
LEFT JOIN `een_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = XX
WHERE (a.`id_category` = XX) AND (b.`id_shop` = XX) LIMIT XX
7 queries 
SELECT *
FROM `een_country` a
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = XX
WHERE (a.`id_country` = XX) LIMIT XX
7 queries 
SELECT *
							FROM `een_country_lang`
							WHERE `id_country` = XX
7 queries 
			SELECT `id_country`
			FROM `een_country`
			WHERE `iso_code` = 'FR' LIMIT XX
5 queries 
							SELECT `name`
							FROM `een_country_lang`
							WHERE `id_lang` = XX
							AND `id_country` = XX LIMIT XX
5 queries 
SELECT v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `een_feature_value` v LEFT JOIN `een_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = XX) LEFT JOIN `een_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = XX) WHERE v.`id_feature` = XX ORDER BY vl.`value` ASC
5 queries 
SELECT fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, XX) = sa.id_product_attribute AND sa.id_shop = XX  AND sa.id_shop_group = XX ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = XX AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=XX) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (XX, XX, XX, XX, XX, XX, XX, XX))) AND ps.id_shop='XX' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='XX' AND c.nleft>=XX AND c.nright<=XX GROUP BY p.id_product) p INNER JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_XX ON (p.id_product = fp_XX.id_product) WHERE ((fp.id_feature=XX)) AND ((fp_XX.id_feature_value IN (XX, XX, XX, XX, XX, XX, XX, XX))) GROUP BY fp.id_feature_value
3 queries 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_last_product_not_ordered` (`id_tag` int(XX) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(XX), UNIQUE KEY `last_product_ordered` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utfXX;
3 queries 
				SELECT tr.*
				FROM `een_tax_rule` tr
				JOIN `een_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
				WHERE trg.`active` = XX
				AND tr.`id_country` = XX
				AND tr.`id_tax_rules_group` = XX
				AND tr.`id_state` IN (XX, XX)
				AND ('XX' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
					OR (tr.`zipcode_to` = XX AND tr.`zipcode_from` IN(XX, 'XX')))
				ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
2 queries 
                SELECT m.`id_module`, m.`name`, ms.`id_module`as `mshop`
                FROM `een_module` m
                LEFT JOIN `een_module_shop` ms
                ON m.`id_module` = ms.`id_module`
                AND ms.`id_shop` = XX
2 queries 
SELECT `id_lang` FROM `een_lang`
                    WHERE `locale` = 'fr-fr'
                    OR `language_code` = 'fr-fr' LIMIT XX
2 queries 
		SELECT `id_category`
		FROM `een_category_shop`
		WHERE `id_category` = XX
		AND `id_shop` = XX LIMIT XX
2 queries 
BEGIN
2 queries 
SHOW TABLES LIKE "een_gmcp_XX"
2 queries 
CREATE TABLE IF NOT EXISTS `een_gmcp_reporting` (`id_reporting` int(XX) NOT NULL AUTO_INCREMENT,`iso_feed` LONGTEXT NOT NULL,    `reporting_content` LONGTEXT NOT NULL,`id_shop` int(XX) NOT NULL,`date_add` datetime NOT NULL,`date_upd` datetime NOT NULL,PRIMARY KEY (`id_reporting`)) ENGINE=' . _MYSQL_ENGINE_ . ' DEFAULT CHARSET=utfXX;
2 queries 
CREATE TABLE IF NOT EXISTS `een_gmcp_feeds` (`id_feed` int(XX) NOT NULL AUTO_INCREMENT,`iso_lang` LONGTEXT NOT NULL,`iso_country` LONGTEXT NOT NULL,`iso_currency` LONGTEXT NOT NULL, `taxonomy` LONGTEXT NOT NULL, `id_shop` int(XX) NOT NULL,`date_add` datetime NOT NULL,`date_upd` datetime NOT NULL,PRIMARY KEY (`id_feed`)) ENGINE=' . _MYSQL_ENGINE_ . ' DEFAULT CHARSET=utfXX;
2 queries 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_price_range` (`id_tag` int(XX) NOT NULL, `price_min` CHAR(XX) NOT NULL, `price_max` CHAR(XX), `id_product` CHAR(XX), UNIQUE KEY `tag_price_range` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utfXX;
2 queries 
CREATE TABLE IF NOT EXISTS `een_gmcp_tmp_rules`(`id` int(XX) NOT NULL AUTO_INCREMENT, `id_shop` int(XX) NOT NULL DEFAULT "XX",`type` char(XX) NOT NULL, `exclusion_values` longtext NOT NULL, PRIMARY KEY (`id`)) ENGINE=InnoDB DEFAULT CHARSET=utfXX AUTO_INCREMENT=XX;
2 queries 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_last_product_ordered` (`id_tag` int(XX) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(XX), UNIQUE KEY `last_product_ordered` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utfXX;
2 queries 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_promotion` (`id_tag` int(XX) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(XX), UNIQUE KEY `promotion` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utfXX;
2 queries 
CREATE TABLE IF NOT EXISTS `een_gmcp_discount_association` (`id_association` int(XX) NOT NULL AUTO_INCREMENT, `id_discount` int(XX) NOT NULL, `id_product` int(XX) NOT NULL, `channel` CHAR(XX) NOT NULL DEFAULT "SHOPPING_ADS", PRIMARY KEY (`id_association`) ) ENGINE=MyISAM DEFAULT CHARSET=utfXX;
2 queries 
CREATE TABLE IF NOT EXISTS `een_gmcp_tags` (`id_tag` int(XX) NOT NULL AUTO_INCREMENT, `id_shop` int(XX) NOT NULL DEFAULT "XX", `name` char(XX) NOT NULL, `type` char(XX) NOT NULL, `active` TINYINT NOT NULL, `position` INT NOT NULL, `end_date` DATE, PRIMARY KEY (`id_tag`)) ENGINE=MyISAM DEFAULT CHARSET=utfXX AUTO_INCREMENT=XX ;
2 queries 
COMMIT
2 queries 
SELECT XX FROM `een_cart_rule` WHERE ((date_to >= "XX-XX-XX XX:XX:XX" AND date_to <= "XX-XX-XX XX:XX:XX") OR (date_from >= "XX-XX-XX XX:XX:XX" AND date_from <= "XX-XX-XX XX:XX:XX") OR (date_from < "XX-XX-XX XX:XX:XX" AND date_to > "XX-XX-XX XX:XX:XX")) AND `id_customer` IN (XX,XX) LIMIT XX
2 queries 
SELECT product_id as id_product, COUNT(product_id) AS sales
            FROM `een_order_detail`
            WHERE product_id IN (
                SELECT id_product
                FROM `een_category_product`
                LEFT JOIN een_product USING (id_product)
                WHERE id_category = XX
                AND active = XX
            )
            GROUP BY product_id
            ORDER BY sales DESC LIMIT XX
2 queries 
SELECT id_category, id_parent, level_depth, name, is_root_category, active FROM een_category LEFT JOIN een_category_lang AS cl USING (id_category) LEFT JOIN een_category_shop AS cs USING (id_category) WHERE cs.id_shop = XX AND cl.id_lang = XX ORDER BY `een_category`.`id_parent` ASC, `een_category`.`id_category` ASC

Tables stress

90 product
88 product_shop
65 product_attribute
56 feature_product
55 category_lang
49 cart_product
48 image
48 image_shop
48 product_attribute_shop
43 stock_available
41 product_attribute_combination
35 module
32 category
31 module_shop
30 specific_price
29 feature_value_lang
25 feature
25 feature_shop
25 feature_lang
25 product_lang
24 specific_price_priority
24 product_group_reduction_cache
24 pack
24 image_lang
24 attribute
24 attribute_lang
24 attribute_group
21 country
20 category_product
18 category_group
17 category_shop
14 product_sale
13 country_lang
12 currency
8 country_shop
7 hook
5 lang
5 feature_value
5 layered_indexable_feature_value_lang_value
4 shop_url
4 shop
4 lang_shop
4 currency_shop
4 gmcp_feeds
4 cart_rule
3 hook_alias
3 tax_rule
3 tax_rules_group
2 shop_group
2 configuration
2 hook_module
2 currency_lang
2 group
2 group_shop
2 image_type
2 orders
2 iqit_elementor_category
2 cart_rule_lang
2 order_detail
1 memcached_servers
1 configuration_lang
1 module_group
1 meta
1 meta_lang
1 hook_module_exceptions
1 group_lang
1 address_format
1 required_field
1 revslider_sliders
1 gmcp_discount_association
1 gmcp_tags
1 layered_category
1 layered_indexable_feature
1 layered_indexable_feature_lang_value
1 layered_filter_block
1 layered_price_index
1 manufacturer
1 feature_flag
1 order_cart_rule
1 iqit_elementor_category_shop
1 ganalytics_data

ObjectModel instances

Name Instances Source
Product 26 /classes/Link.php:113 (__construct) [id: 647701]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 647701]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 40049]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 40048]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 40046]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 40017]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 36979]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 36884]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 36882]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 36837]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 31035]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 31007]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 31006]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 31000]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 30954]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 30894]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 30840]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 30649]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 30637]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 30635]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 30633]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 25139]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 25116]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 25115]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 25114]
/classes/Link.php:113 (__construct) [id: 647701]
Category 17 /controllers/front/listing/CategoryController.php:78 (__construct) [id: 1000]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 1030]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 1031]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 5735]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 5728]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 5723]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 1027]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 411]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 426]
