Meubles

Product added to wishlist
Product added to compare.

Ce site utilise des cookies provenant de Google afin de fournir ses services et d'analyser le trafic. Les informations relatives à votre utilisation du site sont partagées avec Google. En cliquant sur "Accepter", vous acceptez l'utilisation des cookies.

Load Time 872 ms
Querying Time 200 ms
Queries 769
Memory Peak Usage 26.3 Mb
Included Files 990 files - 13.24 Mb
PrestaShop Cache - Mb
Global vars 0.61 Mb
PrestaShop Version 8.2.0
PHP Version 8.1.34
MySQL Version 11.4.10-MariaDB
Memory Limit 4048M
Max Execution Time 600s
Smarty Cache enabled
Smarty Compilation auto
  Time Cumulated Time Memory Usage Memory Peak Usage
config 0.569 ms 0.569 ms 3.35 Mb 3.8 Mb
__construct 0.005 ms 0.574 ms - Mb 3.8 Mb
init 5.134 ms 5.708 ms 1.02 Mb 4.5 Mb
setMedia 0.880 ms 6.588 ms 0.31 Mb 4.7 Mb
postProcess 0.000 ms 6.588 ms - Mb 4.7 Mb
initHeader 0.000 ms 6.588 ms - Mb 4.7 Mb
initContent 222.322 ms 228.910 ms 13.55 Mb 18.3 Mb
initFooter 0.001 ms 228.911 ms - Mb 18.3 Mb
display 643.128 ms 872 ms 7.05 Mb 26.3 Mb
Hook Time Memory Usage
DisplayFooter 187.144 ms 1.02 Mb
displayProductListFunctionalButtons 6.063 ms 0.07 Mb
displayBeforeBodyClosingTag 2.287 ms 0.62 Mb
displayCountDown 2.249 ms 0.10 Mb
DisplayHeader 1.216 ms 0.14 Mb
DisplayBeforeBodyClosingTag 1.142 ms 0.13 Mb
displayNav2 0.575 ms 0.18 Mb
displayNav1 0.419 ms 0.09 Mb
displayFooter 0.382 ms 0.09 Mb
displayCustomerLoginFormAfter 0.369 ms 0.07 Mb
displayMainMenu 0.348 ms 0.17 Mb
renderWidget 0.224 ms 0.13 Mb
IsJustElementor 0.166 ms 0.02 Mb
displayAfterBreadcrumb 0.120 ms 0.04 Mb
ProductSearchProvider 0.101 ms - Mb
DisplayProductPriceBlock 0.064 ms 0.07 Mb
ActionFrontControllerSetMedia 0.048 ms 0.01 Mb
OverrideLayoutTemplate 0.027 ms - Mb
DisplayTop 0.007 ms - Mb
ModuleRoutes 0.003 ms - Mb
ActionProductSearchAfter 0.002 ms - Mb
ActionDispatcher 0.002 ms - Mb
Header 0.001 ms - Mb
23 hook(s) 202.959 ms 2.97 Mb
Module Time Memory Usage
ph_simpleblog 0.834 ms 0.25 Mb
iqitthemeeditor 0.260 ms 0.15 Mb
ps_emailalerts 0.065 ms 0.10 Mb
facebookconversiontrackingplus 187.650 ms 1.12 Mb
revolutpayment 0.343 ms 0.24 Mb
revsliderprestashop 0.396 ms 0.09 Mb
ps_shoppingcart 0.050 ms 0.03 Mb
ps_googleanalytics 1.339 ms 0.24 Mb
iqitcompare 2.940 ms 0.13 Mb
iqitcontactpage 0.040 ms 0.02 Mb
iqitcookielaw 0.338 ms 0.07 Mb
iqitcountdown 2.326 ms 0.09 Mb
iqitelementor 0.326 ms 0.09 Mb
iqitfreedeliverycount 0.051 ms 0.02 Mb
iqitmegamenu 0.446 ms 0.30 Mb
iqitsizecharts 0.058 ms 0.04 Mb
iqitwishlist 5.649 ms 0.70 Mb
iqitextendedproduct 0.066 ms 0.05 Mb
iqitsociallogin 0.419 ms 0.15 Mb
gmerchantcenterpro 6.493 ms 1.19 Mb
stripe_official 0.230 ms 0.05 Mb
abandonedcart 0.241 ms 0.08 Mb
vivawalletsmartcheckout 0.133 ms - Mb
ps_facetedsearch 0.462 ms 0.18 Mb
iqitlinksmanager 0.662 ms 0.17 Mb
ps_languageselector 0.163 ms 0.13 Mb
ps_currencyselector 0.151 ms 0.06 Mb
iqitsearch 0.062 ms 0.01 Mb
ps_customersignin 0.028 ms 0.02 Mb
iqitproductsnav 0.176 ms 0.06 Mb
ps_emailsubscription 0.324 ms 0.08 Mb
31 module(s) 212.722 ms 5.87 Mb