/classes/Meta.php:380 (__construct) [id: 1000]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/modules/ps_facetedsearch/src/Product/Search.php:365 (__construct) [id: 1000]
/modules/ps_facetedsearch/src/Filters/Block.php:157 (__construct) [id: 1000]
/modules/facebookconversiontrackingplus/facebookconversiontrackingplus.php:3085 (__construct) [id: 1000]
/classes/Link.php:402 (__construct) [id: 1000]
/modules/facebookconversiontrackingplus/classes/ConversionApi.php:518 (__construct) [id: 1000]
Country 15 /config/config.inc.php:148 (__construct) [id: 8]
/classes/controller/FrontController.php:946 (__construct) [id: 21]
/classes/AddressFormat.php:404 (__construct) [id: 17]
/classes/controller/FrontController.php:1779 (__construct) [id: 17]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 8]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 8]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 8]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 8]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 8]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 8]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 8]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 19]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 4]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 3]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 186]
Language 13 /config/config.inc.php:213 (__construct) [id: 1]
/classes/Tools.php:560 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
Currency 9 /src/Adapter/Currency/CurrencyDataProvider.php:101 (__construct) [id: 1]
/classes/Tools.php:690 (getCurrencyInstance) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:213 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:213 (__construct) [id: 0]
/modules/gmerchantcenterpro/lib/moduleTools.php:213 (__construct) [id: 0]
/modules/gmerchantcenterpro/lib/moduleTools.php:213 (__construct) [id: 0]
/modules/gmerchantcenterpro/lib/moduleTools.php:213 (__construct) [id: 0]
/modules/gmerchantcenterpro/lib/moduleTools.php:213 (__construct) [id: 0]
/modules/gmerchantcenterpro/lib/moduleTools.php:213 (__construct) [id: 0]
Address 4 /classes/shop/Shop.php:486 (__construct) [id: ]
/classes/Product.php:3694 (initialize) [id: ]
/classes/Product.php:3804 (__construct) [id: ]
/classes/Product.php:5964 (__construct) [id: ]
Cart 2 /classes/controller/FrontController.php:467 (__construct) [id: ]
/classes/controller/FrontController.php:541 (__construct) [id: ]
Shop 1 /config/config.inc.php:119 (initialize) [id: 1]
ShopGroup 1 /classes/shop/Shop.php:561 (__construct) [id: 1]
Customer 1 /config/config.inc.php:266 (__construct) [id: ]
Group 1 /classes/Cart.php:249 (getCurrent) [id: 1]
Gender 1 /classes/controller/FrontController.php:1702 (__construct) [id: 0]
Risk 1 /classes/controller/FrontController.php:1705 (__construct) [id: ]
AddressFormat 1 /classes/controller/FrontController.php:1773 (generateAddress) [id: ]
State 1 /classes/controller/FrontController.php:1778 (__construct) [id: 0]
IqitElementorCategory 1 /modules/iqitelementor/iqitelementor.php:784 (isJustElementor) [id: ]

Included Files

# Filename
0 /index.php
1 /config/config.inc.php
2 /config/defines.inc.php
3 /config/autoload.php
4 /vendor/autoload.php
5 /vendor/composer/autoload_real.php
6 /vendor/composer/platform_check.php
7 /vendor/composer/ClassLoader.php
8 /vendor/composer/include_paths.php
9 /vendor/composer/autoload_static.php
10 /vendor/symfony/polyfill-php72/bootstrap.php
11 /vendor/symfony/polyfill-mbstring/bootstrap.php
12 /vendor/symfony/polyfill-mbstring/bootstrap80.php
13 /vendor/symfony/polyfill-intl-normalizer/bootstrap.php
14 /vendor/symfony/polyfill-intl-normalizer/bootstrap80.php
15 /vendor/symfony/polyfill-intl-idn/bootstrap.php
16 /vendor/symfony/deprecation-contracts/function.php
17 /vendor/ralouphie/getallheaders/src/getallheaders.php
18 /vendor/symfony/polyfill-ctype/bootstrap.php
19 /vendor/symfony/polyfill-ctype/bootstrap80.php
20 /vendor/symfony/polyfill-php80/bootstrap.php
21 /vendor/guzzlehttp/promises/src/functions_include.php
22 /vendor/guzzlehttp/promises/src/functions.php
23 /vendor/guzzlehttp/guzzle/src/functions_include.php
24 /vendor/guzzlehttp/guzzle/src/functions.php
25 /vendor/symfony/polyfill-iconv/bootstrap.php
26 /vendor/ezyang/htmlpurifier/library/HTMLPurifier.composer.php
27 /vendor/jakeasmith/http_build_url/src/http_build_url.php
28 /vendor/lcobucci/jwt/compat/class-aliases.php
29 /vendor/lcobucci/jwt/src/Token.php
30 /vendor/lcobucci/jwt/src/Signature.php
31 /vendor/lcobucci/jwt/compat/json-exception-polyfill.php
32 /vendor/lcobucci/jwt/compat/lcobucci-clock-polyfill.php
33 /vendor/swiftmailer/swiftmailer/lib/swift_required.php
34 /vendor/swiftmailer/swiftmailer/lib/classes/Swift.php
35 /vendor/symfony/polyfill-intl-icu/bootstrap.php
36 /vendor/symfony/polyfill-php73/bootstrap.php
37 /vendor/symfony/polyfill-php81/bootstrap.php
38 /vendor/api-platform/core/src/deprecation.php
39 /vendor/api-platform/core/src/Api/FilterInterface.php
40 /vendor/api-platform/core/src/Api/ResourceClassResolverInterface.php
41 /vendor/api-platform/core/src/deprecated_interfaces.php
42 /vendor/api-platform/core/src/Metadata/Property/Factory/PropertyNameCollectionFactoryInterface.php
43 /vendor/api-platform/core/src/Metadata/Resource/Factory/ResourceNameCollectionFactoryInterface.php
44 /vendor/api-platform/core/src/Metadata/Extractor/ResourceExtractorInterface.php
45 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/DateFilterInterface.php
46 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/ExistsFilterInterface.php
47 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/OrderFilterInterface.php
48 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/RangeFilterInterface.php
49 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/SearchFilterInterface.php
50 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationCollectionExtensionInterface.php
51 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationItemExtensionInterface.php
52 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultCollectionExtensionInterface.php
53 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultItemExtensionInterface.php
54 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Filter/FilterInterface.php
55 /vendor/api-platform/core/src/Doctrine/Orm/QueryAwareInterface.php
56 /vendor/api-platform/core/src/Doctrine/Orm/Util/QueryNameGeneratorInterface.php
57 /vendor/api-platform/core/src/Elasticsearch/Metadata/Document/Factory/DocumentMetadataFactoryInterface.php
58 /vendor/api-platform/core/src/Symfony/Validator/ValidationGroupsGeneratorInterface.php
59 /vendor/api-platform/core/src/Symfony/Validator/Exception/ConstraintViolationListAwareExceptionInterface.php
60 /vendor/api-platform/core/src/Exception/ExceptionInterface.php
61 /vendor/api-platform/core/src/Core/Bridge/Symfony/Validator/Metadata/Property/Restriction/PropertySchemaRestrictionMetadataInterface.php
62 /vendor/api-platform/core/src/State/Pagination/PaginatorInterface.php
63 /vendor/api-platform/core/src/State/Pagination/PartialPaginatorInterface.php
64 /vendor/api-platform/core/src/Documentation/DocumentationInterface.php
65 /vendor/api-platform/core/src/JsonLd/AnonymousContextBuilderInterface.php
66 /vendor/api-platform/core/src/JsonLd/ContextBuilderInterface.php
67 /vendor/api-platform/core/src/Core/JsonSchema/SchemaFactoryInterface.php
68 /vendor/api-platform/core/src/JsonSchema/TypeFactoryInterface.php
69 /vendor/api-platform/core/src/OpenApi/Factory/OpenApiFactoryInterface.php
70 /vendor/api-platform/core/src/PathResolver/OperationPathResolverInterface.php
71 /vendor/api-platform/core/src/Symfony/Security/ResourceAccessCheckerInterface.php
72 /vendor/api-platform/core/src/Serializer/Filter/FilterInterface.php
73 /vendor/api-platform/core/src/Serializer/SerializerContextBuilderInterface.php
74 /vendor/api-platform/core/src/Validator/ValidatorInterface.php
75 /vendor/api-platform/core/src/Api/UrlGeneratorInterface.php
76 /vendor/api-platform/core/src/GraphQl/ExecutorInterface.php
77 /vendor/api-platform/core/src/GraphQl/Error/ErrorHandlerInterface.php
78 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ValidateStageInterface.php
79 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ReadStageInterface.php
80 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityPostDenormalizeStageInterface.php
81 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityStageInterface.php
82 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/WriteStageInterface.php
83 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SerializeStageInterface.php
84 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/DeserializeStageInterface.php
85 /vendor/api-platform/core/src/GraphQl/Resolver/QueryItemResolverInterface.php
86 /vendor/api-platform/core/src/GraphQl/Resolver/QueryCollectionResolverInterface.php
87 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Factory/ResolverFactoryInterface.php
88 /vendor/api-platform/core/src/GraphQl/Resolver/MutationResolverInterface.php
89 /vendor/api-platform/core/src/Core/GraphQl/Subscription/MercureSubscriptionIriGeneratorInterface.php
90 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionIdentifierGeneratorInterface.php
91 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionManagerInterface.php
92 /vendor/api-platform/core/src/Core/GraphQl/Serializer/SerializerContextBuilderInterface.php
93 /vendor/api-platform/core/src/GraphQl/Type/TypesFactoryInterface.php
94 /vendor/api-platform/core/src/GraphQl/Type/Definition/TypeInterface.php
95 /vendor/api-platform/core/src/GraphQl/Type/TypesContainerInterface.php
96 /vendor/psr/container/src/ContainerInterface.php
97 /vendor/api-platform/core/src/Operation/PathSegmentNameGeneratorInterface.php
98 /vendor/ircmaxell/password-compat/lib/password.php
99 /vendor/martinlindhe/php-mb-helpers/src/mb_helpers.php
100 /vendor/prestashop/laminas-code-lts/polyfill/ReflectionEnumPolyfill.php
101 /src/Core/Version.php
102 /config/alias.php
103 /vendor/prestashop/autoload/src/PrestashopAutoload.php
104 /vendor/prestashop/autoload/src/LegacyClassLoader.php
105 /vendor/symfony/symfony/src/Symfony/Component/Filesystem/Filesystem.php
106 /vendor/prestashop/autoload/src/Autoloader.php
107 /config/bootstrap.php
108 /src/Core/ContainerBuilder.php
109 /src/Core/Foundation/IoC/Container.php
110 /src/Adapter/ServiceLocator.php
111 /var/cache/prod/appParameters.php
114 /var/cache/prod/class_index.php
115 /classes/controller/Controller.php
117 /classes/ObjectModel.php
118 /src/Core/Foundation/Database/EntityInterface.php
120 /classes/db/Db.php
122 /classes/Hook.php
124 /classes/module/Module.php
125 /src/Core/Module/Legacy/ModuleInterface.php
127 /classes/Tools.php
128 /classes/Context.php
129 /classes/shop/Shop.php
130 /src/Core/Security/PasswordGenerator.php
131 /classes/db/DbPDO.php
132 /classes/AddressFormat.php
133 /classes/cache/Cache.php
134 /classes/cache/CacheMemcached.php
135 /config/db_slave_server.inc.php
136 /src/Core/Security/Hashing.php
137 /classes/Configuration.php
138 /classes/Validate.php
139 /src/Adapter/EntityMapper.php
140 /classes/db/DbQuery.php
141 /src/Core/Addon/Theme/ThemeManagerBuilder.php
142 /vendor/psr/log/Psr/Log/NullLogger.php
143 /vendor/psr/log/Psr/Log/AbstractLogger.php
144 /vendor/psr/log/Psr/Log/LoggerInterface.php
145 /src/Adapter/Configuration.php
146 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ParameterBag.php
147 /src/Core/Domain/Configuration/ShopConfigurationInterface.php
148 /src/Core/ConfigurationInterface.php
149 /src/Core/Addon/Theme/ThemeRepository.php
150 /src/Core/Addon/AddonRepositoryInterface.php
151 /src/Core/Domain/Shop/ValueObject/ShopConstraint.php
152 /src/Core/Addon/Theme/Theme.php
153 /src/Core/Addon/AddonInterface.php
154 /src/Core/Util/ArrayFinder.php
155 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccess.php
156 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorBuilder.php
157 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessor.php
158 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorInterface.php
159 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPath.php
160 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPathInterface.php
161 /config/defines_uri.inc.php
162 /classes/Language.php
163 /src/Core/Language/LanguageInterface.php
164 /classes/Country.php
165 /classes/PrestaShopCollection.php
166 /classes/shop/ShopGroup.php
167 /classes/Cookie.php
168 /classes/PhpEncryption.php
169 /classes/PhpEncryptionEngine.php
170 /vendor/defuse/php-encryption/src/Key.php
171 /vendor/defuse/php-encryption/src/Encoding.php
172 /vendor/defuse/php-encryption/src/Core.php
173 /vendor/defuse/php-encryption/src/Crypto.php
174 /vendor/defuse/php-encryption/src/KeyOrPassword.php
175 /vendor/defuse/php-encryption/src/RuntimeTests.php
176 /vendor/defuse/php-encryption/src/DerivedKeys.php
177 /vendor/defuse/php-encryption/src/Exception/WrongKeyOrModifiedCiphertextException.php
178 /vendor/defuse/php-encryption/src/Exception/CryptoException.php
179 /src/Core/Session/SessionHandler.php
180 /src/Core/Session/SessionHandlerInterface.php
181 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Session.php
182 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBag.php
183 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBagInterface.php
184 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagInterface.php
185 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBag.php
186 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBagInterface.php
187 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagProxy.php
188 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionInterface.php
189 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/PhpBridgeSessionStorage.php
190 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/NativeSessionStorage.php
191 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/MetadataBag.php
192 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/StrictSessionHandler.php
193 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/AbstractSessionHandler.php
194 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/SessionHandlerProxy.php
195 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/AbstractProxy.php
196 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/SessionStorageInterface.php
197 /config/smarty.config.inc.php
198 /vendor/smarty/smarty/libs/Smarty.class.php
199 /vendor/smarty/smarty/libs/functions.php
200 /vendor/smarty/smarty/libs/Autoloader.php
201 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_data.php
202 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_extension_handler.php
203 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php
204 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php
205 /vendor/smarty/smarty/libs/sysplugins/smarty_resource.php
206 /vendor/smarty/smarty/libs/sysplugins/smarty_variable.php
207 /vendor/smarty/smarty/libs/sysplugins/smarty_template_source.php
208 /vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php
209 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_resource_file.php
210 /config/smartyfront.config.inc.php
211 /classes/Smarty/SmartyResourceModule.php
212 /vendor/smarty/smarty/libs/sysplugins/smarty_resource_custom.php
213 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerresource.php
214 /classes/Smarty/SmartyResourceParent.php
215 /classes/Smarty/SmartyLazyRegister.php
216 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerplugin.php
217 /vendor/smarty/smarty/libs/plugins/modifier.truncate.php
218 /classes/Customer.php
219 /classes/Group.php
220 /override/classes/Link.php
221 /classes/Link.php
222 /classes/shop/ShopUrl.php
223 /override/classes/Dispatcher.php
224 /classes/Dispatcher.php
225 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Request.php
226 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeader.php
227 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeaderItem.php
228 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/FileBag.php
229 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderBag.php
230 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderUtils.php
231 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ServerBag.php
232 /src/Adapter/SymfonyContainer.php
233 /vendor/mobiledetect/mobiledetectlib/Mobile_Detect.php
234 /modules/ph_simpleblog/ph_simpleblog.php
235 /modules/ph_simpleblog/assets/phpthumb/ThumbLib.inc.php
236 /modules/ph_simpleblog/assets/phpthumb/PhpThumb.inc.php
237 /modules/ph_simpleblog/assets/phpthumb/ThumbBase.inc.php
238 /modules/ph_simpleblog/assets/phpthumb/GdThumb.inc.php
239 /modules/ph_simpleblog/vendor/autoload.php
240 /modules/ph_simpleblog/vendor/composer/autoload_real.php
241 /modules/ph_simpleblog/vendor/composer/platform_check.php
242 /modules/ph_simpleblog/vendor/composer/autoload_static.php
243 /modules/ph_simpleblog/models/SimpleBlogCategory.php
244 /modules/ph_simpleblog/models/SimpleBlogPost.php
245 /modules/ph_simpleblog/models/SimpleBlogPostType.php
246 /modules/ph_simpleblog/models/SimpleBlogPostImage.php
247 /modules/ph_simpleblog/models/SimpleBlogTag.php
248 /modules/ph_simpleblog/models/SimpleBlogComment.php
249 /modules/ph_simpleblog/models/SimpleBlogPostAuthor.php
250 /modules/ph_simpleblog/classes/SimpleBlogHelper.php
251 /modules/ph_simpleblog/classes/BlogPostsFinder.php
252 /modules/ph_simpleblog/controllers/front/default_list.php
253 /classes/controller/ModuleFrontController.php
254 /override/classes/controller/FrontController.php
255 /classes/controller/FrontController.php
256 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_createdata.php
257 /vendor/smarty/smarty/libs/sysplugins/smarty_data.php
258 /classes/Translate.php
259 /modules/ph_simpleblog/translations/fr.php
260 /src/PrestaShopBundle/Translation/TranslatorComponent.php
261 /vendor/symfony/symfony/src/Symfony/Component/Translation/Translator.php
262 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorInterface.php
263 /vendor/symfony/contracts/Translation/LocaleAwareInterface.php
264 /vendor/symfony/contracts/Translation/TranslatorInterface.php
265 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorBagInterface.php
266 /src/PrestaShopBundle/Translation/PrestaShopTranslatorTrait.php
267 /src/PrestaShopBundle/Translation/TranslatorLanguageTrait.php
268 /src/PrestaShopBundle/Translation/TranslatorInterface.php
269 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatter.php
270 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatter.php
271 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatterInterface.php
272 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatterInterface.php
273 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/ChoiceMessageFormatterInterface.php
274 /vendor/symfony/symfony/src/Symfony/Component/Translation/IdentityTranslator.php
275 /vendor/symfony/contracts/Translation/TranslatorTrait.php
276 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactory.php
277 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactoryInterface.php