Stopwatch SQL - 769 queries

# Query Time (ms) Rows Filesort Group By Location
156
SELECT SQL_NO_CACHE p.id_product FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (33201, 751256, 33206, 750009, 751249, 33208))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=3 AND c.nright<=346 GROUP BY p.id_product) p INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) GROUP BY p.id_product ORDER BY p.position ASC, p.id_product DESC
16.584 ms 9363600 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
164
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (33201, 751256, 33206, 750009, 751249, 33208))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=3 AND c.nright<=346 GROUP BY p.id_product) p INNER JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=13)) AND ((fp_1.id_feature_value IN (33201, 751256, 33206, 750009, 751249, 33208))) GROUP BY fp.id_feature_value
13.233 ms 18727200 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
174
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (33201, 751256, 33206, 750009, 751249, 33208))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=3 AND c.nright<=346 GROUP BY p.id_product) p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((sa.out_of_stock=1) OR (sa.quantity>0)) AND ((fp_1.id_feature_value IN (33201, 751256, 33206, 750009, 751249, 33208)))
12.953 ms 37454400 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
172
SELECT SQL_NO_CACHE cp.id_category, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (33201, 751256, 33206, 750009, 751249, 33208))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=3 AND c.nright<=346 GROUP BY p.id_product) p INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (33201, 751256, 33206, 750009, 751249, 33208))) AND cg.id_group='1' AND c.level_depth<=3 AND c.nleft>3 AND c.nright<346 GROUP BY cp.id_category
12.489 ms 18727200 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
175
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (33201, 751256, 33206, 750009, 751249, 33208))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=3 AND c.nright<=346 GROUP BY p.id_product) p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((sa.quantity>0)) AND ((fp_1.id_feature_value IN (33201, 751256, 33206, 750009, 751249, 33208)))
12.458 ms 37454400 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
173
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (33201, 751256, 33206, 750009, 751249, 33208))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=3 AND c.nright<=346 GROUP BY p.id_product) p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_stock_available sa_1 ON (p.id_product = sa_1.id_product AND IFNULL(pac.id_product_attribute, 0) = sa_1.id_product_attribute AND sa_1.id_shop = 1  AND sa_1.id_shop_group = 0 ) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((sa.quantity<=0 AND sa_1.out_of_stock IN (0, 2))) AND ((fp_1.id_feature_value IN (33201, 751256, 33206, 750009, 751249, 33208)))
12.382 ms 37454400 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
162
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (33201, 751256, 33206, 750009, 751249, 33208))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=3 AND c.nright<=346 GROUP BY p.id_product) p INNER JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=10)) AND ((fp_1.id_feature_value IN (33201, 751256, 33206, 750009, 751249, 33208))) GROUP BY fp.id_feature_value
12.339 ms 18727200 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
159
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (33201, 751256, 33206, 750009, 751249, 33208))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=3 AND c.nright<=346 GROUP BY p.id_product) p LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (33201, 751256, 33206, 750009, 751249, 33208))) AND p.date_add>'2026-01-29 00:00:00'
12.214 ms 18727200 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
158
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (33201, 751256, 33206, 750009, 751249, 33208))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=3 AND c.nright<=346 GROUP BY p.id_product) p LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((p.on_sale=1)) AND ((fp_1.id_feature_value IN (33201, 751256, 33206, 750009, 751249, 33208)))
12.054 ms 18727200 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
167
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) WHERE ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=3 AND c.nright<=346 GROUP BY p.id_product) p INNER JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature=29)) GROUP BY fp.id_feature_value
12.003 ms 4681800 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
176
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (33201, 751256, 33206, 750009, 751249, 33208))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=3 AND c.nright<=346 GROUP BY p.id_product) p INNER JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=17)) AND ((fp_1.id_feature_value IN (33201, 751256, 33206, 750009, 751249, 33208))) GROUP BY fp.id_feature_value
1.639 ms 4536 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
160
SELECT SQL_NO_CACHE COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (33201, 751256, 33206, 750009, 751249, 33208))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=3 AND c.nright<=346 GROUP BY p.id_product) p LEFT JOIN een_specific_price sp ON (
sp.id_product = p.id_product AND 
sp.id_shop IN (0, 1) AND 
sp.id_currency IN (0, 1) AND 
sp.id_country IN (0, 21) AND 
sp.id_group IN (0, 1) AND 
sp.from_quantity = 1 AND
sp.reduction > 0 AND
sp.id_customer = 0 AND
sp.id_cart = 0 AND 
(sp.from = '0000-00-00 00:00:00' OR '2026-04-28 18:46:52' >= sp.from) AND 
(sp.to = '0000-00-00 00:00:00' OR '2026-04-28 18:46:52' <= sp.to) 
) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((sp.reduction>0)) AND ((fp_1.id_feature_value IN (33201, 751256, 33206, 750009, 751249, 33208)))
1.632 ms 4184 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
165
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (33201, 751256, 33206, 750009, 751249, 33208))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=3 AND c.nright<=346 GROUP BY p.id_product) p INNER JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=20)) AND ((fp_1.id_feature_value IN (33201, 751256, 33206, 750009, 751249, 33208))) GROUP BY fp.id_feature_value
1.482 ms 2208 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
161
SELECT SQL_NO_CACHE psi.price_min, MIN(price_min) as min, MAX(price_max) as max FROM een_product p INNER JOIN een_layered_price_index psi ON (psi.id_product = p.id_product AND psi.id_shop = 1 AND psi.id_currency = 1 AND psi.id_country = 21) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (33201, 751256, 33206, 750009, 751249, 33208))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=3 AND c.nright<=346
1.300 ms 3060 /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
3
SELECT SQL_NO_CACHE c.`name`, cl.`id_lang`, IF(cl.`id_lang` IS NULL, c.`value`, cl.`value`) AS value, c.id_shop_group, c.id_shop
FROM `een_configuration` c
LEFT JOIN `een_configuration_lang` cl ON (c.`id_configuration` = cl.`id_configuration`)
1.166 ms 1696 /classes/Configuration.php:180
169
SELECT SQL_NO_CACHE fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, 0) = sa.id_product_attribute AND sa.id_shop = 1  AND sa.id_shop_group = 0 ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = 1 AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=1) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (33201, 751256, 33206, 750009, 751249, 33208))) AND ps.id_shop='1' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='1' AND c.nleft>=3 AND c.nright<=346 GROUP BY p.id_product) p INNER JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_1 ON (p.id_product = fp_1.id_product) WHERE ((fp.id_feature=34)) AND ((fp_1.id_feature_value IN (33201, 751256, 33206, 750009, 751249, 33208))) GROUP BY fp.id_feature_value
0.894 ms 224 Yes /modules/ps_facetedsearch/src/Adapter/MySQL.php:85
750
SELECT SQL_NO_CACHE id_category, id_parent, level_depth, name, is_root_category, active FROM een_category LEFT JOIN een_category_lang AS cl USING (id_category) LEFT JOIN een_category_shop AS cs USING (id_category) WHERE cs.id_shop = 1 AND cl.id_lang = 1 ORDER BY `een_category`.`id_parent` ASC, `een_category`.`id_category` ASC
0.707 ms 330 Yes /modules/facebookconversiontrackingplus/facebookconversiontrackingplus.php:2945
751
SELECT SQL_NO_CACHE id_category, id_parent, level_depth, name, is_root_category, active FROM een_category LEFT JOIN een_category_lang AS cl USING (id_category) LEFT JOIN een_category_shop AS cs USING (id_category) WHERE cs.id_shop = 1 AND cl.id_lang = 1 ORDER BY `een_category`.`id_parent` ASC, `een_category`.`id_category` ASC
0.647 ms 330 Yes /modules/facebookconversiontrackingplus/facebookconversiontrackingplus.php:2945
768
SELECT SQL_NO_CACHE cp.`id_category`, cp.`id_product`, cl.`name` FROM `een_category_product` cp
LEFT JOIN `een_category` c ON (c.id_category = cp.id_category)
LEFT JOIN `een_category_lang` cl ON (cp.`id_category` = cl.`id_category` AND cl.id_shop = 1 )
INNER JOIN een_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
WHERE cp.`id_product` IN (548444,548406,548036,547985,547921,547665,547376,547204,547001,546968,546867,546692,546464,546348,546341,546058,546031,545729,545709,545693,545554,545474,544569,544543,544488,544358,544260,544028,543423,543357,543348,543106,543008,542781,542706,542487) AND cl.`id_lang` = 1
ORDER BY c.`level_depth` DESC
0.609 ms 73 Yes /modules/ps_googleanalytics/classes/Wrapper/ProductWrapper.php:109
192
SELECT SQL_NO_CACHE `id_hook`, `name`
FROM `een_hook`
UNION
SELECT `id_hook`, ha.`alias` as name
FROM `een_hook_alias` ha
INNER JOIN `een_hook` h ON ha.name = h.name
0.587 ms 0 /classes/Hook.php:1326
193
SELECT SQL_NO_CACHE h.id_hook, h.name as h_name, title, description, h.position, hm.position as hm_position, m.id_module, m.name, m.active
FROM `een_hook_module` hm
STRAIGHT_JOIN `een_hook` h ON (h.id_hook = hm.id_hook AND hm.id_shop = 1)
STRAIGHT_JOIN `een_module` as m ON (m.id_module = hm.id_module)
ORDER BY hm.position
0.560 ms 486 /classes/Hook.php:456
14
SELECT SQL_NO_CACHE h.`name` as hook, m.`id_module`, h.`id_hook`, m.`name` as module
FROM `een_module` m
INNER JOIN een_module_shop module_shop
ON (module_shop.id_module = m.id_module AND module_shop.id_shop = 1 AND module_shop.enable_device & 1)
INNER JOIN `een_hook_module` `hm` ON hm.`id_module` = m.`id_module`
INNER JOIN `een_hook` `h` ON hm.`id_hook` = h.`id_hook`
LEFT JOIN `een_module_group` `mg` ON mg.`id_module` = m.`id_module`
WHERE (h.`name` != "paymentOptions") AND (hm.`id_shop` = 1) AND (mg.id_shop = 1 AND  mg.`id_group` IN (1))
GROUP BY hm.id_hook, hm.id_module
ORDER BY hm.`position`
0.521 ms 244 Yes Yes /classes/Hook.php:1267
178
SELECT SQL_NO_CACHE p.*,
ps.*,
pl.*,
sa.out_of_stock,
IFNULL(sa.quantity, 0) as quantity,
(DATEDIFF(
p.`date_add`,
DATE_SUB(
'2026-04-28 00:00:00',
INTERVAL 90 DAY
)
) > 0) as new
FROM een_product p
LEFT JOIN een_product_lang pl
ON pl.id_product = p.id_product
AND pl.id_shop = 1
AND pl.id_lang = 1
LEFT JOIN een_stock_available sa   ON sa.id_product = p.id_product
AND sa.id_product_attribute = 0
AND sa.id_shop = 1 LEFT JOIN een_product_shop ps
ON ps.id_product = p.id_product
AND ps.id_shop = 1
WHERE p.id_product IN (548444,548406,548036,547985,547921,547665,547376,547204,547001,546968,546867,546692,546464,546348,546341,546058,546031,545729,545709,545693,545554,545474,544569,544543,544488,544358,544260,544028,543423,543357,543348,543106,543008,542781,542706,542487)
0.489 ms 36 /classes/ProductAssembler.php:95
42
SELECT SQL_NO_CACHE c.*, cl.`id_lang`, cl.`name`, cl.`description`, cl.`additional_description`, cl.`link_rewrite`, cl.`meta_title`, cl.`meta_keywords`, cl.`meta_description`
FROM `een_category` c
INNER JOIN een_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `een_category_lang` cl ON (c.`id_category` = cl.`id_category` AND `id_lang` = 1  AND cl.id_shop = 1 )
LEFT JOIN `een_category_group` cg ON (cg.`id_category` = c.`id_category`)
WHERE `id_parent` = 1000
AND `active` = 1
AND cg.`id_group` =1
GROUP BY c.`id_category`
ORDER BY `level_depth` ASC, category_shop.`position` ASC
0.416 ms 12 Yes Yes /classes/Category.php:924
113
SELECT SQL_NO_CACHE *
FROM `een_gmcp_feeds` ff
WHERE (ff.id_shop=1)
ORDER BY ff.feed_is_default ASC
0.397 ms 370 Yes /modules/gmerchantcenterpro/models/Feeds.php:62
171
SELECT SQL_NO_CACHE c.`id_category`, cl.`name`
FROM `een_category` c
INNER JOIN een_category_shop category_shop
ON (category_shop.id_category = c.id_category AND category_shop.id_shop = 1)
LEFT JOIN `een_category_lang` cl ON c.`id_category` = cl.`id_category` AND cl.id_shop = 1 
WHERE 1  AND `id_lang` = 1
AND c.`active` = 1
ORDER BY c.nleft, c.position
0.356 ms 330 Yes /classes/Category.php:724
177
REPLACE INTO een_layered_filter_block (hash, data) VALUES ("184cd098da9a1a78de8e20ead7c74ee4", "a:1:{s:7:\"filters\";a:8:{i:0;a:7:{s:9:\"type_lite\";s:6:\"extras\";s:4:\"type\";s:6:\"extras\";s:6:\"id_key\";i:0;s:4:\"name\";s:10:\"Selections\";s:6:\"values\";a:3:{s:4:\"sale\";a:2:{s:4:\"name\";s:8:\"En promo\";s:3:\"nbr\";i:0;}s:3:\"new\";a:2:{s:4:\"name\";s:15:\"Nouveau produit\";s:3:\"nbr\";i:0;}s:8:\"discount\";a:2:{s:4:\"name\";s:8:\"En promo\";s:3:\"nbr\";i:25;}}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";s:1:\"0\";}i:1;a:12:{s:9:\"type_lite\";s:5:\"price\";s:4:\"type\";s:5:\"price\";s:6:\"id_key\";i:0;s:4:\"name\";s:4:\"Prix\";s:3:\"max\";d:0;s:3:\"min\";d:0;s:4:\"unit\";s:3:\"€\";s:14:\"specifications\";a:11:{s:6:\"symbol\";a:11:{i:0;s:1:\",\";i:1;s:3:\" \";i:2;s:1:\";\";i:3;s:1:\"%\";i:4;s:1:\"-\";i:5;s:1:\"+\";i:6;s:1:\"E\";i:7;s:2:\"×\";i:8;s:3:\"‰\";i:9;s:3:\"∞\";i:10;s:3:\"NaN\";}s:12:\"currencyCode\";s:3:\"EUR\";s:14:\"currencySymbol\";s:3:\"€\";s:13:\"numberSymbols\";a:11:{i:0;s:1:\",\";i:1;s:3:\" \";i:2;s:1:\";\";i:3;s:1:\"%\";i:4;s:1:\"-\";i:5;s:1:\"+\";i:6;s:1:\"E\";i:7;s:2:\"×\";i:8;s:3:\"‰\";i:9;s:3:\"∞\";i:10;s:3:\"NaN\";}s:15:\"positivePattern\";s:12:\"#,##0.00 ¤\";s:15:\"negativePattern\";s:13:\"-#,##0.00 ¤\";s:17:\"maxFractionDigits\";i:2;s:17:\"minFractionDigits\";i:2;s:12:\"groupingUsed\";b:1;s:16:\"primaryGroupSize\";i:3;s:18:\"secondaryGroupSize\";i:3;}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";i:3;s:3:\"nbr\";i:252;s:5:\"value\";N;}i:2;a:9:{s:9:\"type_lite\";s:10:\"id_feature\";s:4:\"type\";s:10:\"id_feature\";s:6:\"id_key\";s:2:\"10\";s:6:\"values\";a:9:{i:151;a:4:{s:3:\"nbr\";s:2:\"40\";s:4:\"name\";s:11:\"Bois massif\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:146;a:4:{s:3:\"nbr\";s:2:\"44\";s:4:\"name\";s:17:\"Dérivés du bois\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:150;a:4:{s:3:\"nbr\";s:1:\"4\";s:4:\"name\";s:6:\"Métal\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:81988;a:4:{s:3:\"nbr\";s:1:\"9\";s:4:\"name\";s:10:\"Pin massif\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:751261;a:4:{s:3:\"nbr\";s:1:\"1\";s:4:\"name\";s:62:\"Plateau : marbre coulé poli Structure / pied : métal brossé\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:159601;a:4:{s:3:\"nbr\";s:1:\"7\";s:4:\"name\";s:6:\"Simili\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:143;a:4:{s:3:\"nbr\";s:1:\"8\";s:4:\"name\";s:5:\"Tissu\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:232660;a:4:{s:3:\"nbr\";s:2:\"19\";s:4:\"name\";s:7:\"Velours\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:148;a:4:{s:3:\"nbr\";s:1:\"5\";s:4:\"name\";s:5:\"Verre\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}}s:4:\"name\";s:8:\"Matière\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";s:1:\"0\";}i:3;a:9:{s:9:\"type_lite\";s:10:\"id_feature\";s:4:\"type\";s:10:\"id_feature\";s:6:\"id_key\";s:2:\"20\";s:6:\"values\";a:2:{i:526;a:4:{s:3:\"nbr\";s:1:\"3\";s:4:\"name\";s:13:\"Rectangulaire\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:55781;a:4:{s:3:\"nbr\";s:1:\"3\";s:4:\"name\";s:4:\"Rond\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}}s:4:\"name\";s:5:\"Forme\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";s:1:\"0\";}i:4;a:9:{s:9:\"type_lite\";s:10:\"id_feature\";s:4:\"type\";s:10:\"id_feature\";s:6:\"id_key\";s:2:\"29\";s:6:\"values\";a:30:{i:55029;a:4:{s:3:\"nbr\";s:1:\"3\";s:4:\"name\";s:11:\"Anthracite \";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:33207;a:4:{s:3:\"nbr\";s:1:\"4\";s:4:\"name\";s:5:\"Beige\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:33201;a:5:{s:3:\"nbr\";s:3:\"218\";s:4:\"name\";s:5:\"Blanc\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:7:\"checked\";b:1;}i:751256;a:5:{s:3:\"nbr\";s:1:\"1\";s:4:\"name\";s:18:\"blanc effet marbre\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:7:\"checked\";b:1;}i:33206;a:5:{s:3:\"nbr\";s:2:\"13\";s:4:\"name\";s:4:\"Bleu\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:7:\"checked\";b:1;}i:228923;a:4:{s:3:\"nbr\";s:1:\"5\";s:4:\"name\";s:4:\"Bois\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:751233;a:4:{s:3:\"nbr\";s:1:\"1\";s:4:\"name\";s:12:\"bois et noir\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:750009;a:5:{s:3:\"nbr\";s:1:\"1\";s:4:\"name\";s:4:\"Brun\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:7:\"checked\";b:1;}i:751249;a:5:{s:3:\"nbr\";s:1:\"1\";s:4:\"name\";s:4:\"Brun\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:7:\"checked\";b:1;}i:751234;a:4:{s:3:\"nbr\";s:1:\"1\";s:4:\"name\";s:12:\"Brun et Noir\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:751240;a:4:{s:3:\"nbr\";s:1:\"1\";s:4:\"name\";s:12:\"Brun et Noir\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:751226;a:4:{s:3:\"nbr\";s:2:\"19\";s:4:\"name\";s:13:\"Chêne marron\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:751253;a:4:{s:3:\"nbr\";s:1:\"1\";s:4:\"name\";s:14:\"Chêne naturel\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:751258;a:4:{s:3:\"nbr\";s:1:\"1\";s:4:\"name\";s:14:\"Chêne naturel\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:751268;a:4:{s:3:\"nbr\";s:1:\"1\";s:4:\"name\";s:14:\"chêne naturel\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:86888;a:4:{s:3:\"nbr\";s:2:\"48\";s:4:\"name\";s:13:\"Chêne sonoma\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:751231;a:4:{s:3:\"nbr\";s:1:\"1\";s:4:\"name\";s:42:\"Corps miel – Applications et pieds noirs\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:86884;a:4:{s:3:\"nbr\";s:2:\"10\";s:4:\"name\";s:6:\"Crème\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:33203;a:4:{s:3:\"nbr\";s:1:\"2\";s:4:\"name\";s:4:\"Gris\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:33210;a:4:{s:3:\"nbr\";s:1:\"8\";s:4:\"name\";s:5:\"Jaune\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:33202;a:4:{s:3:\"nbr\";s:1:\"2\";s:4:\"name\";s:6:\"Marron\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:751245;a:4:{s:3:\"nbr\";s:1:\"1\";s:4:\"name\";s:7:\"Naturel\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:33204;a:4:{s:3:\"nbr\";s:3:\"247\";s:4:\"name\";s:4:\"Noir\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:751244;a:4:{s:3:\"nbr\";s:1:\"1\";s:4:\"name\";s:13:\"Noir brillant\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:751266;a:4:{s:3:\"nbr\";s:1:\"1\";s:4:\"name\";s:53:\"Plateau : blanc effet marbre Structure : noyer foncé\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:33205;a:4:{s:3:\"nbr\";s:1:\"5\";s:4:\"name\";s:4:\"Rose\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:33209;a:4:{s:3:\"nbr\";s:1:\"7\";s:4:\"name\";s:5:\"Rouge\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:750025;a:4:{s:3:\"nbr\";s:2:\"36\";s:4:\"name\";s:11:\"Sonoma gris\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:86883;a:4:{s:3:\"nbr\";s:1:\"9\";s:4:\"name\";s:6:\"Taupe \";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:33208;a:5:{s:3:\"nbr\";s:2:\"18\";s:4:\"name\";s:4:\"Vert\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:7:\"checked\";b:1;}}s:4:\"name\";s:7:\"Couleur\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";s:1:\"0\";}i:5;a:9:{s:9:\"type_lite\";s:10:\"id_feature\";s:4:\"type\";s:10:\"id_feature\";s:6:\"id_key\";s:2:\"34\";s:6:\"values\";a:2:{i:240579;a:4:{s:3:\"nbr\";s:1:\"1\";s:4:\"name\";s:8:\"Manguier\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}i:240577;a:4:{s:3:\"nbr\";s:1:\"1\";s:4:\"name\";s:8:\"Sheesham\";s:8:\"url_name\";N;s:10:\"meta_title\";N;}}s:4:\"name\";s:15:\"Essence de bois\";s:8:\"url_name\";N;s:10:\"meta_title\";N;s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";s:1:\"0\";}i:6;a:7:{s:9:\"type_lite\";s:8:\"category\";s:4:\"type\";s:8:\"category\";s:6:\"id_key\";i:0;s:4:\"name\";s:11:\"Catégories\";s:6:\"values\";a:7:{i:411;a:2:{s:4:\"name\";s:5:\"Bancs\";s:3:\"nbr\";s:1:\"3\";}i:1027;a:2:{s:4:\"name\";s:10:\"Meubles TV\";s:3:\"nbr\";s:1:\"5\";}i:1030;a:2:{s:4:\"name\";s:17:\"Meubles de bureau\";s:3:\"nbr\";s:2:\"11\";}i:1031;a:2:{s:4:\"name\";s:13:\"Bibliothèque\";s:3:\"nbr\";s:2:\"11\";}i:5723;a:2:{s:4:\"name\";s:16:\"Chaise, Tabouret\";s:3:\"nbr\";s:1:\"5\";}i:5728;a:2:{s:4:\"name\";s:9:\"Rangement\";s:3:\"nbr\";s:1:\"6\";}i:5735;a:2:{s:4:\"name\";s:6:\"Tables\";s:3:\"nbr\";s:1:\"1\";}}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";s:1:\"0\";}i:7;a:7:{s:9:\"type_lite\";s:12:\"availability\";s:4:\"type\";s:12:\"availability\";s:6:\"id_key\";i:0;s:4:\"name\";s:14:\"Disponibilité\";s:6:\"values\";a:2:{i:2;a:2:{s:4:\"name\";s:8:\"En stock\";s:3:\"nbr\";i:249;}i:0;a:2:{s:4:\"name\";s:14:\"Non disponible\";s:3:\"nbr\";i:3;}}s:17:\"filter_show_limit\";i:0;s:11:\"filter_type\";s:1:\"0\";}}}")
0.287 ms 1 /modules/ps_facetedsearch/src/Filters/Block.php:211
70
SHOW TABLES LIKE "een_gmcp_1800"
0.258 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:88
13
SELECT SQL_NO_CACHE lower(name) as name
FROM `een_hook` h
WHERE (h.active = 1)
0.250 ms 1060 /classes/Hook.php:1366
153
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `een_feature_value` v LEFT JOIN `een_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `een_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 29 ORDER BY vl.`value` ASC
0.228 ms 40 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
152
SELECT SQL_NO_CACHE DISTINCT f.id_feature, f.*, fl.*, IF(liflv.`url_name` IS NULL OR liflv.`url_name` = "", NULL, liflv.`url_name`) AS url_name, IF(liflv.`meta_title` IS NULL OR liflv.`meta_title` = "", NULL, liflv.`meta_title`) AS meta_title, lif.indexable FROM `een_feature` f  INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1) LEFT JOIN `een_feature_lang` fl ON (f.`id_feature` = fl.`id_feature` AND fl.`id_lang` = 1) LEFT JOIN `een_layered_indexable_feature` lif ON (f.`id_feature` = lif.`id_feature`) LEFT JOIN `een_layered_indexable_feature_lang_value` liflv ON (f.`id_feature` = liflv.`id_feature` AND liflv.`id_lang` = 1) ORDER BY f.`position` ASC
0.226 ms 29 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:171
108
SHOW COLUMNS FROM een_gmcp_feeds LIKE "feed_is_default"
0.224 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:128
168
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `een_feature_value` v LEFT JOIN `een_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `een_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 29 ORDER BY vl.`value` ASC
0.220 ms 40 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
77
SHOW TABLES LIKE "een_gmcp_1900"
0.218 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:88
539
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 542781 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 542781 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.212 ms 0 /classes/Cart.php:1430
163
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `een_feature_value` v LEFT JOIN `een_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `een_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 10 ORDER BY vl.`value` ASC
0.207 ms 37 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
110
SHOW COLUMNS FROM een_gmcp_tags LIKE "custom_label_set_postion"
0.193 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:128
109
SHOW COLUMNS FROM een_gmcp_discount_association LIKE "channel"
0.192 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:128
749
SELECT SQL_NO_CACHE product_id as id_product, COUNT(product_id) AS sales
FROM `een_order_detail`
WHERE product_id IN (
SELECT id_product
FROM `een_category_product`
LEFT JOIN een_product USING (id_product)
WHERE id_category = 1000
AND active = 1
)
GROUP BY product_id
ORDER BY sales DESC LIMIT 5
0.190 ms 37 Yes /modules/facebookconversiontrackingplus/facebookconversiontrackingplus.php:2918
697
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (548444) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.180 ms 1 Yes Yes /classes/Product.php:4524
544
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 0 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.176 ms 1 Yes /classes/SpecificPrice.php:576
727
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (543348) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.176 ms 1 Yes Yes /classes/Product.php:4524
728
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (543106) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.176 ms 1 Yes Yes /classes/Product.php:4524
729
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (543008) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.174 ms 1 Yes Yes /classes/Product.php:4524
540
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 542781
ORDER BY f.position ASC
0.172 ms 5 Yes /classes/Product.php:6021
549
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 542706 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 542706 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.170 ms 0 /classes/Cart.php:1430
200
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 548444
ORDER BY f.position ASC
0.163 ms 5 Yes /classes/Product.php:6021
730
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (542781) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.163 ms 1 Yes Yes /classes/Product.php:4524
724
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (544028) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.162 ms 1 Yes Yes /classes/Product.php:4524
114
SELECT SQL_NO_CACHE *
FROM `een_gmcp_feeds` ff
WHERE (ff.iso_lang="fr") AND (ff.id_shop=1)
ORDER BY ff.feed_is_default ASC
0.161 ms 370 Yes /modules/gmerchantcenterpro/models/Feeds.php:72
185
SELECT SQL_NO_CACHE DISTINCT `id_product` FROM `een_specific_price` WHERE `id_product` != 0
0.159 ms 523 /classes/SpecificPrice.php:310
725
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (543423) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.158 ms 1 Yes Yes /classes/Product.php:4524
699
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (548036) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.157 ms 1 Yes Yes /classes/Product.php:4524
698
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (548406) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.155 ms 1 Yes Yes /classes/Product.php:4524
710
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (546348) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.154 ms 1 Yes Yes /classes/Product.php:4524
2
SELECT SQL_NO_CACHE gs.*, s.*, gs.name AS group_name, s.name AS shop_name, s.active, su.domain, su.domain_ssl, su.physical_uri, su.virtual_uri
FROM een_shop_group gs
LEFT JOIN een_shop s
ON s.id_shop_group = gs.id_shop_group
LEFT JOIN een_shop_url su
ON s.id_shop = su.id_shop AND su.main = 1
WHERE s.deleted = 0
AND gs.deleted = 0
ORDER BY gs.name, s.name
0.152 ms 1 Yes /classes/shop/Shop.php:715
726
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (543357) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.152 ms 1 Yes Yes /classes/Product.php:4524
555
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 0 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.151 ms 1 Yes /classes/SpecificPrice.php:576
672
SELECT SQL_NO_CACHE 1 FROM `een_cart_rule` WHERE ((date_to >= "2026-04-28 00:00:00" AND date_to <= "2026-04-28 23:59:59") OR (date_from >= "2026-04-28 00:00:00" AND date_from <= "2026-04-28 23:59:59") OR (date_from < "2026-04-28 00:00:00" AND date_to > "2026-04-28 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
0.151 ms 2 /classes/CartRule.php:357
732
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (542487) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.151 ms 1 Yes Yes /classes/Product.php:4524
199
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 548444 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 548444 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.150 ms 0 /classes/Cart.php:1430
673
SELECT SQL_NO_CACHE * FROM `een_cart_rule` cr
LEFT JOIN `een_cart_rule_lang` crl 
ON (cr.`id_cart_rule` = crl.`id_cart_rule` AND crl.`id_lang` = 1) WHERE (cr.`id_customer` = 0) AND NOW() BETWEEN cr.date_from AND cr.date_to
AND cr.`active` = 1
AND free_shipping = 1 AND carrier_restriction = 1
0.150 ms 1 /classes/CartRule.php:423
16
SELECT SQL_NO_CACHE `id_hook`, `name` FROM `een_hook`
0.149 ms 1060 /classes/Hook.php:1326
705
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (547001) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.149 ms 1 Yes Yes /classes/Product.php:4524
731
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (542706) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.149 ms 1 Yes Yes /classes/Product.php:4524
702
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (547665) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.147 ms 1 Yes Yes /classes/Product.php:4524
703
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (547376) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.147 ms 1 Yes Yes /classes/Product.php:4524
708
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (546692) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.146 ms 1 Yes Yes /classes/Product.php:4524
712
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (546058) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.146 ms 1 Yes Yes /classes/Product.php:4524
718
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (545474) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.146 ms 1 Yes Yes /classes/Product.php:4524
170
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `een_feature_value` v LEFT JOIN `een_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `een_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 34 ORDER BY vl.`value` ASC
0.145 ms 8 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
189
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 0 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.145 ms 1 Yes /classes/SpecificPrice.php:576
205
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 0 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.145 ms 1 Yes /classes/SpecificPrice.php:576
226
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 0 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.145 ms 1 Yes /classes/SpecificPrice.php:576
700
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (547985) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.145 ms 1 Yes Yes /classes/Product.php:4524
257
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 0 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.144 ms 1 Yes /classes/SpecificPrice.php:576
365
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 546031 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 546031 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.144 ms 0 /classes/Cart.php:1430
701
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (547921) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.144 ms 1 Yes Yes /classes/Product.php:4524
707
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (546867) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.144 ms 1 Yes Yes /classes/Product.php:4524
719
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (544569) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.144 ms 1 Yes Yes /classes/Product.php:4524
720
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (544543) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.144 ms 1 Yes Yes /classes/Product.php:4524
247
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 0 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.143 ms 1 Yes /classes/SpecificPrice.php:576
709
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (546464) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.143 ms 1 Yes Yes /classes/Product.php:4524
715
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (545709) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.143 ms 1 Yes Yes /classes/Product.php:4524
716
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (545693) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.143 ms 1 Yes Yes /classes/Product.php:4524
371
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 0 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.142 ms 1 Yes /classes/SpecificPrice.php:576
381
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 0 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.142 ms 1 Yes /classes/SpecificPrice.php:576
514
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 0 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.142 ms 1 Yes /classes/SpecificPrice.php:576
704
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (547204) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.142 ms 1 Yes Yes /classes/Product.php:4524
722
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (544358) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.142 ms 1 Yes Yes /classes/Product.php:4524
216
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 0 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.142 ms 1 Yes /classes/SpecificPrice.php:576
20
SELECT SQL_NO_CACHE m.page, ml.url_rewrite, ml.id_lang
FROM `een_meta` m
LEFT JOIN `een_meta_lang` ml ON (m.id_meta = ml.id_meta AND ml.id_shop = 1 )
ORDER BY LENGTH(ml.url_rewrite) DESC
0.141 ms 66 Yes /classes/Dispatcher.php:654
396
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 545693 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 545693 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.141 ms 0 /classes/Cart.php:1430
706
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (546968) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.141 ms 1 Yes Yes /classes/Product.php:4524
711
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (546341) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.141 ms 1 Yes Yes /classes/Product.php:4524
713
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (546031) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.141 ms 1 Yes Yes /classes/Product.php:4524
344