278 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCache.php
279 /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerConfigCache.php
280 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheInterface.php
281 /var/cache/prod/translations/catalogue.fr-FR.NXhscRe.php
282 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogue.php
283 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogueInterface.php
284 /vendor/symfony/symfony/src/Symfony/Component/Translation/MetadataAwareInterface.php
285 /controllers/front/listing/CategoryController.php
286 /classes/controller/ProductListingFrontController.php
287 /classes/controller/ProductPresentingFrontController.php
288 /src/Adapter/Presenter/Object/ObjectPresenter.php
289 /src/Adapter/Presenter/PresenterInterface.php
290 /src/Adapter/Presenter/Cart/CartPresenter.php
291 /src/Adapter/Image/ImageRetriever.php
292 /classes/tax/TaxConfiguration.php
293 /classes/Smarty/TemplateFinder.php
294 /classes/assets/StylesheetManager.php
295 /classes/assets/AbstractAssetManager.php
296 /src/Adapter/Assets/AssetUrlGeneratorTrait.php
297 /classes/assets/JavascriptManager.php
298 /classes/assets/CccReducer.php
299 /modules/iqitthemeeditor/iqitthemeeditor.php
300 /modules/iqitthemeeditor/src/IqitSmartyModifiers.php
301 /modules/iqitthemeeditor/translations/fr.php
302 /classes/Category.php
303 /classes/webservice/WebserviceRequest.php
304 /src/Adapter/ContainerBuilder.php
305 /src/Adapter/Environment.php
306 /src/Core/EnvironmentInterface.php
307 /vendor/symfony/symfony/src/Symfony/Component/Cache/DoctrineProvider.php
308 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/CacheProvider.php
309 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Cache.php
310 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/FlushableCache.php
311 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/ClearableCache.php
312 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiOperationCache.php
313 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiGetCache.php
314 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiDeleteCache.php
315 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiPutCache.php
316 /vendor/symfony/symfony/src/Symfony/Component/Cache/PruneableInterface.php
317 /vendor/symfony/symfony/src/Symfony/Component/Cache/ResettableInterface.php
318 /vendor/symfony/contracts/Service/ResetInterface.php
319 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/ArrayAdapter.php
320 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ArrayTrait.php
321 /vendor/psr/log/Psr/Log/LoggerAwareTrait.php
322 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AdapterInterface.php
323 /vendor/symfony/symfony/src/Symfony/Component/Cache/CacheItem.php
324 /vendor/symfony/contracts/Cache/ItemInterface.php
325 /vendor/psr/cache/src/CacheItemInterface.php
326 /vendor/psr/cache/src/CacheItemPoolInterface.php
327 /vendor/symfony/contracts/Cache/CacheInterface.php
328 /vendor/psr/log/Psr/Log/LoggerAwareInterface.php
329 /vendor/doctrine/orm/lib/Doctrine/ORM/Tools/Setup.php
330 /vendor/doctrine/deprecations/lib/Doctrine/Deprecations/Deprecation.php
331 /vendor/doctrine/orm/lib/Doctrine/ORM/Configuration.php
332 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Configuration.php
333 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/CacheAdapter.php
334 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/DoctrineProvider.php
335 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationReader.php
336 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Reader.php
337 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationRegistry.php
338 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/DoctrineAnnotations.php
339 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Annotation.php
340 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Entity.php
341 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embeddable.php
342 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embedded.php
343 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/MappedSuperclass.php
344 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/InheritanceType.php
345 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorColumn.php
346 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorMap.php
347 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Id.php
348 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/GeneratedValue.php
349 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Version.php
350 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumn.php
351 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumns.php
352 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Column.php
353 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToOne.php
354 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToMany.php
355 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToOne.php
356 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToMany.php
357 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Table.php
358 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/UniqueConstraint.php
359 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Index.php
360 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinTable.php
361 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SequenceGenerator.php
362 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/CustomIdGenerator.php
363 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ChangeTrackingPolicy.php
364 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OrderBy.php
365 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQueries.php
366 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQuery.php
367 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/HasLifecycleCallbacks.php
368 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PrePersist.php
369 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostPersist.php
370 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreUpdate.php
371 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostUpdate.php
372 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreRemove.php
373 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostRemove.php
374 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostLoad.php
375 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreFlush.php
376 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/FieldResult.php
377 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ColumnResult.php
378 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityResult.php
379 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQuery.php
380 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQueries.php
381 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMapping.php
382 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMappings.php
383 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverride.php
384 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverrides.php
385 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverride.php
386 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverrides.php
387 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityListeners.php
388 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Cache.php
389 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/SimpleAnnotationReader.php
390 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocParser.php
391 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocLexer.php
392 /vendor/doctrine/lexer/lib/Doctrine/Common/Lexer/AbstractLexer.php
393 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Target.php
394 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/AnnotationDriver.php
395 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/CompatibilityAnnotationDriver.php
396 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/MappingDriver.php
397 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/ColocatedMappingDriver.php
398 /var/cache/prod/FrontContainer.php
399 /src/Adapter/Container/LegacyContainer.php
400 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Container.php
401 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/RewindableGenerator.php
402 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/ServiceLocator.php
403 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ServiceLocator.php
404 /vendor/symfony/contracts/Service/ServiceLocatorTrait.php
405 /vendor/psr/container/src/ContainerExceptionInterface.php
406 /vendor/psr/container/src/NotFoundExceptionInterface.php
407 /vendor/symfony/contracts/Service/ServiceProviderInterface.php
408 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ResettableContainerInterface.php
409 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ContainerInterface.php
410 /src/Adapter/Container/LegacyContainerInterface.php
411 /modules/ps_categorytree/vendor/autoload.php
412 /modules/ps_categorytree/vendor/composer/autoload_real.php
413 /modules/ps_categorytree/vendor/composer/platform_check.php
414 /modules/ps_categorytree/vendor/composer/autoload_static.php
415 /modules/ps_facetedsearch/vendor/autoload.php
416 /modules/ps_facetedsearch/vendor/composer/autoload_real.php
417 /modules/ps_facetedsearch/vendor/composer/platform_check.php
418 /modules/ps_facetedsearch/vendor/composer/autoload_static.php
419 /modules/contactform/vendor/autoload.php
420 /modules/contactform/vendor/composer/autoload_real.php
421 /modules/contactform/vendor/composer/platform_check.php
422 /modules/contactform/vendor/composer/autoload_static.php
423 /modules/ps_sharebuttons/vendor/autoload.php
424 /modules/ps_sharebuttons/vendor/composer/autoload_real.php
425 /modules/ps_sharebuttons/vendor/composer/platform_check.php
426 /modules/ps_sharebuttons/vendor/composer/autoload_static.php
427 /modules/gsitemap/vendor/autoload.php
428 /modules/gsitemap/vendor/composer/autoload_real.php
429 /modules/gsitemap/vendor/composer/platform_check.php
430 /modules/gsitemap/vendor/composer/autoload_static.php
431 /modules/ps_crossselling/vendor/autoload.php
432 /modules/ps_crossselling/vendor/composer/autoload_real.php
433 /modules/ps_crossselling/vendor/composer/platform_check.php
434 /modules/ps_crossselling/vendor/composer/autoload_static.php
435 /modules/ps_themecusto/vendor/autoload.php
436 /modules/ps_themecusto/vendor/composer/autoload_real.php
437 /modules/ps_themecusto/vendor/composer/platform_check.php
438 /modules/ps_themecusto/vendor/composer/autoload_static.php
439 /modules/ps_supplierlist/vendor/autoload.php
440 /modules/ps_supplierlist/vendor/composer/autoload_real.php
441 /modules/ps_supplierlist/vendor/composer/platform_check.php
442 /modules/ps_supplierlist/vendor/composer/autoload_static.php
443 /modules/ps_googleanalytics/vendor/autoload.php
444 /modules/ps_googleanalytics/vendor/composer/autoload_real.php
445 /modules/ps_googleanalytics/vendor/composer/platform_check.php
446 /modules/ps_googleanalytics/vendor/composer/autoload_static.php
447 /modules/statssearch/vendor/autoload.php
448 /modules/statssearch/vendor/composer/autoload_real.php
449 /modules/statssearch/vendor/composer/platform_check.php
450 /modules/statssearch/vendor/composer/autoload_static.php
451 /modules/ps_faviconnotificationbo/vendor/autoload.php
452 /modules/ps_faviconnotificationbo/vendor/composer/autoload_real.php
453 /modules/ps_faviconnotificationbo/vendor/composer/platform_check.php
454 /modules/ps_faviconnotificationbo/vendor/composer/autoload_static.php
455 /modules/ps_categoryproducts/vendor/autoload.php
456 /modules/ps_categoryproducts/vendor/composer/autoload_real.php
457 /modules/ps_categoryproducts/vendor/composer/platform_check.php
458 /modules/ps_categoryproducts/vendor/composer/autoload_static.php
459 /modules/ps_wirepayment/vendor/autoload.php
460 /modules/ps_wirepayment/vendor/composer/autoload_real.php
461 /modules/ps_wirepayment/vendor/composer/platform_check.php
462 /modules/ps_wirepayment/vendor/composer/autoload_static.php
463 /modules/statsregistrations/vendor/autoload.php
464 /modules/statsregistrations/vendor/composer/autoload_real.php
465 /modules/statsregistrations/vendor/composer/platform_check.php
466 /modules/statsregistrations/vendor/composer/autoload_static.php
467 /modules/ps_distributionapiclient/vendor/autoload.php
468 /modules/ps_distributionapiclient/vendor/composer/autoload_real.php
469 /modules/ps_distributionapiclient/vendor/composer/platform_check.php
470 /modules/ps_distributionapiclient/vendor/composer/autoload_static.php
471 /modules/ps_distributionapiclient/vendor/symfony/polyfill-intl-grapheme/bootstrap.php
472 /modules/ps_distributionapiclient/vendor/symfony/string/Resources/functions.php
473 /modules/ps_emailalerts/vendor/autoload.php
474 /modules/ps_emailalerts/vendor/composer/autoload_real.php
475 /modules/ps_emailalerts/vendor/composer/platform_check.php
476 /modules/ps_emailalerts/vendor/composer/autoload_static.php
477 /modules/ps_brandlist/vendor/autoload.php
478 /modules/ps_brandlist/vendor/composer/autoload_real.php
479 /modules/ps_brandlist/vendor/composer/platform_check.php
480 /modules/ps_brandlist/vendor/composer/autoload_static.php
481 /modules/ps_viewedproduct/vendor/autoload.php
482 /modules/ps_viewedproduct/vendor/composer/autoload_real.php
483 /modules/ps_viewedproduct/vendor/composer/platform_check.php
484 /modules/ps_viewedproduct/vendor/composer/autoload_static.php
485 /modules/iqitsociallogin/vendor/autoload.php
486 /modules/iqitsociallogin/vendor/composer/autoload_real.php
487 /modules/iqitsociallogin/vendor/composer/platform_check.php
488 /modules/iqitsociallogin/vendor/composer/autoload_static.php
489 /modules/gmerchantcenterpro/vendor/autoload.php
490 /modules/gmerchantcenterpro/vendor/composer/autoload_real.php
491 /modules/gmerchantcenterpro/vendor/composer/platform_check.php
492 /modules/gmerchantcenterpro/vendor/composer/autoload_static.php
493 /modules/wizardai/vendor/autoload.php
494 /modules/wizardai/vendor/composer/autoload_real.php
495 /modules/wizardai/vendor/composer/platform_check.php
496 /modules/wizardai/vendor/composer/autoload_static.php
497 /modules/wizardai/vendor/clue/stream-filter/src/functions_include.php
498 /modules/wizardai/vendor/clue/stream-filter/src/functions.php
499 /modules/wizardai/vendor/guzzlehttp/psr7/src/functions_include.php
500 /modules/wizardai/vendor/guzzlehttp/psr7/src/functions.php
501 /modules/wizardai/vendor/php-http/message/src/filters.php
502 /modules/wizardai/vendor/symfony/polyfill-apcu/bootstrap.php
503 /modules/stripe_official/vendor/autoload.php
504 /modules/stripe_official/vendor/composer/autoload_real.php
505 /modules/stripe_official/vendor/composer/platform_check.php
506 /modules/stripe_official/vendor/composer/autoload_static.php
507 /modules/vivawalletsmartcheckout/vendor/autoload.php
508 /modules/vivawalletsmartcheckout/vendor/composer/autoload_real.php
509 /modules/vivawalletsmartcheckout/vendor/composer/autoload_static.php
510 /modules/autoupgrade/vendor/autoload.php
511 /modules/autoupgrade/vendor/composer/autoload_real.php
512 /modules/autoupgrade/vendor/composer/autoload_static.php
513 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment.php
514 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Client.php
515 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer.php
516 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/QueueConsumer.php
517 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/File.php
518 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/ForkCurl.php
519 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/LibCurl.php
520 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/Socket.php
521 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Version.php
522 /src/Core/Localization/Locale/Repository.php
523 /src/Core/Localization/Locale/RepositoryInterface.php
524 /src/Core/Localization/CLDR/LocaleRepository.php
525 /src/Core/Localization/CLDR/LocaleDataSource.php
526 /src/Core/Localization/CLDR/DataLayer/LocaleCache.php
527 /src/Core/Data/Layer/AbstractDataLayer.php
528 /src/Core/Localization/CLDR/LocaleDataLayerInterface.php
529 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/FilesystemAdapter.php
530 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AbstractAdapter.php
531 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractAdapterTrait.php
532 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractTrait.php
533 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ContractsTrait.php
534 /vendor/symfony/contracts/Cache/CacheTrait.php
535 /vendor/psr/cache/src/InvalidArgumentException.php
536 /vendor/psr/cache/src/CacheException.php
537 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemTrait.php
538 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemCommonTrait.php
539 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/DefaultMarshaller.php
540 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/MarshallerInterface.php
541 /src/Core/Localization/CLDR/DataLayer/LocaleReference.php
542 /src/Core/Localization/CLDR/Reader.php
543 /src/Core/Localization/CLDR/ReaderInterface.php
544 /src/Core/Localization/Currency/Repository.php
545 /src/Core/Localization/Currency/RepositoryInterface.php
546 /src/Core/Localization/Currency/CurrencyDataSource.php
547 /src/Core/Localization/Currency/DataSourceInterface.php
548 /src/Core/Localization/Currency/DataLayer/CurrencyCache.php
549 /src/Core/Localization/Currency/CurrencyDataLayerInterface.php
550 /src/Core/Localization/Currency/DataLayer/CurrencyDatabase.php
551 /src/Adapter/Currency/CurrencyDataProvider.php
552 /src/Core/Currency/CurrencyDataProviderInterface.php
553 /src/Adapter/LegacyContext.php
554 /src/Adapter/Tools.php
555 /src/Core/Localization/Currency/DataLayer/CurrencyReference.php
556 /src/Core/Localization/Currency/DataLayer/CurrencyInstalled.php
557 /vendor/prestashop/decimal/src/Operation/Rounding.php
558 /src/Core/Localization/Locale.php
559 /src/Core/Localization/LocaleInterface.php
560 /src/Core/Localization/Specification/Price.php
561 /src/Core/Localization/Specification/Number.php
562 /src/Core/Localization/Specification/NumberInterface.php
563 /src/Core/Localization/Specification/Factory.php
564 /src/Core/Localization/CLDR/LocaleData.php
565 /src/Core/Localization/CLDR/NumberSymbolsData.php
566 /src/Core/Localization/CLDR/CurrencyData.php
567 /src/Core/Localization/CLDR/Locale.php
568 /src/Core/Localization/CLDR/LocaleInterface.php
569 /src/Core/Localization/Specification/NumberSymbolList.php
570 /classes/Currency.php
571 /src/Core/Localization/Currency/LocalizedCurrencyId.php
572 /src/Core/Localization/Currency/CurrencyData.php
573 /src/Core/Localization/Currency/CurrencyCollection.php
574 /src/Core/Localization/Currency.php
575 /src/Core/Localization/CurrencyInterface.php
576 /src/Core/Localization/Specification/NumberCollection.php
577 /src/Core/Localization/Number/Formatter.php
578 /classes/Cart.php
579 /src/Adapter/AddressFactory.php
580 /override/classes/CartRule.php
581 /classes/CartRule.php
582 /classes/Product.php
583 /src/Core/Domain/Product/ValueObject/RedirectType.php
584 /src/Core/Util/DateTime/DateTime.php
585 /src/Core/Domain/Product/Stock/ValueObject/OutOfStockType.php
586 /src/Core/Domain/Product/Pack/ValueObject/PackStockType.php
587 /src/Core/Domain/Product/ValueObject/ProductType.php
588 /src/Core/Domain/Product/ValueObject/Reference.php