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 546341 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 546341 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.141 ms 0 /classes/Cart.php:1430
714
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (545729) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.141 ms 1 Yes Yes /classes/Product.php:4524
237
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 0 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.140 ms 1 Yes /classes/SpecificPrice.php:576
279
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 0 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.140 ms 1 Yes /classes/SpecificPrice.php:576
519
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 543106 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 543106 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.140 ms 0 /classes/Cart.php:1430
717
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (545554) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.140 ms 1 Yes Yes /classes/Product.php:4524
210
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 548406 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 548406 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.139 ms 0 /classes/Cart.php:1430
268
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 0 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.139 ms 1 Yes /classes/SpecificPrice.php:576
289
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 0 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.139 ms 1 Yes /classes/SpecificPrice.php:576
349
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 0 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.139 ms 1 Yes /classes/SpecificPrice.php:576
391
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 0 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.139 ms 1 Yes /classes/SpecificPrice.php:576
401
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 0 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.139 ms 1 Yes /classes/SpecificPrice.php:576
411
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 0 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.139 ms 1 Yes /classes/SpecificPrice.php:576
723
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (544260) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.139 ms 1 Yes Yes /classes/Product.php:4524
760
SELECT SQL_NO_CACHE product_id as id_product, COUNT(product_id) AS sales
FROM `een_order_detail`
WHERE product_id IN (
SELECT id_product
FROM `een_category_product`
LEFT JOIN een_product USING (id_product)
WHERE id_category = 1000
AND active = 1
)
GROUP BY product_id
ORDER BY sales DESC LIMIT 5
0.139 ms 37 Yes /modules/facebookconversiontrackingplus/facebookconversiontrackingplus.php:2918
231
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 547985 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 547985 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.138 ms 0 /classes/Cart.php:1430
354
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 546058 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 546058 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.138 ms 0 /classes/Cart.php:1430
416
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 545474 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 545474 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.138 ms 0 /classes/Cart.php:1430
504
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 0 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.138 ms 1 Yes /classes/SpecificPrice.php:576
524
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 0 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.138 ms 1 Yes /classes/SpecificPrice.php:576
721
SELECT SQL_NO_CACHE pa.`id_product`, a.`color`, pac.`id_product_attribute`, 0 qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
FROM `een_product_attribute` pa
INNER JOIN een_product_attribute_shop product_attribute_shop
ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = 1)
JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = 1)
JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
WHERE pa.`id_product` IN (544488) AND ag.`is_color_group` = 1
GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
ORDER BY a.`position` ASC;
0.138 ms 1 Yes Yes /classes/Product.php:4524
211
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 548406
ORDER BY f.position ASC
0.137 ms 5 Yes /classes/Product.php:6021
499
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 543357 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 543357 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.137 ms 0 /classes/Cart.php:1430
438
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 544543
ORDER BY f.position ASC
0.137 ms 5 Yes /classes/Product.php:6021
550
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 542706
ORDER BY f.position ASC
0.137 ms 5 Yes /classes/Product.php:6021
560
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 542487 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 542487 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.137 ms 0 /classes/Cart.php:1430
641
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 544260) AND (b.`id_shop` = 1) LIMIT 1
0.137 ms 1 /src/Adapter/EntityMapper.php:71
509
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 543348 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 543348 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.136 ms 0 /classes/Cart.php:1430
252
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 547665 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 547665 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.136 ms 0 /classes/Cart.php:1430
262
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 547376 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 547376 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.136 ms 0 /classes/Cart.php:1430
273
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 547204 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 547204 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.136 ms 0 /classes/Cart.php:1430
386
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 545709 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 545709 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.136 ms 0 /classes/Cart.php:1430
432
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 0 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.136 ms 1 Yes /classes/SpecificPrice.php:576
442
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 0 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.136 ms 1 Yes /classes/SpecificPrice.php:576
452
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 0 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.136 ms 1 Yes /classes/SpecificPrice.php:576
299
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 0 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.135 ms 1 Yes /classes/SpecificPrice.php:576
478
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 544028
ORDER BY f.position ASC
0.135 ms 5 Yes /classes/Product.php:6021
360
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 0 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.135 ms 1 Yes /classes/SpecificPrice.php:576
421
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 0 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.135 ms 1 Yes /classes/SpecificPrice.php:576
462
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 0 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.135 ms 1 Yes /classes/SpecificPrice.php:576
472
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 0 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.135 ms 1 Yes /classes/SpecificPrice.php:576
483
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 0 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.135 ms 1 Yes /classes/SpecificPrice.php:576
494
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 0 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.135 ms 1 Yes /classes/SpecificPrice.php:576
529
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 543008 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 543008 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.135 ms 0 /classes/Cart.php:1430
534
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 0 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.135 ms 1 Yes /classes/SpecificPrice.php:576
221
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 548036 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 548036 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.134 ms 0 /classes/Cart.php:1430
242
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 547921 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 547921 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.134 ms 0 /classes/Cart.php:1430
345
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 546341
ORDER BY f.position ASC
0.134 ms 6 Yes /classes/Product.php:6021
406
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 545554 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 545554 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.134 ms 0 /classes/Cart.php:1430
427
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 544569
ORDER BY f.position ASC
0.134 ms 6 Yes /classes/Product.php:6021
561
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 542487
ORDER BY f.position ASC
0.134 ms 7 Yes /classes/Product.php:6021
1
SELECT SQL_NO_CACHE s.id_shop, CONCAT(su.physical_uri, su.virtual_uri) AS uri, su.domain, su.main
FROM een_shop_url su
LEFT JOIN een_shop s ON (s.id_shop = su.id_shop)
WHERE (su.domain = 'decozzia.com' OR su.domain_ssl = 'decozzia.com')
AND s.active = 1
AND s.deleted = 0
ORDER BY LENGTH(CONCAT(su.physical_uri, su.virtual_uri)) DESC
0.133 ms 1 Yes /classes/shop/Shop.php:1364
166
SELECT SQL_NO_CACHE v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `een_feature_value` v LEFT JOIN `een_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = 1) LEFT JOIN `een_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = 1) WHERE v.`id_feature` = 20 ORDER BY vl.`value` ASC
0.133 ms 9 Yes /modules/ps_facetedsearch/src/Filters/DataAccessor.php:204
284
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 547001 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 547001 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.133 ms 0 /classes/Cart.php:1430
294
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 546968 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 546968 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.133 ms 0 /classes/Cart.php:1430
468
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 544260
ORDER BY f.position ASC
0.133 ms 6 Yes /classes/Product.php:6021
488
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 543423 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 543423 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.133 ms 0 /classes/Cart.php:1430
376
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 545729 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 545729 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.133 ms 0 /classes/Cart.php:1430
458
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 544358
ORDER BY f.position ASC
0.133 ms 6 Yes /classes/Product.php:6021
319
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 0 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.132 ms 1 Yes /classes/SpecificPrice.php:576
329
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 0 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.132 ms 1 Yes /classes/SpecificPrice.php:576
426
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 544569 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 544569 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.132 ms 0 /classes/Cart.php:1430
447
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 544488 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 544488 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.132 ms 0 /classes/Cart.php:1430
448
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 544488
ORDER BY f.position ASC
0.132 ms 6 Yes /classes/Product.php:6021
467
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 544260 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 544260 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.132 ms 0 /classes/Cart.php:1430
510
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 543348
ORDER BY f.position ASC
0.132 ms 6 Yes /classes/Product.php:6021
437
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 544543 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 544543 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.132 ms 0 /classes/Cart.php:1430
457
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 544358 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 544358 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.132 ms 0 /classes/Cart.php:1430
309
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 0 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.131 ms 1 Yes /classes/SpecificPrice.php:576
339
SELECT SQL_NO_CACHE *, ( IF (`id_shop` = 1, 2, 0) +  IF (`id_country` = 21, 4, 0) +  IF (`id_currency` = 1, 8, 0) +  IF (`id_group` = 1, 16, 0) +  IF (`id_customer` = 0, 32, 0)) AS `score`
FROM `een_specific_price`
WHERE
`id_shop` IN (0, 1) AND
`id_currency` IN (0, 1) AND
`id_country` IN (0, 21) AND
`id_group` IN (0, 1) AND `id_product` = 0 AND `id_customer` = 0 AND `id_product_attribute` = 0 AND `id_cart` = 0  AND (`from` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' >= `from`) AND (`to` = '0000-00-00 00:00:00' OR '2026-04-28 00:00:00' <= `to`)
AND IF(`from_quantity` > 1, `from_quantity`, 0) <= 1 ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT 1
0.131 ms 1 Yes /classes/SpecificPrice.php:576
477
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 544028 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 544028 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.131 ms 0 /classes/Cart.php:1430
407
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 545554
ORDER BY f.position ASC
0.130 ms 5 Yes /classes/Product.php:6021
489
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 543423
ORDER BY f.position ASC
0.130 ms 5 Yes /classes/Product.php:6021
304
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 546867 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 546867 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.130 ms 0 /classes/Cart.php:1430
500
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 543357
ORDER BY f.position ASC
0.130 ms 6 Yes /classes/Product.php:6021
222
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 548036
ORDER BY f.position ASC
0.129 ms 5 Yes /classes/Product.php:6021
243
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 547921
ORDER BY f.position ASC
0.129 ms 5 Yes /classes/Product.php:6021
334
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 546348 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 546348 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.129 ms 0 /classes/Cart.php:1430
397
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 545693
ORDER BY f.position ASC
0.129 ms 5 Yes /classes/Product.php:6021
417
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 545474
ORDER BY f.position ASC
0.129 ms 6 Yes /classes/Product.php:6021
520
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 543106
ORDER BY f.position ASC
0.129 ms 5 Yes /classes/Product.php:6021
675
SELECT SQL_NO_CACHE * FROM `een_cart_rule` cr
LEFT JOIN `een_cart_rule_lang` crl 
ON (cr.`id_cart_rule` = crl.`id_cart_rule` AND crl.`id_lang` = 0) WHERE (cr.`id_customer` = 0) AND NOW() BETWEEN cr.date_from AND cr.date_to
AND cr.`active` = 1
AND cr.`quantity` > 0 AND highlight = 1 AND code NOT LIKE "BO_ORDER_%"
0.129 ms 1 /classes/CartRule.php:423
232
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 547985
ORDER BY f.position ASC
0.128 ms 6 Yes /classes/Product.php:6021
253
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 547665
ORDER BY f.position ASC
0.128 ms 6 Yes /classes/Product.php:6021
285
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 547001
ORDER BY f.position ASC
0.128 ms 6 Yes /classes/Product.php:6021
315
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 546692
ORDER BY f.position ASC
0.128 ms 5 Yes /classes/Product.php:6021
324
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 546464 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 546464 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.128 ms 0 /classes/Cart.php:1430
325
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 546464
ORDER BY f.position ASC
0.128 ms 6 Yes /classes/Product.php:6021
665
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 542706) AND (b.`id_shop` = 1) LIMIT 1
0.128 ms 1 /src/Adapter/EntityMapper.php:71
314
SELECT SQL_NO_CACHE COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), 0) as deep_quantity,
COALESCE(SUM(first_level_quantity), 0) as quantity
FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, 0 as pack_quantity
FROM `een_cart_product` cp
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND cp.`id_product` = 546692 UNION SELECT 0 as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
WHERE cp.`id_product_attribute` = 0
AND cp.`id_cart` = 0 AND p.`id_product_item` = 546692 AND (pr.`pack_stock_type` IN (1,2) OR (
pr.`pack_stock_type` = 3
AND 0 = 1
))) as q LIMIT 1
0.128 ms 0 /classes/Cart.php:1430
263
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 547376
ORDER BY f.position ASC
0.127 ms 6 Yes /classes/Product.php:6021
355
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 546058
ORDER BY f.position ASC
0.127 ms 5 Yes /classes/Product.php:6021
366
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 546031
ORDER BY f.position ASC
0.127 ms 5 Yes /classes/Product.php:6021
530
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 543008
ORDER BY f.position ASC
0.127 ms 5 Yes /classes/Product.php:6021
647
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 543423) AND (b.`id_shop` = 1) LIMIT 1
0.127 ms 1 /src/Adapter/EntityMapper.php:71
274
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 547204
ORDER BY f.position ASC
0.126 ms 6 Yes /classes/Product.php:6021
377
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 545729
ORDER BY f.position ASC
0.126 ms 5 Yes /classes/Product.php:6021
387
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 545709
ORDER BY f.position ASC
0.125 ms 5 Yes /classes/Product.php:6021
295
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 546968
ORDER BY f.position ASC
0.124 ms 5 Yes /classes/Product.php:6021
305
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 546867
ORDER BY f.position ASC
0.124 ms 4 Yes /classes/Product.php:6021
335
SELECT SQL_NO_CACHE name, value, pf.id_feature, f.position, fvl.id_feature_value
FROM een_feature_product pf
LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = 1)
LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = 1)
LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = 1)
INNER JOIN een_feature_shop feature_shop
ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = 1)
WHERE pf.id_product = 546348
ORDER BY f.position ASC
0.124 ms 5 Yes /classes/Product.php:6021
579
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 547665
ORDER BY `position`
0.124 ms 8 Yes /classes/Product.php:3545
578
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 547665) AND (b.`id_shop` = 1) LIMIT 1
0.123 ms 1 /src/Adapter/EntityMapper.php:71
650
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 543357) AND (b.`id_shop` = 1) LIMIT 1
0.123 ms 1 /src/Adapter/EntityMapper.php:71
562
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 548444) AND (b.`id_shop` = 1) LIMIT 1
0.122 ms 1 /src/Adapter/EntityMapper.php:71
629
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 544569) AND (b.`id_shop` = 1) LIMIT 1
0.122 ms 1 /src/Adapter/EntityMapper.php:71
614
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 545729) AND (b.`id_shop` = 1) LIMIT 1
0.121 ms 1 /src/Adapter/EntityMapper.php:71
623
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 545554) AND (b.`id_shop` = 1) LIMIT 1
0.121 ms 1 /src/Adapter/EntityMapper.php:71
618
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 545709
ORDER BY `position`
0.120 ms 10 Yes /classes/Product.php:3545
656
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 543106) AND (b.`id_shop` = 1) LIMIT 1
0.120 ms 1 /src/Adapter/EntityMapper.php:71
151
SELECT SQL_NO_CACHE type, id_value, filter_show_limit, filter_type FROM een_layered_category
WHERE controller = 'category'
AND id_category = 1000
AND id_shop = 1
GROUP BY `type`, id_value ORDER BY position ASC
0.119 ms 10 Yes Yes /modules/ps_facetedsearch/src/Filters/Provider.php:61
611
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 546031) AND (b.`id_shop` = 1) LIMIT 1
0.119 ms 1 /src/Adapter/EntityMapper.php:71
626
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 545474) AND (b.`id_shop` = 1) LIMIT 1
0.119 ms 1 /src/Adapter/EntityMapper.php:71
653
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 543348) AND (b.`id_shop` = 1) LIMIT 1
0.119 ms 1 /src/Adapter/EntityMapper.php:71
593
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 546867) AND (b.`id_shop` = 1) LIMIT 1
0.118 ms 1 /src/Adapter/EntityMapper.php:71
617
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 545709) AND (b.`id_shop` = 1) LIMIT 1
0.118 ms 1 /src/Adapter/EntityMapper.php:71
605
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 546341) AND (b.`id_shop` = 1) LIMIT 1
0.117 ms 1 /src/Adapter/EntityMapper.php:71
668
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 542487) AND (b.`id_shop` = 1) LIMIT 1
0.117 ms 1 /src/Adapter/EntityMapper.php:71
620
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 545693) AND (b.`id_shop` = 1) LIMIT 1
0.117 ms 1 /src/Adapter/EntityMapper.php:71
630
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 544569
ORDER BY `position`
0.117 ms 10 Yes /classes/Product.php:3545
644
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 544028) AND (b.`id_shop` = 1) LIMIT 1
0.117 ms 1 /src/Adapter/EntityMapper.php:71
608
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 546058) AND (b.`id_shop` = 1) LIMIT 1
0.116 ms 1 /src/Adapter/EntityMapper.php:71
662
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 542781) AND (b.`id_shop` = 1) LIMIT 1
0.116 ms 1 /src/Adapter/EntityMapper.php:71
596
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 546692) AND (b.`id_shop` = 1) LIMIT 1
0.116 ms 1 /src/Adapter/EntityMapper.php:71
624
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 545554
ORDER BY `position`
0.116 ms 8 Yes /classes/Product.php:3545
645
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 544028
ORDER BY `position`
0.116 ms 10 Yes /classes/Product.php:3545
606
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 546341
ORDER BY `position`
0.115 ms 8 Yes /classes/Product.php:3545
563
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 548444
ORDER BY `position`
0.114 ms 6 Yes /classes/Product.php:3545
581
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 547376) AND (b.`id_shop` = 1) LIMIT 1
0.114 ms 1 /src/Adapter/EntityMapper.php:71
584
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 547204) AND (b.`id_shop` = 1) LIMIT 1
0.114 ms 1 /src/Adapter/EntityMapper.php:71
594
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 546867
ORDER BY `position`
0.114 ms 7 Yes /classes/Product.php:3545
651
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 543357
ORDER BY `position`
0.114 ms 10 Yes /classes/Product.php:3545
18
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `een_module` m
LEFT JOIN `een_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
0.113 ms 104 /classes/module/Module.php:346
569
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 548036) AND (b.`id_shop` = 1) LIMIT 1
0.113 ms 1 /src/Adapter/EntityMapper.php:71
654
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 543348
ORDER BY `position`
0.113 ms 10 Yes /classes/Product.php:3545
676
SELECT SQL_NO_CACHE COUNT(*) FROM `een_orders` o
LEFT JOIN `een_order_cart_rule` ocr ON (ocr.`id_order` = o.`id_order`)
WHERE o.`id_customer` = 0
AND ocr.`deleted` = 0 AND ocr.`id_cart_rule` = 0 LIMIT 1
0.113 ms 1 /classes/order/Order.php:881
642
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 544260
ORDER BY `position`
0.112 ms 8 Yes /classes/Product.php:3545
761
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "ps_emailsubscription" LIMIT 1
0.112 ms 1 /classes/module/Module.php:2659
612
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 546031
ORDER BY `position`
0.111 ms 8 Yes /classes/Product.php:3545
635
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 544488) AND (b.`id_shop` = 1) LIMIT 1
0.111 ms 1 /src/Adapter/EntityMapper.php:71
587
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 547001) AND (b.`id_shop` = 1) LIMIT 1
0.110 ms 1 /src/Adapter/EntityMapper.php:71
609
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 546058
ORDER BY `position`
0.110 ms 8 Yes /classes/Product.php:3545
615
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 545729
ORDER BY `position`
0.110 ms 7 Yes /classes/Product.php:3545
657
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 543106
ORDER BY `position`
0.109 ms 8 Yes /classes/Product.php:3545
194
SELECT SQL_NO_CACHE tr.*
FROM `een_tax_rule` tr
JOIN `een_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 21
AND tr.`id_tax_rules_group` = 1
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.109 ms 1 /classes/tax/TaxRulesTaxManager.php:109
566
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 548406) AND (b.`id_shop` = 1) LIMIT 1
0.109 ms 1 /src/Adapter/EntityMapper.php:71
648
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 543423
ORDER BY `position`
0.109 ms 8 Yes /classes/Product.php:3545
669
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 542487
ORDER BY `position`
0.109 ms 5 Yes /classes/Product.php:3545
572
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 547985) AND (b.`id_shop` = 1) LIMIT 1
0.108 ms 1 /src/Adapter/EntityMapper.php:71
621
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 545693
ORDER BY `position`
0.108 ms 8 Yes /classes/Product.php:3545
545
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 542706)
0.107 ms 1 /classes/Product.php:3860
575
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 547921) AND (b.`id_shop` = 1) LIMIT 1
0.107 ms 1 /src/Adapter/EntityMapper.php:71
660
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 543008
ORDER BY `position`
0.107 ms 10 Yes /classes/Product.php:3545
674
SELECT SQL_NO_CACHE 1 FROM `een_cart_rule` WHERE ((date_to >= "2026-04-28 00:00:00" AND date_to <= "2026-04-28 23:59:59") OR (date_from >= "2026-04-28 00:00:00" AND date_from <= "2026-04-28 23:59:59") OR (date_from < "2026-04-28 00:00:00" AND date_to > "2026-04-28 23:59:59")) AND `id_customer` IN (0,0) LIMIT 1
0.107 ms 2 /classes/CartRule.php:357
24
SELECT SQL_NO_CACHE m.`id_module`, m.`name`, ms.`id_module`as `mshop`
FROM `een_module` m
LEFT JOIN `een_module_shop` ms
ON m.`id_module` = ms.`id_module`
AND ms.`id_shop` = 1
0.107 ms 104 /classes/module/Module.php:346
627
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 545474
ORDER BY `position`
0.107 ms 7 Yes /classes/Product.php:3545
63
SELECT SQL_NO_CACHE *
FROM `een_category` a0
LEFT JOIN `een_category_lang` `a1` ON (a0.`id_category` = a1.`id_category`)
WHERE (a0.`nleft` < 3) AND (a0.`nright` > 346) AND (a1.`id_lang` = 1) AND (a1.`id_shop` = 1)
ORDER BY a0.`nleft` asc
0.106 ms 2 /classes/PrestaShopCollection.php:383
599
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 546464) AND (b.`id_shop` = 1) LIMIT 1
0.106 ms 1 /src/Adapter/EntityMapper.php:71
663
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 542781
ORDER BY `position`
0.106 ms 5 Yes /classes/Product.php:3545
666
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 542706
ORDER BY `position`
0.106 ms 5 Yes /classes/Product.php:3545
638
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 544358) AND (b.`id_shop` = 1) LIMIT 1
0.105 ms 1 /src/Adapter/EntityMapper.php:71
567
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 548406
ORDER BY `position`
0.104 ms 8 Yes /classes/Product.php:3545
602
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 546348) AND (b.`id_shop` = 1) LIMIT 1
0.104 ms 1 /src/Adapter/EntityMapper.php:71
590
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 546968) AND (b.`id_shop` = 1) LIMIT 1
0.102 ms 1 /src/Adapter/EntityMapper.php:71
632
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 544543) AND (b.`id_shop` = 1) LIMIT 1
0.101 ms 1 /src/Adapter/EntityMapper.php:71
597
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 546692
ORDER BY `position`
0.099 ms 8 Yes /classes/Product.php:3545
659
SELECT SQL_NO_CACHE *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = 1
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = 1
WHERE (a.`id_product` = 543008) AND (b.`id_shop` = 1) LIMIT 1
0.099 ms 1 /src/Adapter/EntityMapper.php:71
43
SELECT SQL_NO_CACHE *
FROM `een_category` a
LEFT JOIN `een_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `een_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 1030) AND (b.`id_shop` = 1) LIMIT 1
0.098 ms 1 /src/Adapter/EntityMapper.php:71
582
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 547376
ORDER BY `position`
0.098 ms 7 Yes /classes/Product.php:3545
588
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 547001
ORDER BY `position`
0.097 ms 8 Yes /classes/Product.php:3545
541
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 542706
AND image_shop.`cover` = 1 LIMIT 1
0.096 ms 5 /classes/Product.php:3570
570
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 548036
ORDER BY `position`
0.096 ms 7 Yes /classes/Product.php:3545
573
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 547985
ORDER BY `position`
0.096 ms 8 Yes /classes/Product.php:3545
179
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 548444
AND image_shop.`cover` = 1 LIMIT 1
0.095 ms 6 /classes/Product.php:3570
636
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 544488
ORDER BY `position`
0.095 ms 8 Yes /classes/Product.php:3545
671
SELECT SQL_NO_CACHE c.id_elementor FROM een_iqit_elementor_category c WHERE c.id_category = 1000 LIMIT 1
0.095 ms 62 /modules/iqitelementor/src/IqitElementorCategory.php:87
576
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 547921
ORDER BY `position`
0.094 ms 7 Yes /classes/Product.php:3545
591
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 546968
ORDER BY `position`
0.094 ms 8 Yes /classes/Product.php:3545
585
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 547204
ORDER BY `position`
0.093 ms 6 Yes /classes/Product.php:3545
600
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 546464
ORDER BY `position`
0.093 ms 7 Yes /classes/Product.php:3545
639
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 544358
ORDER BY `position`
0.092 ms 8 Yes /classes/Product.php:3545
633
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 544543
ORDER BY `position`
0.092 ms 9 Yes /classes/Product.php:3545
69
BEGIN
0.089 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:81
603
SELECT SQL_NO_CACHE image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = 1)
WHERE i.`id_product` = 546348
ORDER BY `position`
0.089 ms 6 Yes /classes/Product.php:3545
12
SELECT SQL_NO_CACHE COUNT(DISTINCT l.id_lang) FROM `een_lang` l
JOIN een_lang_shop lang_shop ON (lang_shop.id_lang = l.id_lang AND lang_shop.id_shop = 1)
WHERE l.`active` = 1 LIMIT 1
0.088 ms 1 /classes/Language.php:1216
190
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 548444)
0.088 ms 1 /classes/Product.php:3860
206
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 548406)
0.086 ms 1 /classes/Product.php:3860
217
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 548036)
0.086 ms 1 /classes/Product.php:3860
556
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 542487)
0.086 ms 1 /classes/Product.php:3860
310
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 546692)
0.085 ms 1 /classes/Product.php:3860
361
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 546031)
0.085 ms 1 /classes/Product.php:3860
418
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 544569
AND image_shop.`cover` = 1 LIMIT 1
0.085 ms 10 /classes/Product.php:3570
428
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 544543
AND image_shop.`cover` = 1 LIMIT 1
0.085 ms 9 /classes/Product.php:3570
449
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 544358
AND image_shop.`cover` = 1 LIMIT 1
0.085 ms 8 /classes/Product.php:3570
201
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 548406
AND image_shop.`cover` = 1 LIMIT 1
0.085 ms 8 /classes/Product.php:3570
412
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 545474)
0.084 ms 1 /classes/Product.php:3860
515
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 543106)
0.084 ms 1 /classes/Product.php:3860
25
SELECT SQL_NO_CACHE *
FROM `een_category` a
LEFT JOIN `een_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `een_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 1000) AND (b.`id_shop` = 1) LIMIT 1
0.083 ms 1 /src/Adapter/EntityMapper.php:71
227
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 547985)
0.083 ms 1 /classes/Product.php:3860
350
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 546058)
0.083 ms 1 /classes/Product.php:3860
408
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 545474
AND image_shop.`cover` = 1 LIMIT 1
0.083 ms 7 /classes/Product.php:3570
469
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 544028
AND image_shop.`cover` = 1 LIMIT 1
0.083 ms 10 /classes/Product.php:3570
479
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 543423
AND image_shop.`cover` = 1 LIMIT 1
0.083 ms 8 /classes/Product.php:3570
505
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 543348)
0.083 ms 1 /classes/Product.php:3860
300
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 546867)
0.082 ms 1 /classes/Product.php:3860
346
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 546058
AND image_shop.`cover` = 1 LIMIT 1
0.082 ms 8 /classes/Product.php:3570
372
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 545729)
0.082 ms 1 /classes/Product.php:3860
378
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 545709
AND image_shop.`cover` = 1 LIMIT 1
0.082 ms 10 /classes/Product.php:3570
382
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 545709)
0.082 ms 1 /classes/Product.php:3860
392
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 545693)
0.082 ms 1 /classes/Product.php:3860
398
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 545554