589 /src/Core/Domain/Product/ValueObject/Ean13.php
590 /src/Core/Domain/Product/ValueObject/Isbn.php
591 /src/Core/Domain/Product/ValueObject/Upc.php
592 /src/Core/Domain/Product/ProductSettings.php
593 /src/Core/Domain/Shop/ValueObject/ShopId.php
594 /src/Core/Domain/Shop/ValueObject/ShopIdInterface.php
595 /modules/ps_emailalerts/ps_emailalerts.php
596 /modules/ps_emailalerts/MailAlert.php
597 /src/PrestaShopBundle/Translation/DomainNormalizer.php
598 /modules/facebookconversiontrackingplus/facebookconversiontrackingplus.php
599 /modules/facebookconversiontrackingplus/classes/autoload.php
600 /modules/facebookconversiontrackingplus/translations/fr.php
601 /modules/facebookconversiontrackingplus/classes/ConversionApi.php
602 /modules/facebookconversiontrackingplus/classes/PixelTools.php
603 /modules/facebookconversiontrackingplus/classes/IpGeolocation.php
604 /src/Core/Security/OpenSsl/OpenSSL.php
605 /src/Core/Security/OpenSsl/OpenSSLInterface.php
606 /modules/facebookconversiontrackingplus/classes/SmartForm.php
607 /override/classes/Media.php
608 /classes/Media.php
609 /modules/revolutpayment/revolutpayment.php
610 /modules/revolutpayment/classes/RevolutApi.php
611 /modules/revolutpayment/classes/RevolutDatabaseHelper.php
612 /modules/revolutpayment/classes/RevolutPRBSettingsHelper.php
613 /modules/revolutpayment/classes/RevolutApplePayOnBoardingHelper.php
614 /modules/revolutpayment/classes/RevolutModuleHelper.php
615 /classes/PaymentModule.php
616 /modules/revolutpayment/translations/fr.php
617 /src/Adapter/Presenter/Cart/CartLazyArray.php
618 /src/Adapter/Presenter/AbstractLazyArray.php
619 /src/Adapter/Product/PriceFormatter.php
620 /src/Core/Util/Inflector.php
621 /vendor/doctrine/inflector/lib/Doctrine/Inflector/InflectorFactory.php
622 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Language.php
623 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/InflectorFactory.php
624 /vendor/doctrine/inflector/lib/Doctrine/Inflector/GenericLanguageInflectorFactory.php
625 /vendor/doctrine/inflector/lib/Doctrine/Inflector/LanguageInflectorFactory.php
626 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Rules.php
627 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Ruleset.php
628 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformations.php
629 /vendor/doctrine/inflector/lib/Doctrine/Inflector/WordInflector.php
630 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Inflectible.php
631 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformation.php
632 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Pattern.php
633 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Patterns.php
634 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Uninflected.php
635 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitutions.php
636 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitution.php
637 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Word.php
638 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Inflector.php
639 /vendor/doctrine/inflector/lib/Doctrine/Inflector/CachedWordInflector.php
640 /vendor/doctrine/inflector/lib/Doctrine/Inflector/RulesetInflector.php
641 /classes/Gender.php
642 /classes/Risk.php
643 /classes/Meta.php
644 /modules/revsliderprestashop/revsliderprestashop.php
645 /modules/revsliderprestashop/rev-loader.php
646 /modules/revsliderprestashop/includes/revslider_db.class.php
647 /modules/revsliderprestashop/includes/data.class.php
648 /modules/revsliderprestashop/includes/functions.class.php
649 /modules/revsliderprestashop/includes/em-integration.class.php
650 /modules/revsliderprestashop/includes/cssparser.class.php
651 /modules/revsliderprestashop/includes/woocommerce.class.php
652 /modules/revsliderprestashop/includes/wpml.class.php
653 /modules/revsliderprestashop/includes/colorpicker.class.php
654 /modules/revsliderprestashop/includes/navigation.class.php
655 /modules/revsliderprestashop/includes/object-library.class.php
656 /modules/revsliderprestashop/admin/includes/loadbalancer.class.php
657 /modules/revsliderprestashop/admin/includes/plugin-update.class.php
658 /modules/revsliderprestashop/includes/extension.class.php
659 /modules/revsliderprestashop/includes/favorite.class.php
660 /modules/revsliderprestashop/includes/aq-resizer.class.php
661 /modules/revsliderprestashop/includes/external-sources.class.php
662 /modules/revsliderprestashop/includes/page-template.class.php
663 /modules/revsliderprestashop/includes/slider.class.php
664 /modules/revsliderprestashop/includes/slide.class.php
665 /modules/revsliderprestashop/includes/output.class.php
666 /modules/revsliderprestashop/public/revslider-front.class.php
667 /modules/revsliderprestashop/includes/backwards.php
668 /modules/revsliderprestashop/admin/includes/class-pclzip.php
669 /modules/revsliderprestashop/admin/includes/license.class.php
670 /modules/revsliderprestashop/admin/includes/addons.class.php
671 /modules/revsliderprestashop/admin/includes/template.class.php
672 /modules/revsliderprestashop/admin/includes/functions-admin.class.php
673 /modules/revsliderprestashop/admin/includes/folder.class.php
674 /modules/revsliderprestashop/admin/includes/import.class.php
675 /modules/revsliderprestashop/admin/includes/export.class.php
676 /modules/revsliderprestashop/admin/includes/export-html.class.php
677 /modules/revsliderprestashop/admin/includes/newsletter.class.php
678 /modules/revsliderprestashop/admin/revslider-admin.class.php
679 /modules/revsliderprestashop/includes/update.class.php
680 /modules/revsliderprestashop/includes/resize-imag.php
681 /modules/revsliderprestashop/translations/fr.php
682 /classes/Address.php
683 /classes/ImageType.php
684 /classes/State.php
685 /src/Core/Security/PasswordPolicyConfiguration.php
686 /src/Core/Configuration/DataConfigurationInterface.php
687 /src/Core/Filter/FrontEndObject/MainFilter.php
688 /src/Core/Filter/FilterInterface.php
689 /src/Core/Filter/FrontEndObject/CartFilter.php
690 /src/Core/Filter/HashMapWhitelistFilter.php
691 /src/Core/Filter/CollectionFilter.php
692 /src/Core/Filter/FrontEndObject/ProductFilter.php
693 /src/Core/Filter/FrontEndObject/EmbeddedAttributesFilter.php
694 /src/Core/Filter/FrontEndObject/CustomerFilter.php
695 /src/Core/Filter/FrontEndObject/ShopFilter.php
696 /src/Core/Filter/FrontEndObject/ConfigurationFilter.php
697 /modules/ps_shoppingcart/ps_shoppingcart.php
698 /src/Core/Module/WidgetInterface.php
699 /modules/ps_googleanalytics/ps_googleanalytics.php
700 /modules/ps_googleanalytics/classes/Hook/HookDisplayHeader.php
701 /modules/ps_googleanalytics/classes/Hook/HookInterface.php
702 /vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php
703 /var/cache/prod/smarty/compile/warehouse/ee/78/8a/ee788a7ffa4b95e0a488ef6dc4b9f3c8b40ce111_2.file.ps_googleanalytics.tpl.php
704 /vendor/smarty/smarty/libs/plugins/modifier.escape.php
705 /modules/iqitcompare/iqitcompare.php
706 /modules/iqitcompare/translations/fr.php
707 /modules/iqitcontactpage/iqitcontactpage.php
708 /modules/iqitcontactpage/translations/fr.php
709 /modules/iqitcookielaw/iqitcookielaw.php
710 /modules/iqitcookielaw/translations/fr.php
711 /modules/iqitcountdown/iqitcountdown.php
712 /modules/iqitcountdown/translations/fr.php
713 /modules/iqitelementor/iqitelementor.php
714 /modules/iqitelementor/src/IqitElementorLanding.php
715 /modules/iqitelementor/src/IqitElementorTemplate.php
716 /modules/iqitelementor/src/IqitElementorProduct.php
717 /modules/iqitelementor/src/IqitElementorCategory.php
718 /modules/iqitelementor/src/IqitElementorContent.php
719 /modules/iqitelementor/src/iqitElementorWpHelper.php
720 /modules/iqitelementor/includes/plugin-elementor.php
721 /modules/iqitelementor/src/widgets/IqitElementorWidget_Brands.php
722 /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsList.php
723 /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsListTabs.php
724 /modules/iqitelementor/src/widgets/IqitElementorWidget_Modules.php
725 /modules/iqitelementor/src/widgets/IqitElementorWidget_CustomTpl.php
726 /modules/iqitelementor/src/widgets/IqitElementorWidget_Menu.php
727 /modules/iqitelementor/src/widgets/IqitElementorWidget_RevolutionSlider.php
728 /modules/iqitelementor/src/widgets/IqitElementorWidget_Newsletter.php
729 /modules/iqitelementor/src/widgets/IqitElementorWidget_Blog.php
730 /modules/iqitelementor/src/widgets/IqitElementorWidget_Search.php
731 /modules/iqitelementor/src/widgets/IqitElementorWidget_Links.php
732 /modules/iqitelementor/src/widgets/IqitElementorWidget_ContactForm.php
733 /modules/iqitelementor/translations/fr.php
734 /modules/iqitfreedeliverycount/iqitfreedeliverycount.php
735 /modules/iqitfreedeliverycount/translations/fr.php
736 /modules/iqitmegamenu/iqitmegamenu.php
737 /modules/iqitmegamenu/models/IqitMenuTab.php
738 /modules/iqitmegamenu/models/IqitMenuHtml.php
739 /modules/iqitmegamenu/models/IqitMenuLinks.php
740 /modules/iqitmegamenu/translations/fr.php
741 /modules/iqitsizecharts/iqitsizecharts.php
742 /modules/iqitsizecharts/src/IqitSizeCharts.php
743 /modules/iqitsizecharts/translations/fr.php
744 /modules/iqitwishlist/iqitwishlist.php
745 /modules/iqitwishlist/src/IqitWishlistProduct.php
746 /modules/iqitwishlist/translations/fr.php
747 /modules/iqitextendedproduct/iqitextendedproduct.php
748 /modules/iqitextendedproduct/src/IqitThreeSixty.php
749 /modules/iqitextendedproduct/src/IqitProductVideo.php
750 /modules/iqitextendedproduct/translations/fr.php
751 /classes/assets/PrestashopAssetsLibraries.php
752 /modules/iqitsociallogin/iqitsociallogin.php
753 /modules/iqitsociallogin/translations/fr.php
754 /modules/gmerchantcenterpro/gmerchantcenterpro.php
755 /modules/gmerchantcenterpro/translations/fr.php
756 /modules/gmerchantcenterpro/lib/moduleTools.php
757 /modules/gmerchantcenterpro/conf/moduleConfiguration.php
758 /modules/gmerchantcenterpro/lib/moduleUpdate.php
759 /modules/gmerchantcenterpro/lib/install/installController.php
760 /modules/gmerchantcenterpro/lib/install/installSql.php
761 /modules/gmerchantcenterpro/lib/install/installInterface.php
762 /modules/gmerchantcenterpro/models/Feeds.php
763 /modules/gmerchantcenterpro/lib/hook/hookController.php
764 /modules/gmerchantcenterpro/lib/hook/hookDisplay.php
765 /modules/gmerchantcenterpro/lib/hook/hookBase.php
766 /modules/gmerchantcenterpro/lib/dao/moduleDao.php
767 /var/cache/prod/smarty/compile/warehouse/f7/5f/75/f75f75b788ebecd0995da205f357ac74693f8076_2.file.header.tpl.php
768 /modules/stripe_official/stripe_official.php
769 /modules/stripe_official/vendor/stripe/stripe-php/lib/Event.php
770 /modules/stripe_official/vendor/stripe/stripe-php/lib/ApiResource.php
771 /modules/stripe_official/vendor/stripe/stripe-php/lib/StripeObject.php
772 /modules/stripe_official/vendor/stripe/stripe-php/lib/ApiOperations/Request.php
773 /modules/stripe_official/classes/services/PrestashopTranslationService.php
774 /src/Adapter/Localization/LegacyTranslator.php
775 /modules/stripe_official/smarty/plugins/modifier.stripelreplace.php
776 /modules/stripe_official/vendor/stripe/stripe-php/lib/Stripe.php
777 /modules/stripe_official/vendor/stripe/stripe-php/lib/Util/ApiVersion.php
778 /modules/wizardai/vendor/prestashop/module-lib-service-container/src/DependencyInjection/ServiceContainer.php
779 /modules/stripe_official/classes/services/StripeDisplayHeaderService.php
780 /modules/abandonedcart/abandonedcart.php
781 /modules/abandonedcart/classes/abandonedcart_core.php
782 /modules/abandonedcart/translations/fr.php
783 /var/cache/prod/smarty/compile/warehouse/7f/09/a0/7f09a045a9b3f592faaac1a3835665419330db11_2.file.abandonedcart_front.tpl.php
784 /modules/vivawalletsmartcheckout/vivawalletsmartcheckout.php
785 /modules/vivawalletsmartcheckout/src/Helpers/Config.php
786 /modules/vivawalletsmartcheckout/config/app.php
787 /modules/vivawalletsmartcheckout/src/Helpers/General.php
788 /modules/vivawalletsmartcheckout/translations/fr.php
789 /modules/vivawalletsmartcheckout/vendor/vivawallet/vivawallet-php/lib/Application.php
790 /src/Core/Product/Search/ProductSearchContext.php
791 /src/Core/Product/Search/ProductSearchQuery.php
792 /src/Core/Product/Search/SortOrder.php
793 /modules/ps_facetedsearch/ps_facetedsearch.php
794 /modules/ps_facetedsearch/src/HookDispatcher.php
795 /modules/ps_facetedsearch/src/Hook/Attribute.php
796 /modules/ps_facetedsearch/src/Hook/AbstractHook.php
797 /modules/ps_facetedsearch/src/Hook/AttributeGroup.php
798 /modules/ps_facetedsearch/src/Hook/Category.php
799 /modules/ps_facetedsearch/src/Hook/Configuration.php
800 /modules/ps_facetedsearch/src/Hook/Design.php
801 /modules/ps_facetedsearch/src/Hook/Feature.php
802 /modules/ps_facetedsearch/src/Form/Feature/FormModifier.php
803 /modules/ps_facetedsearch/src/Form/Feature/FormDataProvider.php
804 /modules/ps_facetedsearch/src/Hook/FeatureValue.php
805 /modules/ps_facetedsearch/src/Form/FeatureValue/FormModifier.php
806 /modules/ps_facetedsearch/src/Form/FeatureValue/FormDataProvider.php
807 /modules/ps_facetedsearch/src/Hook/Product.php
808 /modules/ps_facetedsearch/src/Hook/ProductSearch.php
809 /modules/ps_facetedsearch/src/Hook/SpecificPrice.php
810 /modules/ps_facetedsearch/src/Filters/Provider.php
811 /modules/ps_facetedsearch/src/URLSerializer.php
812 /modules/ps_facetedsearch/src/Filters/DataAccessor.php
813 /modules/ps_facetedsearch/src/Product/SearchProvider.php
814 /src/Core/Product/Search/FacetsRendererInterface.php
815 /src/Core/Product/Search/ProductSearchProviderInterface.php
816 /modules/ps_facetedsearch/src/Filters/Converter.php
817 /modules/ps_facetedsearch/src/Product/SearchFactory.php
818 /src/Core/Product/Search/ProductSearchResult.php
819 /modules/ps_facetedsearch/src/Product/Search.php
820 /modules/ps_facetedsearch/src/Adapter/MySQL.php
821 /modules/ps_facetedsearch/src/Adapter/AbstractAdapter.php
822 /modules/ps_facetedsearch/src/Adapter/InterfaceAdapter.php
823 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ArrayCollection.php
824 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Collection.php
825 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ReadableCollection.php
826 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Selectable.php
827 /modules/ps_facetedsearch/src/Filters/Products.php
828 /classes/stock/StockAvailable.php
829 /modules/ps_facetedsearch/src/Filters/Block.php
830 /modules/ps_facetedsearch/src/Definition/Availability.php
831 /src/Core/Product/Search/Facet.php
832 /src/Core/Product/Search/Filter.php
833 /vendor/prestashop/decimal/src/DecimalNumber.php
834 /vendor/prestashop/decimal/src/Builder.php
835 /src/Core/Product/Search/FacetCollection.php
836 /classes/ProductAssembler.php
837 /classes/Combination.php
838 /classes/tax/Tax.php
839 /classes/SpecificPrice.php
840 /classes/tax/TaxManagerFactory.php
841 /classes/tax/TaxRulesTaxManager.php
842 /classes/tax/TaxManagerInterface.php
843 /classes/tax/TaxCalculator.php
844 /classes/GroupReduction.php
845 /src/Core/Localization/CLDR/ComputingPrecision.php
846 /src/Core/Localization/CLDR/ComputingPrecisionInterface.php
847 /classes/Pack.php
848 /override/classes/order/Order.php
849 /classes/order/Order.php
850 /classes/Feature.php
851 /classes/Manufacturer.php
852 /classes/ProductPresenterFactory.php
853 /src/Adapter/Presenter/Product/ProductListingPresenter.php
854 /src/Adapter/Presenter/Product/ProductPresenter.php
855 /src/Adapter/Product/ProductColorsRetriever.php
856 /src/Adapter/HookManager.php
857 /src/Core/Product/ProductPresentationSettings.php
858 /src/Adapter/Presenter/Product/ProductListingLazyArray.php
859 /src/Adapter/Presenter/Product/ProductLazyArray.php
860 /classes/Image.php
861 /src/Core/Image/ImageFormatConfiguration.php
862 /src/Core/Image/ImageFormatConfigurationInterface.php
863 /classes/FeatureFlag.php
864 /src/Core/FeatureFlag/FeatureFlagSettings.php
865 /vendor/prestashop/decimal/src/Operation/Multiplication.php
866 /vendor/prestashop/decimal/src/Operation/Addition.php
867 /var/cache/prod/smarty/compile/warehouse/d4/1d/65/d41d65d76b9471b5d365fe06cf1737c89a53af9f_2.module.ps_facetedsearchviewstemplatesfrontcatalogfacets.tpl.php
868 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_block.php
869 /vendor/smarty/smarty/libs/plugins/modifier.count.php
870 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php
871 /var/cache/prod/smarty/compile/warehouse/fb/ea/98/fbea98a84e509d7477392fb3e2519b1e908ae1d0_2.module.ps_facetedsearchviewstemplatesfrontcatalogfacetsdropdown.tpl.php
872 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_foreach.php
873 /var/cache/prod/smarty/compile/warehouse/2e/80/73/2e807335546cfa2360c36327ac89dd2fcb054379_2.module.ps_facetedsearchviewstemplatesfrontcatalogactivefilters.tpl.php
874 /src/Core/Product/Search/Pagination.php
875 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/a7/2d/dc/a72ddcc3457e523238167bfb787364e010571602_2.file.category.tpl.php
876 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_capture.php
877 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/90/cf/46/90cf4679dc49439c314d4747bbab91e7cd883211_2.file.product-list.tpl.php
878 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/20/1d/59/201d594b12ddb0579e97d2d00a38f32349d7f8e2_2.file.layout-full-width.tpl.php
879 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/9f/c0/0d/9fc00de9dab18af4bad561c5978e37a5cf7ba8dc_2.file.layout-both-columns.tpl.php
880 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/cb/45/38/cb4538e80db186323bd2c849a93c3a874eb9fa44_2.file.helpers.tpl.php
881 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_tplfunction.php
882 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/a3/5d/99/a35d9996c0259409d557b9de6f17182667bd08c0_2.file.head.tpl.php
883 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/d8/66/63/d8666378896e3199131756b2a049789ce82f9145_2.file.head-jsonld.tpl.php
884 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/8e/7c/ff/8e7cff5cfb78f6670e25ee2a2964eb6ccbe1b9d5_2.file.product-list-jsonld.tpl.php
885 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/b5/08/e2/b508e285f88ade9f85c8711af34aa86844c85366_2.file.pagination-seo.tpl.php
886 /vendor/smarty/smarty/libs/plugins/modifier.replace.php
887 /vendor/smarty/smarty/libs/plugins/shared.mb_str_replace.php
888 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/52/ed/5b/52ed5bf4088d07f918e31ad1872568dff1a15122_2.file.stylesheets.tpl.php
889 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/2a/77/40/2a7740ed942475bcc06c5e40d5346b6b574f1441_2.file.javascript.tpl.php
890 /classes/ProductDownload.php
891 /src/Core/Cart/Calculator.php
892 /src/Core/Cart/CartRowCollection.php
893 /src/Core/Cart/Fees.php
894 /src/Core/Cart/AmountImmutable.php
895 /src/Core/Cart/CartRuleCollection.php
896 /src/Core/Cart/CartRuleCalculator.php
897 /src/Adapter/Product/PriceCalculator.php
898 /src/Core/Cart/CartRow.php
899 /vendor/symfony/symfony/src/Symfony/Component/Translation/PluralizationRules.php
900 /src/Core/Util/String/StringModifier.php
901 /src/Core/Util/String/StringModifierInterface.php
902 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/05/ac/4e/05ac4e59da39afc94ba29fd4c5bed100b6b3da19_2.file.product-activation.tpl.php
903 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/05/4d/41/054d41abc5a541ea4fd30d63caa94ec106d2993b_2.file.header.tpl.php
904 /modules/iqitlinksmanager/iqitlinksmanager.php