AND image_shop.`cover` = 1 LIMIT 1
0.082 ms 8 /classes/Product.php:3570
402
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 545554)
0.082 ms 1 /classes/Product.php:3860
433
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 544543)
0.082 ms 1 /classes/Product.php:3860
439
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 544488
AND image_shop.`cover` = 1 LIMIT 1
0.082 ms 8 /classes/Product.php:3570
443
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 544488)
0.082 ms 1 /classes/Product.php:3860
459
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 544260
AND image_shop.`cover` = 1 LIMIT 1
0.082 ms 8 /classes/Product.php:3570
473
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 544028)
0.082 ms 1 /classes/Product.php:3860
501
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 543348
AND image_shop.`cover` = 1 LIMIT 1
0.082 ms 10 /classes/Product.php:3570
763
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "iqitsociallogin" LIMIT 1
0.082 ms 1 /classes/module/Module.php:2659
212
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 548036
AND image_shop.`cover` = 1 LIMIT 1
0.082 ms 7 /classes/Product.php:3570
238
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 547921)
0.081 ms 1 /classes/Product.php:3860
248
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 547665)
0.081 ms 1 /classes/Product.php:3860
356
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 546031
AND image_shop.`cover` = 1 LIMIT 1
0.081 ms 8 /classes/Product.php:3570
422
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 544569)
0.081 ms 1 /classes/Product.php:3860
453
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 544358)
0.081 ms 1 /classes/Product.php:3860
463
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 544260)
0.081 ms 1 /classes/Product.php:3860
484
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 543423)
0.081 ms 1 /classes/Product.php:3860
490
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 543357
AND image_shop.`cover` = 1 LIMIT 1
0.081 ms 10 /classes/Product.php:3570
495
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 543357)
0.081 ms 1 /classes/Product.php:3860
521
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 543008
AND image_shop.`cover` = 1 LIMIT 1
0.081 ms 10 /classes/Product.php:3570
525
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 543008)
0.081 ms 1 /classes/Product.php:3860
535
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 542781)
0.081 ms 1 /classes/Product.php:3860
258
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 547376)
0.081 ms 1 /classes/Product.php:3860
46
SELECT SQL_NO_CACHE *
FROM `een_category` a
LEFT JOIN `een_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `een_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 5728) AND (b.`id_shop` = 1) LIMIT 1
0.080 ms 1 /src/Adapter/EntityMapper.php:71
223
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 547985
AND image_shop.`cover` = 1 LIMIT 1
0.080 ms 8 /classes/Product.php:3570
275
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 547001
AND image_shop.`cover` = 1 LIMIT 1
0.080 ms 8 /classes/Product.php:3570
280
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 547001)
0.080 ms 1 /classes/Product.php:3860
511
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 543106
AND image_shop.`cover` = 1 LIMIT 1
0.080 ms 8 /classes/Product.php:3570
29
SELECT SQL_NO_CACHE *
FROM `een_currency` a
LEFT JOIN `een_currency_lang` `b` ON a.`id_currency` = b.`id_currency` AND b.`id_lang` = 1
LEFT JOIN `een_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
0.080 ms 1 /src/Adapter/EntityMapper.php:71
269
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 547204)
0.080 ms 1 /classes/Product.php:3860
320
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 546464)
0.079 ms 1 /classes/Product.php:3860
340
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 546341)
0.079 ms 1 /classes/Product.php:3860
367
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 545729
AND image_shop.`cover` = 1 LIMIT 1
0.079 ms 7 /classes/Product.php:3570
290
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 546968)
0.079 ms 1 /classes/Product.php:3860
330
SELECT SQL_NO_CACHE product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,0) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = 1)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = 1)
WHERE (p.`id_product` = 546348)
0.079 ms 1 /classes/Product.php:3860
44
SELECT SQL_NO_CACHE *
FROM `een_category` a
LEFT JOIN `een_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `een_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 1031) AND (b.`id_shop` = 1) LIMIT 1
0.078 ms 1 /src/Adapter/EntityMapper.php:71
244
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 547665
AND image_shop.`cover` = 1 LIMIT 1
0.078 ms 8 /classes/Product.php:3570
388
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 545693
AND image_shop.`cover` = 1 LIMIT 1
0.078 ms 8 /classes/Product.php:3570
7
SELECT SQL_NO_CACHE *
FROM `een_country` a
LEFT JOIN `een_country_lang` `b` ON a.`id_country` = b.`id_country` AND b.`id_lang` = 1
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 8) LIMIT 1
0.077 ms 1 /src/Adapter/EntityMapper.php:71
154
SELECT SQL_NO_CACHE *
FROM `een_category` a
LEFT JOIN `een_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 1000) LIMIT 1
0.077 ms 1 /src/Adapter/EntityMapper.php:71
157
SELECT SQL_NO_CACHE data FROM een_layered_filter_block WHERE hash="184cd098da9a1a78de8e20ead7c74ee4" LIMIT 1
0.077 ms 1 /modules/ps_facetedsearch/src/Filters/Block.php:186
233
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 547921
AND image_shop.`cover` = 1 LIMIT 1
0.077 ms 7 /classes/Product.php:3570
254
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 547376
AND image_shop.`cover` = 1 LIMIT 1
0.077 ms 7 /classes/Product.php:3570
296
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 546867
AND image_shop.`cover` = 1 LIMIT 1
0.077 ms 7 /classes/Product.php:3570
336
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 546341
AND image_shop.`cover` = 1 LIMIT 1
0.077 ms 8 /classes/Product.php:3570
531
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 542781
AND image_shop.`cover` = 1 LIMIT 1
0.077 ms 5 /classes/Product.php:3570
551
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 542487
AND image_shop.`cover` = 1 LIMIT 1
0.077 ms 5 /classes/Product.php:3570
264
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 547204
AND image_shop.`cover` = 1 LIMIT 1
0.076 ms 6 /classes/Product.php:3570
306
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 546692
AND image_shop.`cover` = 1 LIMIT 1
0.076 ms 8 /classes/Product.php:3570
316
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 546464
AND image_shop.`cover` = 1 LIMIT 1
0.076 ms 7 /classes/Product.php:3570
64
SELECT SQL_NO_CACHE * FROM een_revslider_sliders
0.075 ms 1 /modules/revsliderprestashop/includes/revslider_db.class.php:214
286
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 546968
AND image_shop.`cover` = 1 LIMIT 1
0.075 ms 8 /classes/Product.php:3570
326
SELECT SQL_NO_CACHE image_shop.`id_image`
FROM `een_image` i
INNER JOIN een_image_shop image_shop
ON (image_shop.id_image = i.id_image AND image_shop.id_shop = 1)
WHERE i.`id_product` = 546348
AND image_shop.`cover` = 1 LIMIT 1
0.074 ms 6 /classes/Product.php:3570
45
SELECT SQL_NO_CACHE *
FROM `een_category` a
LEFT JOIN `een_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `een_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 5735) AND (b.`id_shop` = 1) LIMIT 1
0.070 ms 1 /src/Adapter/EntityMapper.php:71
47
SELECT SQL_NO_CACHE *
FROM `een_category` a
LEFT JOIN `een_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `een_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 5723) AND (b.`id_shop` = 1) LIMIT 1
0.070 ms 1 /src/Adapter/EntityMapper.php:71
155
SELECT SQL_NO_CACHE *
FROM `een_category_lang`
WHERE `id_category` = 1000 AND `id_shop` = 1
0.069 ms 1 /src/Adapter/EntityMapper.php:79
0
SELECT SQL_NO_CACHE * FROM een_memcached_servers
0.068 ms 1 /classes/cache/CacheMemcached.php:263
57
SELECT SQL_NO_CACHE * FROM `een_image_type` WHERE 1 AND `products` = 1  ORDER BY `width` DESC, `height` DESC, `name`ASC
0.068 ms 8 Yes /classes/ImageType.php:109
26
SELECT SQL_NO_CACHE * FROM `een_currency` c ORDER BY `iso_code` ASC
0.068 ms 1 Yes /classes/Currency.php:709
117
SELECT SQL_NO_CACHE *
FROM `een_country` a
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 8) LIMIT 1
0.068 ms 1 /src/Adapter/EntityMapper.php:71
48
SELECT SQL_NO_CACHE *
FROM `een_category` a
LEFT JOIN `een_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `een_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 1027) AND (b.`id_shop` = 1) LIMIT 1
0.067 ms 1 /src/Adapter/EntityMapper.php:71
679
SELECT SQL_NO_CACHE COUNT(DISTINCT c.id_currency) FROM `een_currency` c
LEFT JOIN een_currency_shop cs ON (cs.id_currency = c.id_currency AND cs.id_shop = 1)
WHERE c.`active` = 1 AND c.`deleted` = 0 LIMIT 1
0.067 ms 1 /classes/Currency.php:1136
688
SELECT SQL_NO_CACHE SUM(`quantity`)
FROM `een_cart_product`
WHERE `id_cart` = 0 LIMIT 1
0.067 ms 1 /classes/Cart.php:1303
6
SELECT SQL_NO_CACHE l.*, ls.`id_shop`
FROM `een_lang` l
LEFT JOIN `een_lang_shop` ls ON (l.id_lang = ls.id_lang)
0.066 ms 1 /classes/Language.php:1080
202
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 5727 LIMIT 1
0.066 ms 1 /classes/Category.php:1378
762
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 19 AND `id_shop` = 1 LIMIT 1
0.066 ms 0 /classes/module/Module.php:2132
50
SELECT SQL_NO_CACHE *
FROM `een_category` a
LEFT JOIN `een_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `een_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 426) AND (b.`id_shop` = 1) LIMIT 1
0.065 ms 1 /src/Adapter/EntityMapper.php:71
146
SELECT SQL_NO_CACHE *
FROM `een_country` a
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 186) LIMIT 1
0.065 ms 1 /src/Adapter/EntityMapper.php:71
395
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 545693) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.065 ms 1 /classes/stock/StockAvailable.php:453
49
SELECT SQL_NO_CACHE *
FROM `een_category` a
LEFT JOIN `een_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = 1
LEFT JOIN `een_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = 1
WHERE (a.`id_category` = 411) AND (b.`id_shop` = 1) LIMIT 1
0.065 ms 1 /src/Adapter/EntityMapper.php:71
5
SELECT SQL_NO_CACHE su.physical_uri, su.virtual_uri, su.domain, su.domain_ssl
FROM een_shop s
LEFT JOIN een_shop_url su ON (s.id_shop = su.id_shop)
WHERE s.id_shop = 1
AND s.active = 1 AND s.deleted = 0 AND su.main = 1 LIMIT 1
0.064 ms 1 /classes/shop/Shop.php:218
32
SELECT SQL_NO_CACHE *
FROM `een_country` a
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 21) LIMIT 1
0.064 ms 1 /src/Adapter/EntityMapper.php:71
197
SELECT SQL_NO_CACHE tr.*
FROM `een_tax_rule` tr
JOIN `een_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
WHERE trg.`active` = 1
AND tr.`id_country` = 21
AND tr.`id_tax_rules_group` = 0
AND tr.`id_state` IN (0, 0)
AND ('0' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
OR (tr.`zipcode_to` = 0 AND tr.`zipcode_from` IN(0, '0')))
ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
0.064 ms 0 /classes/tax/TaxRulesTaxManager.php:109
119
SELECT SQL_NO_CACHE c.id_currency
FROM `een_currency` c
WHERE (deleted = 0) AND (iso_code = 'EUR') LIMIT 1
0.064 ms 1 /classes/Currency.php:893
134
SELECT SQL_NO_CACHE *
FROM `een_country` a
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 19) LIMIT 1
0.064 ms 1 /src/Adapter/EntityMapper.php:71
71
CREATE TABLE IF NOT EXISTS `een_gmcp_reporting` (`id_reporting` int(11) NOT NULL AUTO_INCREMENT,`iso_feed` LONGTEXT NOT NULL,    `reporting_content` LONGTEXT NOT NULL,`id_shop` int(11) NOT NULL,`date_add` datetime NOT NULL,`date_upd` datetime NOT NULL,PRIMARY KEY (`id_reporting`)) ENGINE=' . _MYSQL_ENGINE_ . ' DEFAULT CHARSET=utf8;
0.063 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
123
SELECT SQL_NO_CACHE c.id_currency
FROM `een_currency` c
WHERE (deleted = 0) AND (iso_code = 'DZD') LIMIT 1
0.063 ms 1 /classes/Currency.php:893
11
SELECT SQL_NO_CACHE domain, domain_ssl
FROM een_shop_url
WHERE main = 1
AND id_shop = 1 LIMIT 1
0.062 ms 1 /classes/shop/ShopUrl.php:182
580
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 547665
0.062 ms 1 /classes/Product.php:2902
765
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "iqitcookielaw" LIMIT 1
0.062 ms 1 /classes/module/Module.php:2659
17
SELECT SQL_NO_CACHE value FROM `een_configuration` WHERE `name` = "PS_MULTISHOP_FEATURE_ACTIVE" LIMIT 1
0.061 ms 1 /classes/shop/Shop.php:1183
129
SELECT SQL_NO_CACHE c.id_currency
FROM `een_currency` c
WHERE (deleted = 0) AND (iso_code = 'MGA') LIMIT 1
0.061 ms 1 /classes/Currency.php:893
131
SELECT SQL_NO_CACHE c.id_currency
FROM `een_currency` c
WHERE (deleted = 0) AND (iso_code = 'MAD') LIMIT 1
0.061 ms 1 /classes/Currency.php:893
142
SELECT SQL_NO_CACHE *
FROM `een_country` a
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 3) LIMIT 1
0.061 ms 1 /src/Adapter/EntityMapper.php:71
677
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "iqitlinksmanager" LIMIT 1
0.061 ms 1 /classes/module/Module.php:2659
115
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'FR' LIMIT 1
0.060 ms 1 /classes/Country.php:194
121
SELECT SQL_NO_CACHE c.id_currency
FROM `een_currency` c
WHERE (deleted = 0) AND (iso_code = 'TND') LIMIT 1
0.060 ms 1 /classes/Currency.php:893
37
SELECT SQL_NO_CACHE *
FROM `een_group` a
LEFT JOIN `een_group_shop` `c` ON a.`id_group` = c.`id_group` AND c.`id_shop` = 1
WHERE (a.`id_group` = 1) LIMIT 1
0.059 ms 1 /src/Adapter/EntityMapper.php:71
127
SELECT SQL_NO_CACHE c.id_currency
FROM `een_currency` c
WHERE (deleted = 0) AND (iso_code = 'XOF') LIMIT 1
0.059 ms 1 /classes/Currency.php:893
148
SELECT SQL_NO_CACHE id_order
FROM `een_orders` o
WHERE (o.id_cart=0) LIMIT 1
0.059 ms 1 /modules/gmerchantcenterpro/lib/dao/moduleDao.php:450
122
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'FR' LIMIT 1
0.059 ms 1 /classes/Country.php:194
183
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE id_product = 0 LIMIT 1
0.059 ms 1 /classes/SpecificPrice.php:426
343
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 546341) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.059 ms 1 /classes/stock/StockAvailable.php:453
595
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 546867
0.059 ms 1 /classes/Product.php:2902
31
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'US' LIMIT 1
0.058 ms 1 /classes/Country.php:194
138
SELECT SQL_NO_CACHE *
FROM `een_country` a
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 4) LIMIT 1
0.058 ms 1 /src/Adapter/EntityMapper.php:71
733
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "supercheckout" LIMIT 1
0.058 ms 0 /classes/module/Module.php:2659
15
SELECT SQL_NO_CACHE `name`, `alias` FROM `een_hook_alias`
0.057 ms 87 /classes/Hook.php:287
34
SELECT SQL_NO_CACHE *
FROM `een_currency` a
LEFT JOIN `een_currency_shop` `c` ON a.`id_currency` = c.`id_currency` AND c.`id_shop` = 1
WHERE (a.`id_currency` = 1) LIMIT 1
0.057 ms 1 /src/Adapter/EntityMapper.php:71
136
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'CA' LIMIT 1
0.057 ms 1 /classes/Country.php:194
149
SELECT SQL_NO_CACHE `name`
FROM `een_hook`
WHERE `id_hook` = 1013 LIMIT 1
0.057 ms 1 /classes/Hook.php:244
393
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 545693 AND id_shop=1 LIMIT 1
0.057 ms 1 /classes/Product.php:6876
764
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 93 AND `id_shop` = 1 LIMIT 1
0.057 ms 1 /classes/module/Module.php:2132
9
SELECT SQL_NO_CACHE *
FROM `een_lang` a
LEFT JOIN `een_lang_shop` `c` ON a.`id_lang` = c.`id_lang` AND c.`id_shop` = 1
WHERE (a.`id_lang` = 1) LIMIT 1
0.056 ms 1 /src/Adapter/EntityMapper.php:71
120
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'FR' LIMIT 1
0.056 ms 1 /classes/Country.php:194
124
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'FR' LIMIT 1
0.056 ms 1 /classes/Country.php:194
125
SELECT SQL_NO_CACHE c.id_currency
FROM `een_currency` c
WHERE (deleted = 0) AND (iso_code = 'XAF') LIMIT 1
0.056 ms 1 /classes/Currency.php:893
150
SELECT SQL_NO_CACHE `id_category`
FROM `een_category_shop`
WHERE `id_category` = 1000
AND `id_shop` = 1 LIMIT 1
0.056 ms 1 /classes/Category.php:2450
607
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 546341
0.056 ms 1 /classes/Product.php:2902
60
SELECT SQL_NO_CACHE *
FROM `een_country` a
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = 1
WHERE (a.`id_country` = 17) LIMIT 1
0.055 ms 1 /src/Adapter/EntityMapper.php:71
112
SELECT SQL_NO_CACHE id_feed
FROM `een_gmcp_feeds` ff
WHERE (ff.id_shop=1) LIMIT 1
0.055 ms 370 /modules/gmerchantcenterpro/models/Feeds.php:53
646
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 544028
0.055 ms 1 /classes/Product.php:2902
198
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 548444) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.055 ms 1 /classes/stock/StockAvailable.php:453
30
SELECT SQL_NO_CACHE `id_lang` FROM `een_lang`
WHERE `locale` = 'fr-fr'
OR `language_code` = 'fr-fr' LIMIT 1
0.054 ms 1 /classes/Language.php:883
65
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "pm_advancedpack" LIMIT 1
0.054 ms 0 /classes/module/Module.php:2659
130
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'FR' LIMIT 1
0.054 ms 1 /classes/Country.php:194
583
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 547376
0.054 ms 1 /classes/Product.php:2902
619
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 545709
0.054 ms 1 /classes/Product.php:2902
643
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 544260
0.054 ms 1 /classes/Product.php:2902
767
SELECT SQL_NO_CACHE data
FROM `een_ganalytics_data`
WHERE id_cart = 0
AND id_shop = 1 LIMIT 1
0.054 ms 0 /modules/ps_googleanalytics/classes/Repository/GanalyticsDataRepository.php:43
19
SELECT SQL_NO_CACHE name, alias FROM `een_hook_alias`
0.053 ms 87 /classes/Hook.php:339
143
SELECT SQL_NO_CACHE *
FROM `een_country_lang`
WHERE `id_country` = 3
0.053 ms 1 /src/Adapter/EntityMapper.php:79
4
SELECT SQL_NO_CACHE *
FROM `een_shop` a
WHERE (a.`id_shop` = 1) LIMIT 1
0.053 ms 1 /src/Adapter/EntityMapper.php:71
28
SELECT SQL_NO_CACHE c.id_currency
FROM `een_currency` c
WHERE (iso_code = 'EUR') LIMIT 1
0.053 ms 1 /classes/Currency.php:893
128
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'FR' LIMIT 1
0.053 ms 1 /classes/Country.php:194
132
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'CH' LIMIT 1
0.053 ms 1 /classes/Country.php:194
135
SELECT SQL_NO_CACHE *
FROM `een_country_lang`
WHERE `id_country` = 19
0.053 ms 1 /src/Adapter/EntityMapper.php:79
140
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'BE' LIMIT 1
0.053 ms 1 /classes/Country.php:194
144
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'SA' LIMIT 1
0.053 ms 1 /classes/Country.php:194
147
SELECT SQL_NO_CACHE *
FROM `een_country_lang`
WHERE `id_country` = 186
0.053 ms 1 /src/Adapter/EntityMapper.php:79
546
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 542706 AND id_shop=1 LIMIT 1
0.053 ms 1 /classes/Product.php:6876
625
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 545554
0.052 ms 1 /classes/Product.php:2902
610
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 546058
0.052 ms 1 /classes/Product.php:2902
613
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 546031
0.052 ms 1 /classes/Product.php:2902
616
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 545729
0.052 ms 1 /classes/Product.php:2902
631
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 544569
0.052 ms 1 /classes/Product.php:2902
649
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 543423
0.052 ms 1 /classes/Product.php:2902
652
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 543357
0.052 ms 1 /classes/Product.php:2902
655
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 543348
0.052 ms 1 /classes/Product.php:2902
658
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 543106
0.052 ms 1 /classes/Product.php:2902
680
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "ps_languageselector" LIMIT 1
0.052 ms 1 /classes/module/Module.php:2659
51
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "facebookproductsfeed" LIMIT 1
0.051 ms 0 /classes/module/Module.php:2659
118
SELECT SQL_NO_CACHE *
FROM `een_country_lang`
WHERE `id_country` = 8
0.051 ms 1 /src/Adapter/EntityMapper.php:79
126
SELECT SQL_NO_CACHE `id_country`
FROM `een_country`
WHERE `iso_code` = 'FR' LIMIT 1
0.051 ms 1 /classes/Country.php:194
139
SELECT SQL_NO_CACHE *
FROM `een_country_lang`
WHERE `id_country` = 4
0.051 ms 1 /src/Adapter/EntityMapper.php:79
203
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 5727 LIMIT 1
0.051 ms 1 /classes/Product.php:5659
542
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 2788 LIMIT 1
0.051 ms 1 /classes/Product.php:5659
548
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 542706) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.051 ms 1 /classes/stock/StockAvailable.php:453
628
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 545474
0.051 ms 1 /classes/Product.php:2902
664
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 542781
0.051 ms 1 /classes/Product.php:2902
670
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 542487
0.051 ms 1 /classes/Product.php:2902
752
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "attributewizardpro" LIMIT 1
0.051 ms 0 /classes/module/Module.php:2659
27
SELECT SQL_NO_CACHE `id_lang` FROM `een_lang`
WHERE `locale` = 'fr-fr'
OR `language_code` = 'fr-fr' LIMIT 1
0.051 ms 1 /classes/Language.php:883
667
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 542706
0.051 ms 1 /classes/Product.php:2902
8
SELECT SQL_NO_CACHE *
FROM `een_shop_group` a
WHERE (a.`id_shop_group` = 1) LIMIT 1
0.050 ms 1 /src/Adapter/EntityMapper.php:71
53
CREATE TABLE IF NOT EXISTS `een_revolut_payment_orders` (
`id` INT NOT NULL AUTO_INCREMENT,
`id_order` INT NULL ,
`id_cart` INT NULL ,
`id_revolut_order` VARCHAR(250) NOT NULL ,
`public_id` VARCHAR(250) NOT NULL ,
`save_card` TINYINT NOT NULL DEFAULT "0" ,
PRIMARY KEY (`id`),
UNIQUE (`id_revolut_order`),
UNIQUE (`id_order`)
) ENGINE = InnoDB;
0.050 ms 1 /modules/revolutpayment/revolutpayment.php:320
116
SELECT SQL_NO_CACHE `name`
FROM `een_country_lang`
WHERE `id_lang` = 1
AND `id_country` = 8 LIMIT 1
0.050 ms 1 /classes/Country.php:252
180
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 1031 LIMIT 1
0.050 ms 1 /classes/Category.php:1378
568
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 548406
0.050 ms 1 /classes/Product.php:2902
80
CREATE TABLE IF NOT EXISTS `een_gmcp_discount_association` (`id_association` int(11) NOT NULL AUTO_INCREMENT, `id_discount` int(11) NOT NULL, `id_product` int(11) NOT NULL, `channel` CHAR(120) NOT NULL DEFAULT "SHOPPING_ADS", PRIMARY KEY (`id_association`) ) ENGINE=MyISAM DEFAULT CHARSET=utf8;
0.050 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
622
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 545693
0.050 ms 1 /classes/Product.php:2902
33
SELECT SQL_NO_CACHE *
FROM `een_country_lang`
WHERE `id_country` = 21
0.049 ms 1 /src/Adapter/EntityMapper.php:79
55
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "ps_legalcompliance" LIMIT 1
0.049 ms 0 /classes/module/Module.php:2659
184
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE `id_product` != 0 LIMIT 1
0.049 ms 523 /classes/SpecificPrice.php:297
209
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 548406) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.049 ms 1 /classes/stock/StockAvailable.php:453
351
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 546058 AND id_shop=1 LIMIT 1
0.049 ms 1 /classes/Product.php:6876
689
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "iqitmegamenu" LIMIT 1
0.049 ms 1 /classes/module/Module.php:2659
21
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "ets_superspeed" LIMIT 1
0.048 ms 0 /classes/module/Module.php:2659
186
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE `from` BETWEEN '2026-04-28 00:00:00' AND '2026-04-28 23:59:59' LIMIT 1
0.048 ms 1 /classes/SpecificPrice.php:377
565
SELECT SQL_NO_CACHE state FROM een_feature_flag WHERE name = 'multiple_image_format' LIMIT 1
0.048 ms 1 /classes/FeatureFlag.php:105
586
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 547204
0.048 ms 1 /classes/Product.php:2902
58
SELECT SQL_NO_CACHE format
FROM `een_address_format`
WHERE `id_country` = 17 LIMIT 1
0.048 ms 1 /classes/AddressFormat.php:656
564
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 548444
0.048 ms 1 /classes/Product.php:2902
695
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "iqitcountdown" LIMIT 1
0.048 ms 1 /classes/module/Module.php:2659
207
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 548406 AND id_shop=1 LIMIT 1
0.047 ms 1 /classes/Product.php:6876
38
SELECT SQL_NO_CACHE *
FROM `een_group_lang`
WHERE `id_group` = 1
0.047 ms 1 /src/Adapter/EntityMapper.php:79
40
SELECT SQL_NO_CACHE `id_category`
FROM `een_category_shop`
WHERE `id_category` = 1000
AND `id_shop` = 1 LIMIT 1
0.047 ms 1 /classes/Category.php:2450
61
SELECT SQL_NO_CACHE *
FROM `een_country_lang`
WHERE `id_country` = 17
0.047 ms 1 /src/Adapter/EntityMapper.php:79
195
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 548444 AND `id_group` = 1 LIMIT 1
0.047 ms 0 /classes/GroupReduction.php:156
409
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 28 LIMIT 1
0.047 ms 1 /classes/Product.php:5659
512
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1015 LIMIT 1
0.047 ms 1 /classes/Product.php:5659
571
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 548036
0.047 ms 1 /classes/Product.php:2902
589
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 547001
0.047 ms 1 /classes/Product.php:2902
661
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 543008
0.047 ms 1 /classes/Product.php:2902
35
SELECT SQL_NO_CACHE *
FROM `een_currency_lang`
WHERE `id_currency` = 1
0.046 ms 1 /src/Adapter/EntityMapper.php:79
145
SELECT SQL_NO_CACHE `name`
FROM `een_country_lang`
WHERE `id_lang` = 1
AND `id_country` = 186 LIMIT 1
0.046 ms 1 /classes/Country.php:252
191
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 548444 AND id_shop=1 LIMIT 1
0.046 ms 1 /classes/Product.php:6876
429
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 418 LIMIT 1
0.046 ms 1 /classes/Category.php:1378
574
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 547985
0.046 ms 1 /classes/Product.php:2902
577
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 547921
0.046 ms 1 /classes/Product.php:2902
592
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 546968
0.046 ms 1 /classes/Product.php:2902
598
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 546692
0.046 ms 1 /classes/Product.php:2902
604
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 546348
0.046 ms 1 /classes/Product.php:2902
691
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "iqitproductsnav" LIMIT 1
0.046 ms 1 /classes/module/Module.php:2659
766
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 72 AND `id_shop` = 1 LIMIT 1
0.046 ms 1 /classes/module/Module.php:2132
137
SELECT SQL_NO_CACHE `name`
FROM `een_country_lang`
WHERE `id_lang` = 1
AND `id_country` = 4 LIMIT 1
0.046 ms 1 /classes/Country.php:252
213
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 1015 LIMIT 1
0.045 ms 1 /classes/Category.php:1378
419
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 28 LIMIT 1
0.045 ms 1 /classes/Product.php:5659
601
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 546464
0.045 ms 1 /classes/Product.php:2902
637
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 544488
0.045 ms 1 /classes/Product.php:2902
141
SELECT SQL_NO_CACHE `name`
FROM `een_country_lang`
WHERE `id_lang` = 1
AND `id_country` = 3 LIMIT 1
0.045 ms 1 /classes/Country.php:252
347
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 28 LIMIT 1
0.045 ms 1 /classes/Product.php:5659
23
SELECT SQL_NO_CACHE * FROM `een_hook_module_exceptions`
WHERE `id_shop` IN (1)
0.044 ms 1 /classes/module/Module.php:2041
204
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 548406
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.044 ms 0 /classes/SpecificPrice.php:259
399
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 5727 LIMIT 1
0.044 ms 1 /classes/Product.php:5659
480
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 5825 LIMIT 1
0.044 ms 1 /classes/Category.php:1378
552
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 441 LIMIT 1
0.044 ms 1 /classes/Category.php:1378
678
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 78 AND `id_shop` = 1 LIMIT 1
0.044 ms 1 /classes/module/Module.php:2132
62
SELECT SQL_NO_CACHE id_required_field, object_name, field_name
FROM een_required_field
0.044 ms 1 /classes/ObjectModel.php:1592
187
SELECT SQL_NO_CACHE 1 FROM `een_specific_price` WHERE `to` BETWEEN '2026-04-28 00:00:00' AND '2026-04-28 23:59:59' LIMIT 1
0.044 ms 1 /classes/SpecificPrice.php:381
208
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 548406 AND `id_group` = 1 LIMIT 1
0.044 ms 0 /classes/GroupReduction.php:156
311
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 546692 AND id_shop=1 LIMIT 1
0.044 ms 1 /classes/Product.php:6876
321
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 546464 AND id_shop=1 LIMIT 1
0.044 ms 1 /classes/Product.php:6876
333
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 546348) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.044 ms 1 /classes/stock/StockAvailable.php:453
353
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 546058) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.044 ms 1 /classes/stock/StockAvailable.php:453
357
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 2788 LIMIT 1
0.044 ms 1 /classes/Category.php:1378
368
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 1020 LIMIT 1
0.044 ms 1 /classes/Category.php:1378
634
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 544543
0.044 ms 1 /classes/Product.php:2902
640
SELECT SQL_NO_CACHE `id_product_attribute`
FROM `een_product_attribute`
WHERE `id_product` = 544358
0.044 ms 1 /classes/Product.php:2902
682
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "ps_currencyselector" LIMIT 1
0.044 ms 1 /classes/module/Module.php:2659
693
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "ps_facetedsearch" LIMIT 1
0.044 ms 1 /classes/module/Module.php:2659
218
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 548036 AND id_shop=1 LIMIT 1
0.043 ms 1 /classes/Product.php:6876
265
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 1027 LIMIT 1
0.043 ms 1 /classes/Category.php:1378
362
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 546031 AND id_shop=1 LIMIT 1
0.043 ms 1 /classes/Product.php:6876
389
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1015 LIMIT 1
0.043 ms 1 /classes/Product.php:5659
403
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 545554 AND id_shop=1 LIMIT 1
0.043 ms 1 /classes/Product.php:6876
423
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 544569 AND id_shop=1 LIMIT 1
0.043 ms 1 /classes/Product.php:6876
456
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 544358) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.043 ms 1 /classes/stock/StockAvailable.php:453
476
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 544028) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.043 ms 1 /classes/stock/StockAvailable.php:453
536
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 542781 AND id_shop=1 LIMIT 1
0.043 ms 1 /classes/Product.php:6876
133
SELECT SQL_NO_CACHE `name`
FROM `een_country_lang`
WHERE `id_lang` = 1
AND `id_country` = 19 LIMIT 1
0.043 ms 1 /classes/Country.php:252
220
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 548036) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.043 ms 1 /classes/stock/StockAvailable.php:453
224
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1015 LIMIT 1
0.043 ms 1 /classes/Product.php:5659
228
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 547985 AND id_shop=1 LIMIT 1
0.043 ms 1 /classes/Product.php:6876
276
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 1021 LIMIT 1
0.043 ms 1 /classes/Category.php:1378
364
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 546031) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.043 ms 1 /classes/stock/StockAvailable.php:453
379
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1015 LIMIT 1
0.043 ms 1 /classes/Product.php:5659
383
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 545709 AND id_shop=1 LIMIT 1
0.043 ms 1 /classes/Product.php:6876
405
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 545554) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.043 ms 1 /classes/stock/StockAvailable.php:453
413
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 545474 AND id_shop=1 LIMIT 1
0.043 ms 1 /classes/Product.php:6876
440
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 28 LIMIT 1
0.043 ms 1 /classes/Product.php:5659
454
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 544358 AND id_shop=1 LIMIT 1
0.043 ms 1 /classes/Product.php:6876
487
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 543423) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.043 ms 1 /classes/stock/StockAvailable.php:453
491
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 29 LIMIT 1
0.043 ms 1 /classes/Category.php:1378
502
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 29 LIMIT 1
0.043 ms 1 /classes/Product.php:5659
506
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 543348 AND id_shop=1 LIMIT 1
0.043 ms 1 /classes/Product.php:6876
518
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 543106) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.043 ms 1 /classes/stock/StockAvailable.php:453
522
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 418 LIMIT 1
0.043 ms 1 /classes/Product.php:5659
436
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 544543) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.042 ms 1 /classes/stock/StockAvailable.php:453
464
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 544260 AND id_shop=1 LIMIT 1
0.042 ms 1 /classes/Product.php:6876
470
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 418 LIMIT 1
0.042 ms 1 /classes/Product.php:5659
496
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 543357 AND id_shop=1 LIMIT 1
0.042 ms 1 /classes/Product.php:6876
528
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 543008) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.042 ms 1 /classes/stock/StockAvailable.php:453