905 /modules/iqitlinksmanager/src/IqitLinkBlockRepository.php
906 /modules/iqitlinksmanager/src/IqitLinkBlock.php
907 /modules/iqitlinksmanager/src/IqitLinkBlockPresenter.php
908 /modules/iqitlinksmanager/translations/fr.php
909 /vendor/smarty/smarty/libs/sysplugins/smarty_template_cached.php
910 /vendor/smarty/smarty/libs/sysplugins/smarty_cacheresource.php
911 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_cacheresource_file.php
912 /var/cache/prod/smarty/cache/iqitlinksmanager/1/1/1/21/displayNav1/warehouse/a9/f2/c1/a9f2c1869604c8c628073c46891a26fcf1453e27.iqitlinksmanagerviewstemplateshookiqitlinksmanager.tpl.php
913 /modules/ps_languageselector/ps_languageselector.php
914 /modules/ps_currencyselector/ps_currencyselector.php
915 /var/cache/prod/smarty/compile/warehouse/73/27/77/73277702161b17505d668b28b8368941cf42c568_2.module.iqitwishlistviewstemplateshookdisplaynav.tpl.php
916 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/03/c2/a5/03c2a55aa51a9b7d61e7f129a111606f12475287_2.file.header-3.tpl.php
917 /modules/iqitsearch/iqitsearch.php
918 /modules/iqitsearch/translations/fr.php
919 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_gettemplatevars.php
920 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/d9/9b/94/d99b947421dcff226f28b1d6cb674c91f17399db_2.module.iqitsearchviewstemplateshookiqitsearchbtn.tpl.php
921 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/46/29/db/4629dbb3c4efa13c090c633dc2e46e5f2b42bed3_2.module.iqitsearchviewstemplateshooksearchbar.tpl.php
922 /modules/ps_customersignin/ps_customersignin.php
923 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/72/be/19/72be192e406191c1cad554abe284e159adeb4234_2.module.ps_customersigninps_customersigninbtn.tpl.php
924 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/b4/a4/76/b4a476e0a8201677b298f7c0f8ca1ac698e1bac3_2.module.ps_shoppingcartps_shoppingcartbtn.tpl.php
925 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/35/65/5e/35655e6409b6198f29dd6e732ef9598dec599880_2.module.ps_shoppingcartps_shoppingcart.tpl.php
926 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/f6/e9/f2/f6e9f2b1680a466582d2199d038efe2cfa3a83f7_2.module.ps_shoppingcartps_shoppingcartcontent.tpl.php
927 /var/cache/prod/smarty/cache/iqitmegamenu/index/1/1/1/21/warehouse/70/ca/47/70ca47640f8f16a0dd1dc3b1fce177bbeed38257.iqitmegamenuviewstemplateshookhorizontal.tpl.php
928 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/ce/2d/19/ce2d19cd13f5f27943d104183b745be20e3618a6_2.file.mobile-header-1.tpl.php
929 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/7a/30/38/7a3038780284d52e9fcd7a66e51e5b86a166106b_2.module.iqitsearchviewstemplateshooksearchbarmobile.tpl.php
930 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/be/ee/e6/beeee6f3d87613010f8af1cabc4c4562f8cf600a_2.module.ps_customersigninps_customersigninmobile.tpl.php
931 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/d4/e1/57/d4e1571b6b210795247564db06deb17061778b51_2.module.ps_shoppingcartps_shoppingcartmqty.tpl.php
932 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/28/b8/a6/28b8a6fb36f22bef1e0b5c53910267c19ceae859_2.file.breadcrumb.tpl.php
933 /modules/iqitproductsnav/iqitproductsnav.php
934 /modules/iqitproductsnav/translations/fr.php
935 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/f1/e6/1e/f1e61e7ca59d67ddb45735d3ba11885aabdcd7c1_2.file.notifications.tpl.php
936 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/1d/15/44/1d154420732e4f5ec7164570156b8e82b8e743cc_2.file.category-header.tpl.php
937 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/08/3f/fe/083ffef0b3aeb82a59679210de0513024cfa645a_2.file.category-subcategories.tpl.php
938 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/8f/2c/f2/8f2cf264e8ef24eff54cdc3881bd1071ff6abcc5_2.file.products-top.tpl.php
939 /vendor/smarty/smarty/libs/plugins/modifier.regex_replace.php
940 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/ca/43/26/ca432646d2c581a6631dbab0f8a0ded19562cc5d_2.file.sort-orders.tpl.php
941 /var/cache/prod/smarty/compile/warehouse/81/a1/04/81a1040ed0eeab6f58198f9907167c7fced628c5_2.module.ps_facetedsearchps_facetedsearch.tpl.php
942 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/52/57/07/52570740bcdee3193f952d35d0d11ce53ff537f4_2.file.products.tpl.php
943 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/45/91/09/4591095b1d399add495fc541674f2fceb9d0f0e3_2.file.product.tpl.php
944 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/cb/91/6c/cb916c508b6fcc743788f1d7f95631e94668cb9d_2.file.product-miniature-1.tpl.php
945 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/31/03/a9/3103a9a485af7d714612ac0c47dbcfbc05c4fd95_2.file.product-miniature-thumb.tpl.php
946 /var/cache/prod/smarty/compile/warehouse/e9/21/d5/e921d51c062189725606e51308456f33ad945843_2.module.iqitwishlistviewstemplateshookproductminiature.tpl.php
947 /var/cache/prod/smarty/compile/warehouse/90/53/a0/9053a0dd520a39bef75969a0e9efeeae750df91b_2.module.iqitcompareviewstemplateshookproductminiature.tpl.php
948 /var/cache/prod/smarty/compile/warehouse/55/c7/a8/55c7a89f423f7f64b1b84881dcb668e4d788f013_2.module.iqitcountdownviewstemplateshookproduct.tpl.php
949 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/6c/98/2d/6c982d5090ff11db9654f1a7f6945865bc19603f_2.file.product-miniature-btn.tpl.php
950 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/8f/7a/83/8f7a832567456fbcc9b33e35ba7ca0da997b29d7_2.file.pagination.tpl.php
951 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/b1/d3/1b/b1d31b2d2e40bf3996d3350fd9793c705dd5bee6_2.file.products-bottom.tpl.php
952 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/e8/79/87/e87987b9e84bb947f6c535f03253877e87b62912_2.file.category-footer.tpl.php
953 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/99/9e/63/999e637a129f69005ecaa1ec5a360060ed703447_2.file.footer.tpl.php
954 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/7b/ea/10/7bea10cca96ef6b28b8f036ef026a7c11e3bde56_2.file.footer-1.tpl.php
955 /var/cache/prod/smarty/cache/iqitlinksmanager/1/1/1/21/displayFooter/warehouse/a9/f2/c1/a9f2c1869604c8c628073c46891a26fcf1453e27.iqitlinksmanagerviewstemplateshookiqitlinksmanager.tpl.php
956 /var/cache/prod/smarty/compile/warehouse/47/ac/57/47ac57039d904771d1de42366e1791900bdd2c2f_2.file.pixelheader.tpl.php
957 /var/cache/prod/smarty/compile/warehouse/d5/a3/51/d5a351153329745771ab994e1aac2c50a2871ed1_2.file.pages_viewed.tpl.php
958 /var/cache/prod/smarty/compile/warehouse/e8/03/5a/e8035a8d1c12c085b510041163fece5592f47256_2.file.addtocart17.tpl.php
959 /var/cache/prod/smarty/compile/warehouse/77/34/89/773489e70d2bbbc33a3532f583f69463b9e8d34b_2.file.wishlist-iqitwishlist.tpl.php
960 /var/cache/prod/smarty/compile/warehouse/d8/97/09/d897090b6df2dbd807e718e356ae88dacdc94b72_2.file.category.tpl.php
961 /var/cache/prod/smarty/compile/warehouse/0b/1e/ae/0b1eae8b95d210de6545ab4d36ef1e0da4a2995c_2.file.newsletter.tpl.php
962 /var/cache/prod/smarty/compile/warehouse/bb/a9/2e/bba92e35e07193f35df4d88c25fef9c1ee267db4_2.file.page_time_event.tpl.php
963 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/2f/e6/59/2fe659ce5c8a3b849eecceed2fd2484c04ba6f2b_2.file.social-links.tpl.php
964 /modules/ps_emailsubscription/ps_emailsubscription.php
965 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/ca/11/75/ca1175f42cce659c415ef88a938d72e6064791dd_2.file.footer-copyrights-1.tpl.php
966 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/b2/b4/18/b2b418437d59a5c40ab3bf79b4a0534fdfc59e9d_2.file.password-policy-template.tpl.php
967 /classes/form/CustomerLoginForm.php
968 /classes/form/AbstractForm.php
969 /classes/form/FormInterface.php
970 /src/Core/Foundation/Templating/RenderableInterface.php
971 /classes/form/CustomerLoginFormatter.php
972 /classes/form/FormFormatterInterface.php
973 /classes/ValidateConstraintTranslator.php
974 /src/Core/Util/InternationalizedDomainNameConverter.php
975 /src/Core/Foundation/Templating/RenderableProxy.php
976 /var/cache/prod/smarty/compile/warehouse/52/f1/b8/52f1b8b385d74962f57df5c0ac1b0e91d62e4760_2.module.iqitwishlistviewstemplateshookdisplaymodal.tpl.php
977 /classes/form/FormField.php
978 /var/cache/prod/smarty/compile/warehouse/30/f5/ac/30f5acd1c8eb485e903c518c39df62f6dab88d7e_2.file.login-form.tpl.php
979 /var/cache/prod/smarty/compile/warehouse/21/f2/27/21f227e16d661dac3c649c0ff89b74dcf6812c75_2.file.form-errors.tpl.php
980 /var/cache/prod/smarty/compile/08/dc/b1/08dcb1adde6be40af6fcc0544d63eb4badcd22a6_2.file.form-fields.tpl.php
981 /var/cache/prod/smarty/compile/21/f2/27/21f227e16d661dac3c649c0ff89b74dcf6812c75_2.file.form-errors.tpl.php
982 /var/cache/prod/smarty/cache/iqitsociallogin/1/1/1/21/warehouse/7b/d5/c3/7bd5c305fe941e7514c4da4c50a911312eb62349.iqitsocialloginviewstemplateshookauthentication.tpl.php
983 /var/cache/prod/smarty/compile/warehouse/d4/a2/00/d4a200912ea9e133f46cf39b7eadc37ea7dd3d2f_2.module.iqitcompareviewstemplateshookdisplaymodal.tpl.php
984 /var/cache/prod/smarty/cache/iqitcookielaw/1/1/1/21/warehouse/6c/9a/c7/6c9ac7fc236180074d341c4bb3247222ad3545d0.iqitcookielawviewstemplateshookiqitcookielaw.tpl.php
985 /modules/ps_googleanalytics/classes/Hook/HookDisplayBeforeBodyClosingTag.php
986 /modules/ps_googleanalytics/classes/Handler/GanalyticsJsHandler.php
987 /modules/ps_googleanalytics/classes/Handler/GanalyticsDataHandler.php
988 /modules/ps_googleanalytics/classes/Repository/GanalyticsDataRepository.php
989 /modules/ps_googleanalytics/classes/Wrapper/ProductWrapper.php
990 /modules/ps_googleanalytics/classes/GoogleAnalyticsTools.php
991 /var/cache/prod/smarty/compile/warehouse/5c/93/46/5c93465cfee83ad9edb76aeff8896d92c35ee986_2.file.ga_tag.tpl.php