532
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1015 LIMIT 1
0.042 ms 1 /classes/Product.php:5659
559
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 542487) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.042 ms 1 /classes/stock/StockAvailable.php:453
41
SELECT SQL_NO_CACHE ctg.`id_group`
FROM een_category_group ctg
WHERE ctg.`id_category` = 1000 AND ctg.`id_group` = 1 LIMIT 1
0.042 ms 1 /classes/Category.php:1754
68
SELECT SQL_NO_CACHE * FROM `een_image_type`
0.042 ms 8 /classes/ImageType.php:161
81
CREATE TABLE IF NOT EXISTS `een_gmcp_tags` (`id_tag` int(11) NOT NULL AUTO_INCREMENT, `id_shop` int(11) NOT NULL DEFAULT "1", `name` char(255) NOT NULL, `type` char(255) NOT NULL, `active` TINYINT NOT NULL, `position` INT NOT NULL, `end_date` DATE, PRIMARY KEY (`id_tag`)) ENGINE=MyISAM DEFAULT CHARSET=utf8 AUTO_INCREMENT=1 ;
0.042 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
230
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 547985) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.042 ms 1 /classes/stock/StockAvailable.php:453
234
SELECT SQL_NO_CACHE cl.`link_rewrite`
FROM `een_category_lang` cl
WHERE `id_lang` = 1
AND cl.id_shop = 1 
AND cl.`id_category` = 28 LIMIT 1
0.042 ms 1 /classes/Category.php:1378
245
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 28 LIMIT 1
0.042 ms 1 /classes/Product.php:5659
249
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 547665 AND id_shop=1 LIMIT 1
0.042 ms 1 /classes/Product.php:6876
373
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 545729 AND id_shop=1 LIMIT 1
0.042 ms 1 /classes/Product.php:6876
375
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 545729) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.042 ms 1 /classes/stock/StockAvailable.php:453
415
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 545474) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.042 ms 1 /classes/stock/StockAvailable.php:453
425
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 544569) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.042 ms 1 /classes/stock/StockAvailable.php:453
434
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 544543 AND id_shop=1 LIMIT 1
0.042 ms 1 /classes/Product.php:6876
446
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 544488) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.042 ms 1 /classes/stock/StockAvailable.php:453
450
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1015 LIMIT 1
0.042 ms 1 /classes/Product.php:5659
460
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 5727 LIMIT 1
0.042 ms 1 /classes/Product.php:5659
466
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 544260) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.042 ms 1 /classes/stock/StockAvailable.php:453
474
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 544028 AND id_shop=1 LIMIT 1
0.042 ms 1 /classes/Product.php:6876
498
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 543357) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.042 ms 1 /classes/stock/StockAvailable.php:453
508
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 543348) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.042 ms 1 /classes/stock/StockAvailable.php:453
516
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 543106 AND id_shop=1 LIMIT 1
0.042 ms 1 /classes/Product.php:6876
526
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 543008 AND id_shop=1 LIMIT 1
0.042 ms 1 /classes/Product.php:6876
182
SELECT SQL_NO_CACHE `name`
FROM `een_manufacturer`
WHERE `id_manufacturer` = 11523
AND `active` = 1 LIMIT 1
0.041 ms 1 /classes/Manufacturer.php:316
239
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 547921 AND id_shop=1 LIMIT 1
0.041 ms 1 /classes/Product.php:6876
241
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 547921) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.041 ms 1 /classes/stock/StockAvailable.php:453
251
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 547665) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.041 ms 1 /classes/stock/StockAvailable.php:453
255
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1015 LIMIT 1
0.041 ms 1 /classes/Product.php:5659
259
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 547376 AND id_shop=1 LIMIT 1
0.041 ms 1 /classes/Product.php:6876
281
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 547001 AND id_shop=1 LIMIT 1
0.041 ms 1 /classes/Product.php:6876
301
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 546867 AND id_shop=1 LIMIT 1
0.041 ms 1 /classes/Product.php:6876
317
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1015 LIMIT 1
0.041 ms 1 /classes/Product.php:5659
341
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 546341 AND id_shop=1 LIMIT 1
0.041 ms 1 /classes/Product.php:6876
385
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 545709) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.041 ms 1 /classes/stock/StockAvailable.php:453
444
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 544488 AND id_shop=1 LIMIT 1
0.041 ms 1 /classes/Product.php:6876
485
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 543423 AND id_shop=1 LIMIT 1
0.041 ms 1 /classes/Product.php:6876
538
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 542781) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.041 ms 1 /classes/stock/StockAvailable.php:453
734
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.041 ms 0 /classes/module/Module.php:2132
36
SELECT SQL_NO_CACHE id_shop
FROM `een_currency_shop`
WHERE `id_currency` = 1
AND id_shop = 1 LIMIT 1
0.040 ms 1 /classes/ObjectModel.php:1729
261
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 547376) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.040 ms 1 /classes/stock/StockAvailable.php:453
270
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 547204 AND id_shop=1 LIMIT 1
0.040 ms 1 /classes/Product.php:6876
283
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 547001) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.040 ms 1 /classes/stock/StockAvailable.php:453
291
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 546968 AND id_shop=1 LIMIT 1
0.040 ms 1 /classes/Product.php:6876
293
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 546968) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.040 ms 1 /classes/stock/StockAvailable.php:453
297
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1015 LIMIT 1
0.040 ms 1 /classes/Product.php:5659
313
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 546692) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.040 ms 1 /classes/stock/StockAvailable.php:453
327
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1015 LIMIT 1
0.040 ms 1 /classes/Product.php:5659
331
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 546348 AND id_shop=1 LIMIT 1
0.040 ms 1 /classes/Product.php:6876
543
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 542706
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.040 ms 0 /classes/SpecificPrice.php:259
557
SELECT SQL_NO_CACHE `id_tax_rules_group`
FROM `een_product_shop`
WHERE `id_product` = 542487 AND id_shop=1 LIMIT 1
0.040 ms 1 /classes/Product.php:6876
683
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 7 AND `id_shop` = 1 LIMIT 1
0.040 ms 1 /classes/module/Module.php:2132
686
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "iqitcompare" LIMIT 1
0.040 ms 1 /classes/module/Module.php:2659
758
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "blockwishlist" LIMIT 1
0.040 ms 1 /classes/module/Module.php:2659
287
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 28 LIMIT 1
0.040 ms 1 /classes/Product.php:5659
307
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 28 LIMIT 1
0.040 ms 1 /classes/Product.php:5659
337
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 5727 LIMIT 1
0.040 ms 1 /classes/Product.php:5659
272
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 547204) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.039 ms 1 /classes/stock/StockAvailable.php:453
303
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 546867) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.039 ms 1 /classes/stock/StockAvailable.php:453
323
SELECT SQL_NO_CACHE SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = 546464) AND (id_product_attribute = 0) AND (id_shop = 1) AND (id_shop_group = 0) LIMIT 1
0.039 ms 1 /classes/stock/StockAvailable.php:453
10
SELECT SQL_NO_CACHE id_shop
FROM `een_lang_shop`
WHERE `id_lang` = 1
AND id_shop = 1 LIMIT 1
0.039 ms 1 /classes/ObjectModel.php:1729
39
SELECT SQL_NO_CACHE id_shop
FROM `een_group_shop`
WHERE `id_group` = 1
AND id_shop = 1 LIMIT 1
0.039 ms 1 /classes/ObjectModel.php:1729
430
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 418 LIMIT 1
0.039 ms 1 /classes/Product.php:5659
681
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 6 AND `id_shop` = 1 LIMIT 1
0.039 ms 1 /classes/module/Module.php:2132
72
CREATE TABLE IF NOT EXISTS `een_gmcp_feeds` (`id_feed` int(11) NOT NULL AUTO_INCREMENT,`iso_lang` LONGTEXT NOT NULL,`iso_country` LONGTEXT NOT NULL,`iso_currency` LONGTEXT NOT NULL, `taxonomy` LONGTEXT NOT NULL, `id_shop` int(11) NOT NULL,`date_add` datetime NOT NULL,`date_upd` datetime NOT NULL,PRIMARY KEY (`id_feed`)) ENGINE=' . _MYSQL_ENGINE_ . ' DEFAULT CHARSET=utf8;
0.038 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
181
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1031 LIMIT 1
0.038 ms 1 /classes/Product.php:5659
513
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 543106
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.038 ms 0 /classes/SpecificPrice.php:259
533
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 542781
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.038 ms 0 /classes/SpecificPrice.php:259
188
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 548444
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.038 ms 0 /classes/SpecificPrice.php:259
196
SELECT SQL_NO_CACHE `reduction`
FROM `een_group`
WHERE `id_group` = 1 LIMIT 1
0.038 ms 1 /classes/Group.php:154
690
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 79 AND `id_shop` = 1 LIMIT 1
0.038 ms 1 /classes/module/Module.php:2132
547
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 542706 AND `id_group` = 1 LIMIT 1
0.037 ms 0 /classes/GroupReduction.php:156
696
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 74 AND `id_shop` = 1 LIMIT 1
0.037 ms 1 /classes/module/Module.php:2132
52
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.037 ms 0 /classes/module/Module.php:2132
78
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_last_product_not_ordered` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `last_product_ordered` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
0.037 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
332
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 546348 AND `id_group` = 1 LIMIT 1
0.037 ms 0 /classes/GroupReduction.php:156
348
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 546058
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.037 ms 0 /classes/SpecificPrice.php:259
394
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 545693 AND `id_group` = 1 LIMIT 1
0.037 ms 0 /classes/GroupReduction.php:156
400
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 545554
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.037 ms 0 /classes/SpecificPrice.php:259
692
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 81 AND `id_shop` = 1 LIMIT 1
0.037 ms 1 /classes/module/Module.php:2132
66
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "gsnippetsreviews" LIMIT 1
0.036 ms 0 /classes/module/Module.php:2659
410
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 545474
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.036 ms 0 /classes/SpecificPrice.php:259
441
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 544488
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.036 ms 0 /classes/SpecificPrice.php:259
694
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 24 AND `id_shop` = 1 LIMIT 1
0.036 ms 1 /classes/module/Module.php:2132
736
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.036 ms 0 /classes/module/Module.php:2132
214
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1015 LIMIT 1
0.035 ms 1 /classes/Product.php:5659
215
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 548036
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.035 ms 0 /classes/SpecificPrice.php:259
225
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 547985
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.035 ms 0 /classes/SpecificPrice.php:259
352
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 546058 AND `id_group` = 1 LIMIT 1
0.035 ms 0 /classes/GroupReduction.php:156
420
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 544569
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.035 ms 0 /classes/SpecificPrice.php:259
481
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 5825 LIMIT 1
0.035 ms 1 /classes/Product.php:5659
523
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 543008
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.035 ms 0 /classes/SpecificPrice.php:259
59
SELECT SQL_NO_CACHE `need_identification_number`
FROM `een_country`
WHERE `id_country` = 17 LIMIT 1
0.035 ms 1 /classes/Country.php:405
358
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 2788 LIMIT 1
0.035 ms 1 /classes/Product.php:5659
380
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 545709
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.034 ms 0 /classes/SpecificPrice.php:259
390
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 545693
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.034 ms 0 /classes/SpecificPrice.php:259
431
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 544543
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.034 ms 0 /classes/SpecificPrice.php:259
471
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 544028
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.034 ms 0 /classes/SpecificPrice.php:259
482
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 543423
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.034 ms 0 /classes/SpecificPrice.php:259
492
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 29 LIMIT 1
0.034 ms 1 /classes/Product.php:5659
493
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 543357
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.034 ms 0 /classes/SpecificPrice.php:259
503
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 543348
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.034 ms 0 /classes/SpecificPrice.php:259
553
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 441 LIMIT 1
0.034 ms 1 /classes/Product.php:5659
684
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "iqitwishlist" LIMIT 1
0.034 ms 1 /classes/module/Module.php:2659
687
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 70 AND `id_shop` = 1 LIMIT 1
0.034 ms 1 /classes/module/Module.php:2132
735
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "onepagecheckout" LIMIT 1
0.034 ms 0 /classes/module/Module.php:2659
737
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "onepagecheckoutps" LIMIT 1
0.034 ms 0 /classes/module/Module.php:2659
369
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1020 LIMIT 1
0.034 ms 1 /classes/Product.php:5659
451
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 544358
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.034 ms 0 /classes/SpecificPrice.php:259
461
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 544260
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.034 ms 0 /classes/SpecificPrice.php:259
753
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.034 ms 0 /classes/module/Module.php:2132
22
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.033 ms 0 /classes/module/Module.php:2132
256
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 547376
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.033 ms 0 /classes/SpecificPrice.php:259
266
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1027 LIMIT 1
0.033 ms 1 /classes/Product.php:5659
370
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 545729
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.033 ms 0 /classes/SpecificPrice.php:259
414
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 545474 AND `id_group` = 1 LIMIT 1
0.033 ms 0 /classes/GroupReduction.php:156
554
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 542487
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.033 ms 0 /classes/SpecificPrice.php:259
235
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 28 LIMIT 1
0.033 ms 1 /classes/Product.php:5659
277
SELECT SQL_NO_CACHE name FROM een_category_lang WHERE id_shop = 1 AND id_lang = 1 AND id_category = 1021 LIMIT 1
0.033 ms 1 /classes/Product.php:5659
359
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 546031
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.033 ms 0 /classes/SpecificPrice.php:259
404
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 545554 AND `id_group` = 1 LIMIT 1
0.033 ms 0 /classes/GroupReduction.php:156
685
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 87 AND `id_shop` = 1 LIMIT 1
0.033 ms 1 /classes/module/Module.php:2132
219
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 548036 AND `id_group` = 1 LIMIT 1
0.032 ms 0 /classes/GroupReduction.php:156
236
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 547921
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.032 ms 0 /classes/SpecificPrice.php:259
246
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 547665
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.032 ms 0 /classes/SpecificPrice.php:259
318
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 546464
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.032 ms 0 /classes/SpecificPrice.php:259
328
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 546348
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.032 ms 0 /classes/SpecificPrice.php:259
475
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 544028 AND `id_group` = 1 LIMIT 1
0.032 ms 0 /classes/GroupReduction.php:156
56
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.032 ms 0 /classes/module/Module.php:2132
229
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 547985 AND `id_group` = 1 LIMIT 1
0.032 ms 0 /classes/GroupReduction.php:156
250
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 547665 AND `id_group` = 1 LIMIT 1
0.032 ms 0 /classes/GroupReduction.php:156
267
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 547204
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.032 ms 0 /classes/SpecificPrice.php:259
288
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 546968
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.032 ms 0 /classes/SpecificPrice.php:259
298
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 546867
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.032 ms 0 /classes/SpecificPrice.php:259
308
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 546692
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.032 ms 0 /classes/SpecificPrice.php:259
322
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 546464 AND `id_group` = 1 LIMIT 1
0.032 ms 0 /classes/GroupReduction.php:156
338
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 546341
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.032 ms 0 /classes/SpecificPrice.php:259
363
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 546031 AND `id_group` = 1 LIMIT 1
0.032 ms 0 /classes/GroupReduction.php:156
374
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 545729 AND `id_group` = 1 LIMIT 1
0.032 ms 0 /classes/GroupReduction.php:156
384
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 545709 AND `id_group` = 1 LIMIT 1
0.032 ms 0 /classes/GroupReduction.php:156
435
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 544543 AND `id_group` = 1 LIMIT 1
0.032 ms 0 /classes/GroupReduction.php:156
455
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 544358 AND `id_group` = 1 LIMIT 1
0.032 ms 0 /classes/GroupReduction.php:156
486
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 543423 AND `id_group` = 1 LIMIT 1
0.032 ms 0 /classes/GroupReduction.php:156
517
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 543106 AND `id_group` = 1 LIMIT 1
0.032 ms 0 /classes/GroupReduction.php:156
527
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 543008 AND `id_group` = 1 LIMIT 1
0.032 ms 0 /classes/GroupReduction.php:156
537
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 542781 AND `id_group` = 1 LIMIT 1
0.032 ms 0 /classes/GroupReduction.php:156
67
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "gremarketing" LIMIT 1
0.031 ms 0 /classes/module/Module.php:2659
83
CREATE TABLE IF NOT EXISTS `een_gmcp_categories` (`id_category` int(11) NOT NULL, `id_shop` int(11) NOT NULL DEFAULT "1",  UNIQUE KEY `id_category` (`id_category`, `id_shop`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
0.031 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
260
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 547376 AND `id_group` = 1 LIMIT 1
0.031 ms 0 /classes/GroupReduction.php:156
278
SELECT SQL_NO_CACHE `priority`, `id_specific_price_priority`
FROM `een_specific_price_priority`
WHERE `id_product` = 547001
ORDER BY `id_specific_price_priority` DESC LIMIT 1
0.031 ms 0 /classes/SpecificPrice.php:259
312
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 546692 AND `id_group` = 1 LIMIT 1
0.031 ms 0 /classes/GroupReduction.php:156
342
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 546341 AND `id_group` = 1 LIMIT 1
0.031 ms 0 /classes/GroupReduction.php:156
424
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 544569 AND `id_group` = 1 LIMIT 1
0.031 ms 0 /classes/GroupReduction.php:156
445
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 544488 AND `id_group` = 1 LIMIT 1
0.031 ms 0 /classes/GroupReduction.php:156
465
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 544260 AND `id_group` = 1 LIMIT 1
0.031 ms 0 /classes/GroupReduction.php:156
497
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 543357 AND `id_group` = 1 LIMIT 1
0.031 ms 0 /classes/GroupReduction.php:156
507
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 543348 AND `id_group` = 1 LIMIT 1
0.031 ms 0 /classes/GroupReduction.php:156
558
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 542487 AND `id_group` = 1 LIMIT 1
0.031 ms 0 /classes/GroupReduction.php:156
738
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.031 ms 0 /classes/module/Module.php:2132
74
CREATE TABLE IF NOT EXISTS `een_gmcp_tmp_rules`(`id` int(11) NOT NULL AUTO_INCREMENT, `id_shop` int(11) NOT NULL DEFAULT "1",`type` char(255) NOT NULL, `exclusion_values` longtext NOT NULL, PRIMARY KEY (`id`)) ENGINE=InnoDB DEFAULT CHARSET=utf8 AUTO_INCREMENT=1;
0.030 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
86
CREATE TABLE IF NOT EXISTS `een_gmcp_tags` (`id_tag` int(11) NOT NULL AUTO_INCREMENT, `id_shop` int(11) NOT NULL DEFAULT "1", `name` char(255) NOT NULL, `type` char(255) NOT NULL, `active` TINYINT NOT NULL, `position` INT NOT NULL, `end_date` DATE, PRIMARY KEY (`id_tag`)) ENGINE=MyISAM DEFAULT CHARSET=utf8 AUTO_INCREMENT=1 ;
0.030 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
91
CREATE TABLE IF NOT EXISTS `een_gmcp_features_by_cat` (`id_cat` int(11) NOT NULL DEFAULT '0', `id_shop` int(3) NOT NULL DEFAULT "1", `values` text NOT NULL, PRIMARY KEY (`id_cat`, `id_shop`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
0.030 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
240
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 547921 AND `id_group` = 1 LIMIT 1
0.030 ms 0 /classes/GroupReduction.php:156
271
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 547204 AND `id_group` = 1 LIMIT 1
0.030 ms 0 /classes/GroupReduction.php:156
282
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 547001 AND `id_group` = 1 LIMIT 1
0.030 ms 0 /classes/GroupReduction.php:156
302
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 546867 AND `id_group` = 1 LIMIT 1
0.030 ms 0 /classes/GroupReduction.php:156
739
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "steasycheckout" LIMIT 1
0.030 ms 0 /classes/module/Module.php:2659
740
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.030 ms 0 /classes/module/Module.php:2132
748
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.030 ms 0 /classes/module/Module.php:2132
73
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_price_range` (`id_tag` int(11) NOT NULL, `price_min` CHAR(255) NOT NULL, `price_max` CHAR(255), `id_product` CHAR(255), UNIQUE KEY `tag_price_range` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
0.030 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
95
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_new_product` (`id_tag` int(11) NOT NULL,  `from_date` DATETIME, `id_product` int,  `id_shop` int(11) NOT NULL,  UNIQUE KEY `tag_new_product` (`id_tag`, `id_product`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
0.030 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
97
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_last_product_ordered` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `last_product_ordered` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
0.030 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
102
CREATE TABLE IF NOT EXISTS `een_gmcp_advanced_exclusion` (`id` int(11) NOT NULL AUTO_INCREMENT, `status` int(11) NOT NULL DEFAULT "1", `id_shop` int(11) NOT NULL DEFAULT "1", `name` char(255) NOT NULL, `type` char(255) NOT NULL, `exclusion_value` longtext NOT NULL, PRIMARY KEY (`id`)) ENGINE=InnoDB DEFAULT CHARSET=utf8 AUTO_INCREMENT=1;
0.030 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
292
SELECT SQL_NO_CACHE `reduction`
FROM `een_product_group_reduction_cache`
WHERE `id_product` = 546968 AND `id_group` = 1 LIMIT 1
0.030 ms 0 /classes/GroupReduction.php:156
759
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 3 AND `id_shop` = 1 LIMIT 1
0.030 ms 0 /classes/module/Module.php:2132
79
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_last_product_not_ordered` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `last_product_ordered` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
0.029 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
85
CREATE TABLE IF NOT EXISTS `een_gmcp_brands` (`id_brands` int(11) NOT NULL, `id_shop` int(11) NOT NULL DEFAULT "1",  UNIQUE KEY `id_brands` (`id_brands`, `id_shop`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
0.029 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
88
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_cats` (`id_tag` int(11) NOT NULL, `id_category` int(11) NOT NULL, UNIQUE KEY `tag_cat` (`id_tag`,`id_category`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
0.029 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
746
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.029 ms 0 /classes/module/Module.php:2132
742
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.029 ms 0 /classes/module/Module.php:2132
744
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.029 ms 0 /classes/module/Module.php:2132
99
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_promotion` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `promotion` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
0.028 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
741
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "thecheckout" LIMIT 1
0.028 ms 0 /classes/module/Module.php:2659
743
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "idxropc" LIMIT 1
0.028 ms 0 /classes/module/Module.php:2659
75
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_last_product_ordered` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `last_product_ordered` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
0.028 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
82
CREATE TABLE IF NOT EXISTS `een_gmcp_taxonomy` (`id_taxonomy` int(11) NOT NULL AUTO_INCREMENT, `value` text NOT NULL, `lang` varchar(5) NOT NULL, PRIMARY KEY (`id_taxonomy`), KEY `lang` (`lang`), FULLTEXT KEY `ft_index` (`value`)) ENGINE=MyISAM DEFAULT CHARSET=utf8 AUTO_INCREMENT=1;
0.028 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
745
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "pwpaysoncheckout" LIMIT 1
0.028 ms 0 /classes/module/Module.php:2659
747
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "easycheckout" LIMIT 1
0.028 ms 0 /classes/module/Module.php:2659
754
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "cdesigner" LIMIT 1
0.028 ms 0 /classes/module/Module.php:2659
92
CREATE TABLE IF NOT EXISTS `een_gmcp_discount_association` (`id_association` int(11) NOT NULL AUTO_INCREMENT, `id_discount` int(11) NOT NULL, `id_product` int(11) NOT NULL, `channel` CHAR(120) NOT NULL DEFAULT "SHOPPING_ADS", PRIMARY KEY (`id_association`) ) ENGINE=MyISAM DEFAULT CHARSET=utf8;
0.027 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
93
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_features` (`id_tag` int(11) NOT NULL, `id_feature` int(11) NOT NULL, `id_shop` int(11) NOT NULL,  UNIQUE KEY `tag_feature` (`id_tag`, `id_feature`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
0.027 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
105
CREATE TABLE IF NOT EXISTS `een_gmcp_tmp_rules`(`id` int(11) NOT NULL AUTO_INCREMENT, `id_shop` int(11) NOT NULL DEFAULT "1",`type` char(255) NOT NULL, `exclusion_values` longtext NOT NULL, PRIMARY KEY (`id`)) ENGINE=InnoDB DEFAULT CHARSET=utf8 AUTO_INCREMENT=1;
0.027 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
755
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.027 ms 0 /classes/module/Module.php:2132
756
SELECT SQL_NO_CACHE `id_module` FROM `een_module` WHERE `name` = "configurator" LIMIT 1
0.027 ms 0 /classes/module/Module.php:2659
100
CREATE TABLE IF NOT EXISTS `een_gmcp_reporting` (`id_reporting` int(11) NOT NULL AUTO_INCREMENT,`iso_feed` LONGTEXT NOT NULL,    `reporting_content` LONGTEXT NOT NULL,`id_shop` int(11) NOT NULL,`date_add` datetime NOT NULL,`date_upd` datetime NOT NULL,PRIMARY KEY (`id_reporting`)) ENGINE=' . _MYSQL_ENGINE_ . ' DEFAULT CHARSET=utf8;
0.026 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
757
SELECT SQL_NO_CACHE `id_module` FROM `een_module_shop` WHERE `id_module` = 0 AND `id_shop` = 1 LIMIT 1
0.026 ms 0 /classes/module/Module.php:2132
84
CREATE TABLE IF NOT EXISTS `een_gmcp_taxonomy_categories` (`id_category` int(11) NOT NULL, `id_shop` int(3) NOT NULL DEFAULT "1", `txt_taxonomy` text NOT NULL, `lang` char(5) NOT NULL, KEY `id_category` (`id_category`,`lang`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
0.025 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
89
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_products` (`id_tag` int(11) NOT NULL, `id_product` int(11) NOT NULL, product_name VARCHAR (255) NOT NULL, UNIQUE KEY `tag_product` (`id_tag`,`id_product`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
0.025 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
101
CREATE TABLE IF NOT EXISTS `een_gmcp_feeds` (`id_feed` int(11) NOT NULL AUTO_INCREMENT,`iso_lang` LONGTEXT NOT NULL,`iso_country` LONGTEXT NOT NULL,`iso_currency` LONGTEXT NOT NULL, `taxonomy` LONGTEXT NOT NULL, `id_shop` int(11) NOT NULL,`date_add` datetime NOT NULL,`date_upd` datetime NOT NULL,PRIMARY KEY (`id_feed`)) ENGINE=' . _MYSQL_ENGINE_ . ' DEFAULT CHARSET=utf8;
0.025 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
76
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_promotion` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `promotion` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
0.025 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
96
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_best_sale` (`id_tag` int(11) NOT NULL, `amount` CHAR(255) NOT NULL, `unit` CHAR(255) ,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255),  `id_shop` int(11) NOT NULL,  UNIQUE KEY `tag_best_sales` (`id_tag`, `id_product`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
0.025 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
103
CREATE TABLE IF NOT EXISTS `een_gmcp_product_excluded` (`id_rule` int(11) NOT NULL DEFAULT "0",`id_product` int(11) NOT NULL DEFAULT "0", `id_product_attribute` int(11)) ENGINE=InnoDB DEFAULT CHARSET=utf8 AUTO_INCREMENT=1;
0.025 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
104
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_price_range` (`id_tag` int(11) NOT NULL, `price_min` CHAR(255) NOT NULL, `price_max` CHAR(255), `id_product` CHAR(255), UNIQUE KEY `tag_price_range` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
0.025 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
54
CREATE TABLE IF NOT EXISTS `een_revolut_cards` (
`id` INT NOT NULL AUTO_INCREMENT,
`customer_id` INT NOT NULL ,
`card_number` VARCHAR(25) NOT NULL,
`expire_month` INT NOT NULL ,
`expire_year` INT NOT NULL ,
PRIMARY KEY (`id`)
) ENGINE=InnoDB;
0.023 ms 1 /modules/revolutpayment/revolutpayment.php:331
90
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_suppliers` (`id_tag` int(11) NOT NULL, `id_supplier` int(11) NOT NULL, UNIQUE KEY `tag_supplier` (`id_tag`,`id_supplier`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
0.023 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
87
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_brands` (`id_tag` int(11) NOT NULL, `id_brand` int(11) NOT NULL, UNIQUE KEY `tag_brand` (`id_tag`,`id_brand`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
0.022 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
94
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_categories` (`id_tag` int(11) NOT NULL, `id_category` int(11) NOT NULL, `id_shop` int(11) NOT NULL,  UNIQUE KEY `tag_feature` (`id_tag`, `id_category`)) ENGINE=MyISAM DEFAULT CHARSET=utf8;
0.022 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
98
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_last_product_not_ordered` (`id_tag` int(11) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(255), UNIQUE KEY `last_product_ordered` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utf8;
0.022 ms 1 /modules/gmerchantcenterpro/lib/install/installSql.php:78
111
COMMIT
0.020 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:155
106
COMMIT
0.016 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:107
107
BEGIN
0.016 ms 1 /modules/gmerchantcenterpro/lib/moduleUpdate.php:121

Doubles

36 queries
SELECT image_shop.`id_image`
                    FROM `een_image` i
                     INNER JOIN een_image_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
                    WHERE i.`id_product` = XX
                    AND image_shop.`cover` = XX LIMIT XX
36 queries
SELECT name FROM een_category_lang WHERE id_shop = XX AND id_lang = XX AND id_category = XX LIMIT XX
36 queries
				SELECT `priority`, `id_specific_price_priority`
				FROM `een_specific_price_priority`
				WHERE `id_product` = XX
				ORDER BY `id_specific_price_priority` DESC LIMIT XX
36 queries
			SELECT *, ( IF (`id_shop` = XX, XX, XX) +  IF (`id_country` = XX, XX, XX) +  IF (`id_currency` = XX, XX, XX) +  IF (`id_group` = XX, XX, XX) +  IF (`id_customer` = XX, XX, XX)) AS `score`
				FROM `een_specific_price`
				WHERE
                `id_shop` IN (XX, XX) AND
                `id_currency` IN (XX, XX) AND
                `id_country` IN (XX, XX) AND
                `id_group` IN (XX, XX) AND `id_product` = XX AND `id_customer` = XX AND `id_product_attribute` = XX AND `id_cart` = XX  AND (`from` = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' >= `from`) AND (`to` = 'XX-XX-XX XX:XX:XX' OR 'XX-XX-XX XX:XX:XX' <= `to`)
				AND IF(`from_quantity` > XX, `from_quantity`, XX) <= XX ORDER BY `id_product_attribute` DESC, `id_cart` DESC, `from_quantity` DESC, `id_specific_price_rule` ASC, `score` DESC, `to` DESC, `from` DESC LIMIT XX
36 queries
SELECT product_shop.`price`, product_shop.`ecotax`,
IFNULL(product_attribute_shop.id_product_attribute,XX) id_product_attribute, product_attribute_shop.`price` AS attribute_price, product_attribute_shop.default_on, product_attribute_shop.`ecotax` AS attribute_ecotax
FROM `een_product` p
INNER JOIN `een_product_shop` `product_shop` ON (product_shop.id_product=p.id_product AND product_shop.id_shop = XX)
LEFT JOIN `een_product_attribute_shop` `product_attribute_shop` ON (product_attribute_shop.id_product = p.id_product AND product_attribute_shop.id_shop = XX)
WHERE (p.`id_product` = XX)
36 queries
                            SELECT `id_tax_rules_group`
                            FROM `een_product_shop`
                            WHERE `id_product` = XX AND id_shop=XX LIMIT XX
36 queries
			SELECT `reduction`
			FROM `een_product_group_reduction_cache`
			WHERE `id_product` = XX AND `id_group` = XX LIMIT XX
36 queries
SELECT SUM(quantity)
FROM `een_stock_available`
WHERE (id_product = XX) AND (id_product_attribute = XX) AND (id_shop = XX) AND (id_shop_group = XX) LIMIT XX
36 queries
SELECT
            COALESCE(SUM(first_level_quantity) + SUM(pack_quantity), XX) as deep_quantity,
            COALESCE(SUM(first_level_quantity), XX) as quantity
          FROM (SELECT SUM(cp.`quantity`) as first_level_quantity, XX as pack_quantity
          FROM `een_cart_product` cp
            WHERE cp.`id_product_attribute` = XX
            
            AND cp.`id_cart` = XX AND cp.`id_product` = XX UNION SELECT XX as first_level_quantity, SUM(cp.`quantity` * p.`quantity`) as pack_quantity
          FROM `een_cart_product` cp JOIN `een_pack` p ON cp.`id_product` = p.`id_product_pack` JOIN `een_product` pr ON p.`id_product_pack` = pr.`id_product`
            WHERE cp.`id_product_attribute` = XX
            
            AND cp.`id_cart` = XX AND p.`id_product_item` = XX AND (pr.`pack_stock_type` IN (XX,XX) OR (
            pr.`pack_stock_type` = XX
            AND XX = XX
        ))) as q LIMIT XX
36 queries
                SELECT name, value, pf.id_feature, f.position, fvl.id_feature_value
                FROM een_feature_product pf
                LEFT JOIN een_feature_lang fl ON (fl.id_feature = pf.id_feature AND fl.id_lang = XX)
                LEFT JOIN een_feature_value_lang fvl ON (fvl.id_feature_value = pf.id_feature_value AND fvl.id_lang = XX)
                LEFT JOIN een_feature f ON (f.id_feature = pf.id_feature AND fl.id_lang = XX)
                 INNER JOIN een_feature_shop feature_shop
        ON (feature_shop.id_feature = f.id_feature AND feature_shop.id_shop = XX)
                WHERE pf.id_product = XX
                ORDER BY f.position ASC
36 queries
SELECT *
FROM `een_product` a
LEFT JOIN `een_product_lang` `b` ON a.`id_product` = b.`id_product` AND b.`id_lang` = XX
LEFT JOIN `een_product_shop` `c` ON a.`id_product` = c.`id_product` AND c.`id_shop` = XX
WHERE (a.`id_product` = XX) AND (b.`id_shop` = XX) LIMIT XX
36 queries
            SELECT image_shop.`cover`, i.`id_image`, il.`legend`, i.`position`
            FROM `een_image` i
             INNER JOIN een_image_shop image_shop
        ON (image_shop.id_image = i.id_image AND image_shop.id_shop = XX)
            LEFT JOIN `een_image_lang` il ON (i.`id_image` = il.`id_image` AND il.`id_lang` = XX)
            WHERE i.`id_product` = XX
            ORDER BY `position`
36 queries
SELECT `id_product_attribute`
            FROM `een_product_attribute`
            WHERE `id_product` = XX
36 queries
SELECT pa.`id_product`, a.`color`, pac.`id_product_attribute`, XX qty, a.`id_attribute`, al.`name`, IF(color = "", a.id_attribute, color) group_by
            FROM `een_product_attribute` pa
             INNER JOIN een_product_attribute_shop product_attribute_shop
        ON (product_attribute_shop.id_product_attribute = pa.id_product_attribute AND product_attribute_shop.id_shop = XX)
            JOIN `een_product_attribute_combination` pac ON (pac.`id_product_attribute` = product_attribute_shop.`id_product_attribute`)
            JOIN `een_attribute` a ON (a.`id_attribute` = pac.`id_attribute`)
            JOIN `een_attribute_lang` al ON (a.`id_attribute` = al.`id_attribute` AND al.`id_lang` = XX)
            JOIN `een_attribute_group` ag ON (a.id_attribute_group = ag.`id_attribute_group`)
            WHERE pa.`id_product` IN (XX) AND ag.`is_color_group` = XX
            GROUP BY pa.`id_product`, a.`id_attribute`, `group_by`
            
            ORDER BY a.`position` ASC;
27 queries
SELECT `id_module` FROM `een_module_shop` WHERE `id_module` = XX AND `id_shop` = XX LIMIT XX
12 queries
			SELECT cl.`link_rewrite`
			FROM `een_category_lang` cl
			WHERE `id_lang` = XX
			 AND cl.id_shop = XX 
			AND cl.`id_category` = XX LIMIT XX
9 queries
SELECT *
FROM `een_category` a
LEFT JOIN `een_category_lang` `b` ON a.`id_category` = b.`id_category` AND b.`id_lang` = XX
LEFT JOIN `een_category_shop` `c` ON a.`id_category` = c.`id_category` AND c.`id_shop` = XX
WHERE (a.`id_category` = XX) AND (b.`id_shop` = XX) LIMIT XX
7 queries
SELECT *
FROM `een_country` a
LEFT JOIN `een_country_shop` `c` ON a.`id_country` = c.`id_country` AND c.`id_shop` = XX
WHERE (a.`id_country` = XX) LIMIT XX
7 queries
SELECT *
							FROM `een_country_lang`
							WHERE `id_country` = XX
7 queries
			SELECT `id_country`
			FROM `een_country`
			WHERE `iso_code` = 'FR' LIMIT XX
5 queries
							SELECT `name`
							FROM `een_country_lang`
							WHERE `id_lang` = XX
							AND `id_country` = XX LIMIT XX
5 queries
SELECT v.*, vl.*, IF(lifvlv.`url_name` IS NULL OR lifvlv.`url_name` = "", NULL, lifvlv.`url_name`) AS url_name, IF(lifvlv.`meta_title` IS NULL OR lifvlv.`meta_title` = "", NULL, lifvlv.`meta_title`) AS meta_title FROM `een_feature_value` v LEFT JOIN `een_feature_value_lang` vl ON (v.`id_feature_value` = vl.`id_feature_value` AND vl.`id_lang` = XX) LEFT JOIN `een_layered_indexable_feature_value_lang_value` lifvlv ON (v.`id_feature_value` = lifvlv.`id_feature_value` AND lifvlv.`id_lang` = XX) WHERE v.`id_feature` = XX ORDER BY vl.`value` ASC
5 queries
SELECT fp.id_feature, fp.id_feature_value, COUNT(DISTINCT p.id_product) c FROM (SELECT p.id_product, p.id_manufacturer, SUM(sa.quantity) as quantity, p.condition, p.weight, p.price, psales.quantity as sales, p.on_sale, p.date_add, cp.position FROM een_product p LEFT JOIN een_product_attribute pa ON (p.id_product = pa.id_product) LEFT JOIN een_product_attribute_combination pac ON (pa.id_product_attribute = pac.id_product_attribute) LEFT JOIN een_stock_available sa ON (p.id_product = sa.id_product AND IFNULL(pac.id_product_attribute, XX) = sa.id_product_attribute AND sa.id_shop = XX  AND sa.id_shop_group = XX ) LEFT JOIN een_product_sale psales ON (psales.id_product = p.id_product) INNER JOIN een_category_product cp ON (p.id_product = cp.id_product) INNER JOIN een_product_shop ps ON (p.id_product = ps.id_product AND ps.id_shop = XX AND ps.active = TRUE) INNER JOIN een_category c ON (cp.id_category = c.id_category AND c.active=XX) LEFT JOIN een_category_group cg ON (cg.id_category = c.id_category) LEFT JOIN een_feature_product fp ON (p.id_product = fp.id_product) WHERE ((fp.id_feature_value IN (XX, XX, XX, XX, XX, XX))) AND ps.id_shop='XX' AND ps.visibility IN ('both', 'catalog') AND cg.id_group='XX' AND c.nleft>=XX AND c.nright<=XX GROUP BY p.id_product) p INNER JOIN een_feature_product fp ON (p.id_product = fp.id_product) LEFT JOIN een_feature_product fp_XX ON (p.id_product = fp_XX.id_product) WHERE ((fp.id_feature=XX)) AND ((fp_XX.id_feature_value IN (XX, XX, XX, XX, XX, XX))) GROUP BY fp.id_feature_value
3 queries
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_last_product_not_ordered` (`id_tag` int(XX) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(XX), UNIQUE KEY `last_product_ordered` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utfXX;
2 queries
                SELECT m.`id_module`, m.`name`, ms.`id_module`as `mshop`
                FROM `een_module` m
                LEFT JOIN `een_module_shop` ms
                ON m.`id_module` = ms.`id_module`
                AND ms.`id_shop` = XX
2 queries
SELECT `id_lang` FROM `een_lang`
                    WHERE `locale` = 'fr-fr'
                    OR `language_code` = 'fr-fr' LIMIT XX
2 queries
		SELECT `id_category`
		FROM `een_category_shop`
		WHERE `id_category` = XX
		AND `id_shop` = XX LIMIT XX
2 queries
BEGIN
2 queries
SHOW TABLES LIKE "een_gmcp_XX"
2 queries
CREATE TABLE IF NOT EXISTS `een_gmcp_reporting` (`id_reporting` int(XX) NOT NULL AUTO_INCREMENT,`iso_feed` LONGTEXT NOT NULL,    `reporting_content` LONGTEXT NOT NULL,`id_shop` int(XX) NOT NULL,`date_add` datetime NOT NULL,`date_upd` datetime NOT NULL,PRIMARY KEY (`id_reporting`)) ENGINE=' . _MYSQL_ENGINE_ . ' DEFAULT CHARSET=utfXX;
2 queries
CREATE TABLE IF NOT EXISTS `een_gmcp_feeds` (`id_feed` int(XX) NOT NULL AUTO_INCREMENT,`iso_lang` LONGTEXT NOT NULL,`iso_country` LONGTEXT NOT NULL,`iso_currency` LONGTEXT NOT NULL, `taxonomy` LONGTEXT NOT NULL, `id_shop` int(XX) NOT NULL,`date_add` datetime NOT NULL,`date_upd` datetime NOT NULL,PRIMARY KEY (`id_feed`)) ENGINE=' . _MYSQL_ENGINE_ . ' DEFAULT CHARSET=utfXX;
2 queries
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_price_range` (`id_tag` int(XX) NOT NULL, `price_min` CHAR(XX) NOT NULL, `price_max` CHAR(XX), `id_product` CHAR(XX), UNIQUE KEY `tag_price_range` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utfXX;
2 queries
CREATE TABLE IF NOT EXISTS `een_gmcp_tmp_rules`(`id` int(XX) NOT NULL AUTO_INCREMENT, `id_shop` int(XX) NOT NULL DEFAULT "XX",`type` char(XX) NOT NULL, `exclusion_values` longtext NOT NULL, PRIMARY KEY (`id`)) ENGINE=InnoDB DEFAULT CHARSET=utfXX AUTO_INCREMENT=XX;
2 queries
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_last_product_ordered` (`id_tag` int(XX) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(XX), UNIQUE KEY `last_product_ordered` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utfXX;
2 queries
CREATE TABLE IF NOT EXISTS `een_gmcp_tags_dynamic_promotion` (`id_tag` int(XX) NOT NULL,`start_date` DATETIME, `end_date` DATETIME, `id_product` CHAR(XX), UNIQUE KEY `promotion` (`id_tag`, `id_product`)) ENGINE=InnoDB DEFAULT CHARSET=utfXX;
2 queries
CREATE TABLE IF NOT EXISTS `een_gmcp_discount_association` (`id_association` int(XX) NOT NULL AUTO_INCREMENT, `id_discount` int(XX) NOT NULL, `id_product` int(XX) NOT NULL, `channel` CHAR(XX) NOT NULL DEFAULT "SHOPPING_ADS", PRIMARY KEY (`id_association`) ) ENGINE=MyISAM DEFAULT CHARSET=utfXX;
2 queries
CREATE TABLE IF NOT EXISTS `een_gmcp_tags` (`id_tag` int(XX) NOT NULL AUTO_INCREMENT, `id_shop` int(XX) NOT NULL DEFAULT "XX", `name` char(XX) NOT NULL, `type` char(XX) NOT NULL, `active` TINYINT NOT NULL, `position` INT NOT NULL, `end_date` DATE, PRIMARY KEY (`id_tag`)) ENGINE=MyISAM DEFAULT CHARSET=utfXX AUTO_INCREMENT=XX ;
2 queries
COMMIT
2 queries
				SELECT tr.*
				FROM `een_tax_rule` tr
				JOIN `een_tax_rules_group` trg ON (tr.`id_tax_rules_group` = trg.`id_tax_rules_group`)
				WHERE trg.`active` = XX
				AND tr.`id_country` = XX
				AND tr.`id_tax_rules_group` = XX
				AND tr.`id_state` IN (XX, XX)
				AND ('XX' BETWEEN tr.`zipcode_from` AND tr.`zipcode_to`
					OR (tr.`zipcode_to` = XX AND tr.`zipcode_from` IN(XX, 'XX')))
				ORDER BY tr.`zipcode_from` DESC, tr.`zipcode_to` DESC, tr.`id_state` DESC, tr.`id_country` DESC
2 queries
SELECT XX FROM `een_cart_rule` WHERE ((date_to >= "XX-XX-XX XX:XX:XX" AND date_to <= "XX-XX-XX XX:XX:XX") OR (date_from >= "XX-XX-XX XX:XX:XX" AND date_from <= "XX-XX-XX XX:XX:XX") OR (date_from < "XX-XX-XX XX:XX:XX" AND date_to > "XX-XX-XX XX:XX:XX")) AND `id_customer` IN (XX,XX) LIMIT XX
2 queries
SELECT product_id as id_product, COUNT(product_id) AS sales
            FROM `een_order_detail`
            WHERE product_id IN (
                SELECT id_product
                FROM `een_category_product`
                LEFT JOIN een_product USING (id_product)
                WHERE id_category = XX
                AND active = XX
            )
            GROUP BY product_id
            ORDER BY sales DESC LIMIT XX
2 queries
SELECT id_category, id_parent, level_depth, name, is_root_category, active FROM een_category LEFT JOIN een_category_lang AS cl USING (id_category) LEFT JOIN een_category_shop AS cs USING (id_category) WHERE cs.id_shop = XX AND cl.id_lang = XX ORDER BY `een_category`.`id_parent` ASC, `een_category`.`id_category` ASC

Tables stress

126 product
124 product_shop
89 product_attribute
73 cart_product
72 image
72 image_shop
72 product_attribute_shop
68 feature_product
64 category_lang
55 stock_available
53 product_attribute_combination
42 specific_price
41 feature_value_lang
37 feature
37 feature_shop
37 feature_lang
37 product_lang
36 specific_price_priority
36 product_group_reduction_cache
36 pack
36 image_lang
36 attribute
36 attribute_lang
36 attribute_group
34 module
32 category
30 module_shop
21 country
20 category_product
18 category_group
17 category_shop
14 product_sale
13 country_lang
12 currency
8 country_shop
7 hook
5 lang
5 feature_value
5 layered_indexable_feature_value_lang_value
4 shop_url
4 shop
4 lang_shop
4 currency_shop
4 gmcp_feeds
4 cart_rule
3 hook_alias
2 shop_group
2 configuration
2 hook_module
2 currency_lang
2 group
2 group_shop
2 image_type
2 orders
2 tax_rule
2 tax_rules_group
2 cart_rule_lang
2 order_detail
1 memcached_servers
1 configuration_lang
1 module_group
1 meta
1 meta_lang
1 hook_module_exceptions
1 group_lang
1 address_format
1 required_field
1 revslider_sliders
1 gmcp_discount_association
1 gmcp_tags
1 layered_category
1 layered_indexable_feature
1 layered_indexable_feature_lang_value
1 layered_filter_block
1 layered_price_index
1 manufacturer
1 feature_flag
1 iqit_elementor_category
1 order_cart_rule
1 ganalytics_data

ObjectModel instances

Name Instances Source
Product 36 /src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 548444]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 548406]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 548036]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 547985]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 547921]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 547665]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 547376]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 547204]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 547001]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 546968]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 546867]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 546692]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 546464]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 546348]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 546341]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 546058]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 546031]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 545729]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 545709]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 545693]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 545554]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 545474]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 544569]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 544543]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 544488]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 544358]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 544260]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 544028]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 543423]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 543357]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 543348]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 543106]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 543008]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 542781]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 542706]
/src/Adapter/Image/ImageRetriever.php:80 (__construct) [id: 542487]
Category 17 /controllers/front/listing/CategoryController.php:78 (__construct) [id: 1000]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 1030]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 1031]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 5735]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 5728]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 5723]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 1027]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 411]
/controllers/front/listing/CategoryController.php:216 (__construct) [id: 426]
/classes/Meta.php:380 (__construct) [id: 1000]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/classes/PrestaShopCollection.php:385 (hydrateCollection) [id: ]
/modules/ps_facetedsearch/src/Product/Search.php:365 (__construct) [id: 1000]
/modules/ps_facetedsearch/src/Filters/Block.php:157 (__construct) [id: 1000]
/modules/facebookconversiontrackingplus/facebookconversiontrackingplus.php:3085 (__construct) [id: 1000]
/classes/Link.php:402 (__construct) [id: 1000]
/modules/facebookconversiontrackingplus/classes/ConversionApi.php:518 (__construct) [id: 1000]
Country 15 /config/config.inc.php:148 (__construct) [id: 8]
/classes/controller/FrontController.php:946 (__construct) [id: 21]
/classes/AddressFormat.php:404 (__construct) [id: 17]
/classes/controller/FrontController.php:1779 (__construct) [id: 17]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 8]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 8]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 8]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 8]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 8]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 8]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 8]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 19]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 4]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 3]
/modules/gmerchantcenterpro/lib/moduleTools.php:208 (__construct) [id: 186]
Language 13 /config/config.inc.php:213 (__construct) [id: 1]
/classes/Tools.php:560 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:203 (__construct) [id: 1]
Currency 9 /src/Adapter/Currency/CurrencyDataProvider.php:101 (__construct) [id: 1]
/classes/Tools.php:690 (getCurrencyInstance) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:213 (__construct) [id: 1]
/modules/gmerchantcenterpro/lib/moduleTools.php:213 (__construct) [id: 0]
/modules/gmerchantcenterpro/lib/moduleTools.php:213 (__construct) [id: 0]
/modules/gmerchantcenterpro/lib/moduleTools.php:213 (__construct) [id: 0]
/modules/gmerchantcenterpro/lib/moduleTools.php:213 (__construct) [id: 0]
/modules/gmerchantcenterpro/lib/moduleTools.php:213 (__construct) [id: 0]
/modules/gmerchantcenterpro/lib/moduleTools.php:213 (__construct) [id: 0]
Address 4 /classes/shop/Shop.php:486 (__construct) [id: ]
/classes/Product.php:3694 (initialize) [id: ]
/classes/Product.php:3804 (__construct) [id: ]
/classes/Product.php:5964 (__construct) [id: ]
Cart 2 /classes/controller/FrontController.php:467 (__construct) [id: ]
/classes/controller/FrontController.php:541 (__construct) [id: ]
Shop 1 /config/config.inc.php:119 (initialize) [id: 1]
ShopGroup 1 /classes/shop/Shop.php:561 (__construct) [id: 1]
Customer 1 /config/config.inc.php:266 (__construct) [id: ]
Group 1 /classes/Cart.php:249 (getCurrent) [id: 1]
Gender 1 /classes/controller/FrontController.php:1702 (__construct) [id: 0]
Risk 1 /classes/controller/FrontController.php:1705 (__construct) [id: ]
AddressFormat 1 /classes/controller/FrontController.php:1773 (generateAddress) [id: ]
State 1 /classes/controller/FrontController.php:1778 (__construct) [id: 0]
IqitElementorCategory 1 /modules/iqitelementor/iqitelementor.php:784 (isJustElementor) [id: ]

Included Files

# Filename
0 /index.php
1 /config/config.inc.php
2 /config/defines.inc.php
3 /config/autoload.php
4 /vendor/autoload.php
5 /vendor/composer/autoload_real.php
6 /vendor/composer/platform_check.php
7 /vendor/composer/ClassLoader.php
8 /vendor/composer/include_paths.php
9 /vendor/composer/autoload_static.php
10 /vendor/symfony/polyfill-php72/bootstrap.php
11 /vendor/symfony/polyfill-mbstring/bootstrap.php
12 /vendor/symfony/polyfill-mbstring/bootstrap80.php
13 /vendor/symfony/polyfill-intl-normalizer/bootstrap.php
14 /vendor/symfony/polyfill-intl-normalizer/bootstrap80.php
15 /vendor/symfony/polyfill-intl-idn/bootstrap.php
16 /vendor/symfony/deprecation-contracts/function.php
17 /vendor/ralouphie/getallheaders/src/getallheaders.php
18 /vendor/symfony/polyfill-ctype/bootstrap.php
19 /vendor/symfony/polyfill-ctype/bootstrap80.php
20 /vendor/symfony/polyfill-php80/bootstrap.php
21 /vendor/guzzlehttp/promises/src/functions_include.php
22 /vendor/guzzlehttp/promises/src/functions.php
23 /vendor/guzzlehttp/guzzle/src/functions_include.php
24 /vendor/guzzlehttp/guzzle/src/functions.php
25 /vendor/symfony/polyfill-iconv/bootstrap.php
26 /vendor/ezyang/htmlpurifier/library/HTMLPurifier.composer.php
27 /vendor/jakeasmith/http_build_url/src/http_build_url.php
28 /vendor/lcobucci/jwt/compat/class-aliases.php
29 /vendor/lcobucci/jwt/src/Token.php
30 /vendor/lcobucci/jwt/src/Signature.php
31 /vendor/lcobucci/jwt/compat/json-exception-polyfill.php
32 /vendor/lcobucci/jwt/compat/lcobucci-clock-polyfill.php
33 /vendor/swiftmailer/swiftmailer/lib/swift_required.php
34 /vendor/swiftmailer/swiftmailer/lib/classes/Swift.php
35 /vendor/symfony/polyfill-intl-icu/bootstrap.php
36 /vendor/symfony/polyfill-php73/bootstrap.php
37 /vendor/symfony/polyfill-php81/bootstrap.php
38 /vendor/api-platform/core/src/deprecation.php
39 /vendor/api-platform/core/src/Api/FilterInterface.php
40 /vendor/api-platform/core/src/Api/ResourceClassResolverInterface.php
41 /vendor/api-platform/core/src/deprecated_interfaces.php
42 /vendor/api-platform/core/src/Metadata/Property/Factory/PropertyNameCollectionFactoryInterface.php
43 /vendor/api-platform/core/src/Metadata/Resource/Factory/ResourceNameCollectionFactoryInterface.php
44 /vendor/api-platform/core/src/Metadata/Extractor/ResourceExtractorInterface.php
45 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/DateFilterInterface.php
46 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/ExistsFilterInterface.php
47 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/OrderFilterInterface.php
48 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/RangeFilterInterface.php
49 /vendor/api-platform/core/src/Core/Bridge/Doctrine/Common/Filter/SearchFilterInterface.php
50 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationCollectionExtensionInterface.php
51 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationItemExtensionInterface.php
52 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultCollectionExtensionInterface.php
53 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Extension/AggregationResultItemExtensionInterface.php
54 /vendor/api-platform/core/src/Core/Bridge/Doctrine/MongoDbOdm/Filter/FilterInterface.php
55 /vendor/api-platform/core/src/Doctrine/Orm/QueryAwareInterface.php
56 /vendor/api-platform/core/src/Doctrine/Orm/Util/QueryNameGeneratorInterface.php
57 /vendor/api-platform/core/src/Elasticsearch/Metadata/Document/Factory/DocumentMetadataFactoryInterface.php
58 /vendor/api-platform/core/src/Symfony/Validator/ValidationGroupsGeneratorInterface.php
59 /vendor/api-platform/core/src/Symfony/Validator/Exception/ConstraintViolationListAwareExceptionInterface.php
60 /vendor/api-platform/core/src/Exception/ExceptionInterface.php
61 /vendor/api-platform/core/src/Core/Bridge/Symfony/Validator/Metadata/Property/Restriction/PropertySchemaRestrictionMetadataInterface.php
62 /vendor/api-platform/core/src/State/Pagination/PaginatorInterface.php
63 /vendor/api-platform/core/src/State/Pagination/PartialPaginatorInterface.php
64 /vendor/api-platform/core/src/Documentation/DocumentationInterface.php
65 /vendor/api-platform/core/src/JsonLd/AnonymousContextBuilderInterface.php
66 /vendor/api-platform/core/src/JsonLd/ContextBuilderInterface.php
67 /vendor/api-platform/core/src/Core/JsonSchema/SchemaFactoryInterface.php
68 /vendor/api-platform/core/src/JsonSchema/TypeFactoryInterface.php
69 /vendor/api-platform/core/src/OpenApi/Factory/OpenApiFactoryInterface.php
70 /vendor/api-platform/core/src/PathResolver/OperationPathResolverInterface.php
71 /vendor/api-platform/core/src/Symfony/Security/ResourceAccessCheckerInterface.php
72 /vendor/api-platform/core/src/Serializer/Filter/FilterInterface.php
73 /vendor/api-platform/core/src/Serializer/SerializerContextBuilderInterface.php
74 /vendor/api-platform/core/src/Validator/ValidatorInterface.php
75 /vendor/api-platform/core/src/Api/UrlGeneratorInterface.php
76 /vendor/api-platform/core/src/GraphQl/ExecutorInterface.php
77 /vendor/api-platform/core/src/GraphQl/Error/ErrorHandlerInterface.php
78 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ValidateStageInterface.php
79 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/ReadStageInterface.php
80 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityPostDenormalizeStageInterface.php
81 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SecurityStageInterface.php
82 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/WriteStageInterface.php
83 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/SerializeStageInterface.php
84 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Stage/DeserializeStageInterface.php
85 /vendor/api-platform/core/src/GraphQl/Resolver/QueryItemResolverInterface.php
86 /vendor/api-platform/core/src/GraphQl/Resolver/QueryCollectionResolverInterface.php
87 /vendor/api-platform/core/src/Core/GraphQl/Resolver/Factory/ResolverFactoryInterface.php
88 /vendor/api-platform/core/src/GraphQl/Resolver/MutationResolverInterface.php
89 /vendor/api-platform/core/src/Core/GraphQl/Subscription/MercureSubscriptionIriGeneratorInterface.php
90 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionIdentifierGeneratorInterface.php
91 /vendor/api-platform/core/src/Core/GraphQl/Subscription/SubscriptionManagerInterface.php
92 /vendor/api-platform/core/src/Core/GraphQl/Serializer/SerializerContextBuilderInterface.php
93 /vendor/api-platform/core/src/GraphQl/Type/TypesFactoryInterface.php
94 /vendor/api-platform/core/src/GraphQl/Type/Definition/TypeInterface.php
95 /vendor/api-platform/core/src/GraphQl/Type/TypesContainerInterface.php
96 /vendor/psr/container/src/ContainerInterface.php
97 /vendor/api-platform/core/src/Operation/PathSegmentNameGeneratorInterface.php
98 /vendor/ircmaxell/password-compat/lib/password.php
99 /vendor/martinlindhe/php-mb-helpers/src/mb_helpers.php
100 /vendor/prestashop/laminas-code-lts/polyfill/ReflectionEnumPolyfill.php
101 /src/Core/Version.php
102 /config/alias.php
103 /vendor/prestashop/autoload/src/PrestashopAutoload.php
104 /vendor/prestashop/autoload/src/LegacyClassLoader.php
105 /vendor/symfony/symfony/src/Symfony/Component/Filesystem/Filesystem.php
106 /vendor/prestashop/autoload/src/Autoloader.php
107 /config/bootstrap.php
108 /src/Core/ContainerBuilder.php
109 /src/Core/Foundation/IoC/Container.php
110 /src/Adapter/ServiceLocator.php
111 /var/cache/prod/appParameters.php
114 /var/cache/prod/class_index.php
115 /classes/controller/Controller.php
117 /classes/ObjectModel.php
118 /src/Core/Foundation/Database/EntityInterface.php
120 /classes/db/Db.php
122 /classes/Hook.php
124 /classes/module/Module.php
125 /src/Core/Module/Legacy/ModuleInterface.php
127 /classes/Tools.php
128 /classes/Context.php
129 /classes/shop/Shop.php
130 /src/Core/Security/PasswordGenerator.php
131 /classes/db/DbPDO.php
132 /classes/AddressFormat.php
133 /classes/cache/Cache.php
134 /classes/cache/CacheMemcached.php
135 /config/db_slave_server.inc.php
136 /src/Core/Security/Hashing.php
137 /classes/Configuration.php
138 /classes/Validate.php
139 /src/Adapter/EntityMapper.php
140 /classes/db/DbQuery.php
141 /src/Core/Addon/Theme/ThemeManagerBuilder.php
142 /vendor/psr/log/Psr/Log/NullLogger.php
143 /vendor/psr/log/Psr/Log/AbstractLogger.php
144 /vendor/psr/log/Psr/Log/LoggerInterface.php
145 /src/Adapter/Configuration.php
146 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ParameterBag.php
147 /src/Core/Domain/Configuration/ShopConfigurationInterface.php
148 /src/Core/ConfigurationInterface.php
149 /src/Core/Addon/Theme/ThemeRepository.php
150 /src/Core/Addon/AddonRepositoryInterface.php
151 /src/Core/Domain/Shop/ValueObject/ShopConstraint.php
152 /src/Core/Addon/Theme/Theme.php
153 /src/Core/Addon/AddonInterface.php
154 /src/Core/Util/ArrayFinder.php
155 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccess.php
156 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorBuilder.php
157 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessor.php
158 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyAccessorInterface.php
159 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPath.php
160 /vendor/symfony/symfony/src/Symfony/Component/PropertyAccess/PropertyPathInterface.php
161 /config/defines_uri.inc.php
162 /classes/Language.php
163 /src/Core/Language/LanguageInterface.php
164 /classes/Country.php
165 /classes/PrestaShopCollection.php
166 /classes/shop/ShopGroup.php
167 /classes/Cookie.php
168 /classes/PhpEncryption.php
169 /classes/PhpEncryptionEngine.php
170 /vendor/defuse/php-encryption/src/Key.php
171 /vendor/defuse/php-encryption/src/Encoding.php
172 /vendor/defuse/php-encryption/src/Core.php
173 /vendor/defuse/php-encryption/src/Crypto.php
174 /vendor/defuse/php-encryption/src/KeyOrPassword.php
175 /vendor/defuse/php-encryption/src/RuntimeTests.php
176 /vendor/defuse/php-encryption/src/DerivedKeys.php
177 /vendor/defuse/php-encryption/src/Exception/WrongKeyOrModifiedCiphertextException.php
178 /vendor/defuse/php-encryption/src/Exception/CryptoException.php
179 /src/Core/Session/SessionHandler.php
180 /src/Core/Session/SessionHandlerInterface.php
181 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Session.php
182 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBag.php
183 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Attribute/AttributeBagInterface.php
184 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagInterface.php
185 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBag.php
186 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Flash/FlashBagInterface.php
187 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionBagProxy.php
188 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/SessionInterface.php
189 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/PhpBridgeSessionStorage.php
190 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/NativeSessionStorage.php
191 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/MetadataBag.php
192 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/StrictSessionHandler.php
193 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Handler/AbstractSessionHandler.php
194 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/SessionHandlerProxy.php
195 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/Proxy/AbstractProxy.php
196 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Session/Storage/SessionStorageInterface.php
197 /config/smarty.config.inc.php
198 /vendor/smarty/smarty/libs/Smarty.class.php
199 /vendor/smarty/smarty/libs/functions.php
200 /vendor/smarty/smarty/libs/Autoloader.php
201 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_data.php
202 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_extension_handler.php
203 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_templatebase.php
204 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_template.php
205 /vendor/smarty/smarty/libs/sysplugins/smarty_resource.php
206 /vendor/smarty/smarty/libs/sysplugins/smarty_variable.php
207 /vendor/smarty/smarty/libs/sysplugins/smarty_template_source.php
208 /vendor/smarty/smarty/libs/sysplugins/smarty_template_resource_base.php
209 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_resource_file.php
210 /config/smartyfront.config.inc.php
211 /classes/Smarty/SmartyResourceModule.php
212 /vendor/smarty/smarty/libs/sysplugins/smarty_resource_custom.php
213 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerresource.php
214 /classes/Smarty/SmartyResourceParent.php
215 /classes/Smarty/SmartyLazyRegister.php
216 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_registerplugin.php
217 /vendor/smarty/smarty/libs/plugins/modifier.truncate.php
218 /classes/Customer.php
219 /classes/Group.php
220 /override/classes/Link.php
221 /classes/Link.php
222 /classes/shop/ShopUrl.php
223 /override/classes/Dispatcher.php
224 /classes/Dispatcher.php
225 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/Request.php
226 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeader.php
227 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/AcceptHeaderItem.php
228 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/FileBag.php
229 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderBag.php
230 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/HeaderUtils.php
231 /vendor/symfony/symfony/src/Symfony/Component/HttpFoundation/ServerBag.php
232 /src/Adapter/SymfonyContainer.php
233 /vendor/mobiledetect/mobiledetectlib/Mobile_Detect.php
234 /modules/ph_simpleblog/ph_simpleblog.php
235 /modules/ph_simpleblog/assets/phpthumb/ThumbLib.inc.php
236 /modules/ph_simpleblog/assets/phpthumb/PhpThumb.inc.php
237 /modules/ph_simpleblog/assets/phpthumb/ThumbBase.inc.php
238 /modules/ph_simpleblog/assets/phpthumb/GdThumb.inc.php
239 /modules/ph_simpleblog/vendor/autoload.php
240 /modules/ph_simpleblog/vendor/composer/autoload_real.php
241 /modules/ph_simpleblog/vendor/composer/platform_check.php
242 /modules/ph_simpleblog/vendor/composer/autoload_static.php
243 /modules/ph_simpleblog/models/SimpleBlogCategory.php
244 /modules/ph_simpleblog/models/SimpleBlogPost.php
245 /modules/ph_simpleblog/models/SimpleBlogPostType.php
246 /modules/ph_simpleblog/models/SimpleBlogPostImage.php
247 /modules/ph_simpleblog/models/SimpleBlogTag.php
248 /modules/ph_simpleblog/models/SimpleBlogComment.php
249 /modules/ph_simpleblog/models/SimpleBlogPostAuthor.php
250 /modules/ph_simpleblog/classes/SimpleBlogHelper.php
251 /modules/ph_simpleblog/classes/BlogPostsFinder.php
252 /modules/ph_simpleblog/controllers/front/default_list.php
253 /classes/controller/ModuleFrontController.php
254 /override/classes/controller/FrontController.php
255 /classes/controller/FrontController.php
256 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_createdata.php
257 /vendor/smarty/smarty/libs/sysplugins/smarty_data.php
258 /classes/Translate.php
259 /modules/ph_simpleblog/translations/fr.php
260 /src/PrestaShopBundle/Translation/TranslatorComponent.php
261 /vendor/symfony/symfony/src/Symfony/Component/Translation/Translator.php
262 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorInterface.php
263 /vendor/symfony/contracts/Translation/LocaleAwareInterface.php
264 /vendor/symfony/contracts/Translation/TranslatorInterface.php
265 /vendor/symfony/symfony/src/Symfony/Component/Translation/TranslatorBagInterface.php
266 /src/PrestaShopBundle/Translation/PrestaShopTranslatorTrait.php
267 /src/PrestaShopBundle/Translation/TranslatorLanguageTrait.php
268 /src/PrestaShopBundle/Translation/TranslatorInterface.php
269 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatter.php
270 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatter.php
271 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/IntlFormatterInterface.php
272 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/MessageFormatterInterface.php
273 /vendor/symfony/symfony/src/Symfony/Component/Translation/Formatter/ChoiceMessageFormatterInterface.php
274 /vendor/symfony/symfony/src/Symfony/Component/Translation/IdentityTranslator.php
275 /vendor/symfony/contracts/Translation/TranslatorTrait.php
276 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactory.php
277 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheFactoryInterface.php
278 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCache.php
279 /vendor/symfony/symfony/src/Symfony/Component/Config/ResourceCheckerConfigCache.php
280 /vendor/symfony/symfony/src/Symfony/Component/Config/ConfigCacheInterface.php
281 /var/cache/prod/translations/catalogue.fr-FR.NXhscRe.php
282 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogue.php
283 /vendor/symfony/symfony/src/Symfony/Component/Translation/MessageCatalogueInterface.php
284 /vendor/symfony/symfony/src/Symfony/Component/Translation/MetadataAwareInterface.php
285 /controllers/front/listing/CategoryController.php
286 /classes/controller/ProductListingFrontController.php
287 /classes/controller/ProductPresentingFrontController.php
288 /src/Adapter/Presenter/Object/ObjectPresenter.php
289 /src/Adapter/Presenter/PresenterInterface.php
290 /src/Adapter/Presenter/Cart/CartPresenter.php
291 /src/Adapter/Image/ImageRetriever.php
292 /classes/tax/TaxConfiguration.php
293 /classes/Smarty/TemplateFinder.php
294 /classes/assets/StylesheetManager.php
295 /classes/assets/AbstractAssetManager.php
296 /src/Adapter/Assets/AssetUrlGeneratorTrait.php
297 /classes/assets/JavascriptManager.php
298 /classes/assets/CccReducer.php
299 /modules/iqitthemeeditor/iqitthemeeditor.php
300 /modules/iqitthemeeditor/src/IqitSmartyModifiers.php
301 /modules/iqitthemeeditor/translations/fr.php
302 /classes/Category.php
303 /classes/webservice/WebserviceRequest.php
304 /src/Adapter/ContainerBuilder.php
305 /src/Adapter/Environment.php
306 /src/Core/EnvironmentInterface.php
307 /vendor/symfony/symfony/src/Symfony/Component/Cache/DoctrineProvider.php
308 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/CacheProvider.php
309 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Cache.php
310 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/FlushableCache.php
311 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/ClearableCache.php
312 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiOperationCache.php
313 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiGetCache.php
314 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiDeleteCache.php
315 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/MultiPutCache.php
316 /vendor/symfony/symfony/src/Symfony/Component/Cache/PruneableInterface.php
317 /vendor/symfony/symfony/src/Symfony/Component/Cache/ResettableInterface.php
318 /vendor/symfony/contracts/Service/ResetInterface.php
319 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/ArrayAdapter.php
320 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ArrayTrait.php
321 /vendor/psr/log/Psr/Log/LoggerAwareTrait.php
322 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AdapterInterface.php
323 /vendor/symfony/symfony/src/Symfony/Component/Cache/CacheItem.php
324 /vendor/symfony/contracts/Cache/ItemInterface.php
325 /vendor/psr/cache/src/CacheItemInterface.php
326 /vendor/psr/cache/src/CacheItemPoolInterface.php
327 /vendor/symfony/contracts/Cache/CacheInterface.php
328 /vendor/psr/log/Psr/Log/LoggerAwareInterface.php
329 /vendor/doctrine/orm/lib/Doctrine/ORM/Tools/Setup.php
330 /vendor/doctrine/deprecations/lib/Doctrine/Deprecations/Deprecation.php
331 /vendor/doctrine/orm/lib/Doctrine/ORM/Configuration.php
332 /vendor/doctrine/dbal/lib/Doctrine/DBAL/Configuration.php
333 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/CacheAdapter.php
334 /vendor/doctrine/cache/lib/Doctrine/Common/Cache/Psr6/DoctrineProvider.php
335 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationReader.php
336 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Reader.php
337 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/AnnotationRegistry.php
338 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/DoctrineAnnotations.php
339 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Annotation.php
340 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Entity.php
341 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embeddable.php
342 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Embedded.php
343 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/MappedSuperclass.php
344 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/InheritanceType.php
345 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorColumn.php
346 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/DiscriminatorMap.php
347 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Id.php
348 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/GeneratedValue.php
349 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Version.php
350 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumn.php
351 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinColumns.php
352 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Column.php
353 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToOne.php
354 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OneToMany.php
355 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToOne.php
356 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ManyToMany.php
357 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Table.php
358 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/UniqueConstraint.php
359 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Index.php
360 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/JoinTable.php
361 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SequenceGenerator.php
362 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/CustomIdGenerator.php
363 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ChangeTrackingPolicy.php
364 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/OrderBy.php
365 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQueries.php
366 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedQuery.php
367 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/HasLifecycleCallbacks.php
368 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PrePersist.php
369 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostPersist.php
370 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreUpdate.php
371 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostUpdate.php
372 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreRemove.php
373 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostRemove.php
374 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PostLoad.php
375 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/PreFlush.php
376 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/FieldResult.php
377 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/ColumnResult.php
378 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityResult.php
379 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQuery.php
380 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/NamedNativeQueries.php
381 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMapping.php
382 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/SqlResultSetMappings.php
383 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverride.php
384 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AssociationOverrides.php
385 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverride.php
386 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/AttributeOverrides.php
387 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/EntityListeners.php
388 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Cache.php
389 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/SimpleAnnotationReader.php
390 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocParser.php
391 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/DocLexer.php
392 /vendor/doctrine/lexer/lib/Doctrine/Common/Lexer/AbstractLexer.php
393 /vendor/doctrine/annotations/lib/Doctrine/Common/Annotations/Annotation/Target.php
394 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/AnnotationDriver.php
395 /vendor/doctrine/orm/lib/Doctrine/ORM/Mapping/Driver/CompatibilityAnnotationDriver.php
396 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/MappingDriver.php
397 /vendor/doctrine/persistence/src/Persistence/Mapping/Driver/ColocatedMappingDriver.php
398 /var/cache/prod/FrontContainer.php
399 /src/Adapter/Container/LegacyContainer.php
400 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Container.php
401 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/RewindableGenerator.php
402 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/Argument/ServiceLocator.php
403 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ServiceLocator.php
404 /vendor/symfony/contracts/Service/ServiceLocatorTrait.php
405 /vendor/psr/container/src/ContainerExceptionInterface.php
406 /vendor/psr/container/src/NotFoundExceptionInterface.php
407 /vendor/symfony/contracts/Service/ServiceProviderInterface.php
408 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ResettableContainerInterface.php
409 /vendor/symfony/symfony/src/Symfony/Component/DependencyInjection/ContainerInterface.php
410 /src/Adapter/Container/LegacyContainerInterface.php
411 /modules/ps_categorytree/vendor/autoload.php
412 /modules/ps_categorytree/vendor/composer/autoload_real.php
413 /modules/ps_categorytree/vendor/composer/platform_check.php
414 /modules/ps_categorytree/vendor/composer/autoload_static.php
415 /modules/ps_facetedsearch/vendor/autoload.php
416 /modules/ps_facetedsearch/vendor/composer/autoload_real.php
417 /modules/ps_facetedsearch/vendor/composer/platform_check.php
418 /modules/ps_facetedsearch/vendor/composer/autoload_static.php
419 /modules/contactform/vendor/autoload.php
420 /modules/contactform/vendor/composer/autoload_real.php
421 /modules/contactform/vendor/composer/platform_check.php
422 /modules/contactform/vendor/composer/autoload_static.php
423 /modules/ps_sharebuttons/vendor/autoload.php
424 /modules/ps_sharebuttons/vendor/composer/autoload_real.php
425 /modules/ps_sharebuttons/vendor/composer/platform_check.php
426 /modules/ps_sharebuttons/vendor/composer/autoload_static.php
427 /modules/gsitemap/vendor/autoload.php
428 /modules/gsitemap/vendor/composer/autoload_real.php
429 /modules/gsitemap/vendor/composer/platform_check.php
430 /modules/gsitemap/vendor/composer/autoload_static.php
431 /modules/ps_crossselling/vendor/autoload.php
432 /modules/ps_crossselling/vendor/composer/autoload_real.php
433 /modules/ps_crossselling/vendor/composer/platform_check.php
434 /modules/ps_crossselling/vendor/composer/autoload_static.php
435 /modules/ps_themecusto/vendor/autoload.php
436 /modules/ps_themecusto/vendor/composer/autoload_real.php
437 /modules/ps_themecusto/vendor/composer/platform_check.php
438 /modules/ps_themecusto/vendor/composer/autoload_static.php
439 /modules/ps_supplierlist/vendor/autoload.php
440 /modules/ps_supplierlist/vendor/composer/autoload_real.php
441 /modules/ps_supplierlist/vendor/composer/platform_check.php
442 /modules/ps_supplierlist/vendor/composer/autoload_static.php
443 /modules/ps_googleanalytics/vendor/autoload.php
444 /modules/ps_googleanalytics/vendor/composer/autoload_real.php
445 /modules/ps_googleanalytics/vendor/composer/platform_check.php
446 /modules/ps_googleanalytics/vendor/composer/autoload_static.php
447 /modules/statssearch/vendor/autoload.php
448 /modules/statssearch/vendor/composer/autoload_real.php
449 /modules/statssearch/vendor/composer/platform_check.php
450 /modules/statssearch/vendor/composer/autoload_static.php
451 /modules/ps_faviconnotificationbo/vendor/autoload.php
452 /modules/ps_faviconnotificationbo/vendor/composer/autoload_real.php
453 /modules/ps_faviconnotificationbo/vendor/composer/platform_check.php
454 /modules/ps_faviconnotificationbo/vendor/composer/autoload_static.php
455 /modules/ps_categoryproducts/vendor/autoload.php
456 /modules/ps_categoryproducts/vendor/composer/autoload_real.php
457 /modules/ps_categoryproducts/vendor/composer/platform_check.php
458 /modules/ps_categoryproducts/vendor/composer/autoload_static.php
459 /modules/ps_wirepayment/vendor/autoload.php
460 /modules/ps_wirepayment/vendor/composer/autoload_real.php
461 /modules/ps_wirepayment/vendor/composer/platform_check.php
462 /modules/ps_wirepayment/vendor/composer/autoload_static.php
463 /modules/statsregistrations/vendor/autoload.php
464 /modules/statsregistrations/vendor/composer/autoload_real.php
465 /modules/statsregistrations/vendor/composer/platform_check.php
466 /modules/statsregistrations/vendor/composer/autoload_static.php
467 /modules/ps_distributionapiclient/vendor/autoload.php
468 /modules/ps_distributionapiclient/vendor/composer/autoload_real.php
469 /modules/ps_distributionapiclient/vendor/composer/platform_check.php
470 /modules/ps_distributionapiclient/vendor/composer/autoload_static.php
471 /modules/ps_distributionapiclient/vendor/symfony/polyfill-intl-grapheme/bootstrap.php
472 /modules/ps_distributionapiclient/vendor/symfony/string/Resources/functions.php
473 /modules/ps_emailalerts/vendor/autoload.php
474 /modules/ps_emailalerts/vendor/composer/autoload_real.php
475 /modules/ps_emailalerts/vendor/composer/platform_check.php
476 /modules/ps_emailalerts/vendor/composer/autoload_static.php
477 /modules/ps_brandlist/vendor/autoload.php
478 /modules/ps_brandlist/vendor/composer/autoload_real.php
479 /modules/ps_brandlist/vendor/composer/platform_check.php
480 /modules/ps_brandlist/vendor/composer/autoload_static.php
481 /modules/ps_viewedproduct/vendor/autoload.php
482 /modules/ps_viewedproduct/vendor/composer/autoload_real.php
483 /modules/ps_viewedproduct/vendor/composer/platform_check.php
484 /modules/ps_viewedproduct/vendor/composer/autoload_static.php
485 /modules/iqitsociallogin/vendor/autoload.php
486 /modules/iqitsociallogin/vendor/composer/autoload_real.php
487 /modules/iqitsociallogin/vendor/composer/platform_check.php
488 /modules/iqitsociallogin/vendor/composer/autoload_static.php
489 /modules/gmerchantcenterpro/vendor/autoload.php
490 /modules/gmerchantcenterpro/vendor/composer/autoload_real.php
491 /modules/gmerchantcenterpro/vendor/composer/platform_check.php
492 /modules/gmerchantcenterpro/vendor/composer/autoload_static.php
493 /modules/wizardai/vendor/autoload.php
494 /modules/wizardai/vendor/composer/autoload_real.php
495 /modules/wizardai/vendor/composer/platform_check.php
496 /modules/wizardai/vendor/composer/autoload_static.php
497 /modules/wizardai/vendor/clue/stream-filter/src/functions_include.php
498 /modules/wizardai/vendor/clue/stream-filter/src/functions.php
499 /modules/wizardai/vendor/guzzlehttp/psr7/src/functions_include.php
500 /modules/wizardai/vendor/guzzlehttp/psr7/src/functions.php
501 /modules/wizardai/vendor/php-http/message/src/filters.php
502 /modules/wizardai/vendor/symfony/polyfill-apcu/bootstrap.php
503 /modules/stripe_official/vendor/autoload.php
504 /modules/stripe_official/vendor/composer/autoload_real.php
505 /modules/stripe_official/vendor/composer/platform_check.php
506 /modules/stripe_official/vendor/composer/autoload_static.php
507 /modules/vivawalletsmartcheckout/vendor/autoload.php
508 /modules/vivawalletsmartcheckout/vendor/composer/autoload_real.php
509 /modules/vivawalletsmartcheckout/vendor/composer/autoload_static.php
510 /modules/autoupgrade/vendor/autoload.php
511 /modules/autoupgrade/vendor/composer/autoload_real.php
512 /modules/autoupgrade/vendor/composer/autoload_static.php
513 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment.php
514 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Client.php
515 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer.php
516 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/QueueConsumer.php
517 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/File.php
518 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/ForkCurl.php
519 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/LibCurl.php
520 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Consumer/Socket.php
521 /modules/autoupgrade/vendor/segmentio/analytics-php/lib/Segment/Version.php
522 /src/Core/Localization/Locale/Repository.php
523 /src/Core/Localization/Locale/RepositoryInterface.php
524 /src/Core/Localization/CLDR/LocaleRepository.php
525 /src/Core/Localization/CLDR/LocaleDataSource.php
526 /src/Core/Localization/CLDR/DataLayer/LocaleCache.php
527 /src/Core/Data/Layer/AbstractDataLayer.php
528 /src/Core/Localization/CLDR/LocaleDataLayerInterface.php
529 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/FilesystemAdapter.php
530 /vendor/symfony/symfony/src/Symfony/Component/Cache/Adapter/AbstractAdapter.php
531 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractAdapterTrait.php
532 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/AbstractTrait.php
533 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/ContractsTrait.php
534 /vendor/symfony/contracts/Cache/CacheTrait.php
535 /vendor/psr/cache/src/InvalidArgumentException.php
536 /vendor/psr/cache/src/CacheException.php
537 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemTrait.php
538 /vendor/symfony/symfony/src/Symfony/Component/Cache/Traits/FilesystemCommonTrait.php
539 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/DefaultMarshaller.php
540 /vendor/symfony/symfony/src/Symfony/Component/Cache/Marshaller/MarshallerInterface.php
541 /src/Core/Localization/CLDR/DataLayer/LocaleReference.php
542 /src/Core/Localization/CLDR/Reader.php
543 /src/Core/Localization/CLDR/ReaderInterface.php
544 /src/Core/Localization/Currency/Repository.php
545 /src/Core/Localization/Currency/RepositoryInterface.php
546 /src/Core/Localization/Currency/CurrencyDataSource.php
547 /src/Core/Localization/Currency/DataSourceInterface.php
548 /src/Core/Localization/Currency/DataLayer/CurrencyCache.php
549 /src/Core/Localization/Currency/CurrencyDataLayerInterface.php
550 /src/Core/Localization/Currency/DataLayer/CurrencyDatabase.php
551 /src/Adapter/Currency/CurrencyDataProvider.php
552 /src/Core/Currency/CurrencyDataProviderInterface.php
553 /src/Adapter/LegacyContext.php
554 /src/Adapter/Tools.php
555 /src/Core/Localization/Currency/DataLayer/CurrencyReference.php
556 /src/Core/Localization/Currency/DataLayer/CurrencyInstalled.php
557 /vendor/prestashop/decimal/src/Operation/Rounding.php
558 /src/Core/Localization/Locale.php
559 /src/Core/Localization/LocaleInterface.php
560 /src/Core/Localization/Specification/Price.php
561 /src/Core/Localization/Specification/Number.php
562 /src/Core/Localization/Specification/NumberInterface.php
563 /src/Core/Localization/Specification/Factory.php
564 /src/Core/Localization/CLDR/LocaleData.php
565 /src/Core/Localization/CLDR/NumberSymbolsData.php
566 /src/Core/Localization/CLDR/CurrencyData.php
567 /src/Core/Localization/CLDR/Locale.php
568 /src/Core/Localization/CLDR/LocaleInterface.php
569 /src/Core/Localization/Specification/NumberSymbolList.php
570 /classes/Currency.php
571 /src/Core/Localization/Currency/LocalizedCurrencyId.php
572 /src/Core/Localization/Currency/CurrencyData.php
573 /src/Core/Localization/Currency/CurrencyCollection.php
574 /src/Core/Localization/Currency.php
575 /src/Core/Localization/CurrencyInterface.php
576 /src/Core/Localization/Specification/NumberCollection.php
577 /src/Core/Localization/Number/Formatter.php
578 /classes/Cart.php
579 /src/Adapter/AddressFactory.php
580 /override/classes/CartRule.php
581 /classes/CartRule.php
582 /classes/Product.php
583 /src/Core/Domain/Product/ValueObject/RedirectType.php
584 /src/Core/Util/DateTime/DateTime.php
585 /src/Core/Domain/Product/Stock/ValueObject/OutOfStockType.php
586 /src/Core/Domain/Product/Pack/ValueObject/PackStockType.php
587 /src/Core/Domain/Product/ValueObject/ProductType.php
588 /src/Core/Domain/Product/ValueObject/Reference.php
589 /src/Core/Domain/Product/ValueObject/Ean13.php
590 /src/Core/Domain/Product/ValueObject/Isbn.php
591 /src/Core/Domain/Product/ValueObject/Upc.php
592 /src/Core/Domain/Product/ProductSettings.php
593 /src/Core/Domain/Shop/ValueObject/ShopId.php
594 /src/Core/Domain/Shop/ValueObject/ShopIdInterface.php
595 /modules/ps_emailalerts/ps_emailalerts.php
596 /modules/ps_emailalerts/MailAlert.php
597 /src/PrestaShopBundle/Translation/DomainNormalizer.php
598 /modules/facebookconversiontrackingplus/facebookconversiontrackingplus.php
599 /modules/facebookconversiontrackingplus/classes/autoload.php
600 /modules/facebookconversiontrackingplus/translations/fr.php
601 /modules/facebookconversiontrackingplus/classes/ConversionApi.php
602 /modules/facebookconversiontrackingplus/classes/PixelTools.php
603 /modules/facebookconversiontrackingplus/classes/IpGeolocation.php
604 /src/Core/Security/OpenSsl/OpenSSL.php
605 /src/Core/Security/OpenSsl/OpenSSLInterface.php
606 /modules/facebookconversiontrackingplus/classes/SmartForm.php
607 /override/classes/Media.php
608 /classes/Media.php
609 /modules/revolutpayment/revolutpayment.php
610 /modules/revolutpayment/classes/RevolutApi.php
611 /modules/revolutpayment/classes/RevolutDatabaseHelper.php
612 /modules/revolutpayment/classes/RevolutPRBSettingsHelper.php
613 /modules/revolutpayment/classes/RevolutApplePayOnBoardingHelper.php
614 /modules/revolutpayment/classes/RevolutModuleHelper.php
615 /classes/PaymentModule.php
616 /modules/revolutpayment/translations/fr.php
617 /src/Adapter/Presenter/Cart/CartLazyArray.php
618 /src/Adapter/Presenter/AbstractLazyArray.php
619 /src/Adapter/Product/PriceFormatter.php
620 /src/Core/Util/Inflector.php
621 /vendor/doctrine/inflector/lib/Doctrine/Inflector/InflectorFactory.php
622 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Language.php
623 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/InflectorFactory.php
624 /vendor/doctrine/inflector/lib/Doctrine/Inflector/GenericLanguageInflectorFactory.php
625 /vendor/doctrine/inflector/lib/Doctrine/Inflector/LanguageInflectorFactory.php
626 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Rules.php
627 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Ruleset.php
628 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformations.php
629 /vendor/doctrine/inflector/lib/Doctrine/Inflector/WordInflector.php
630 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Inflectible.php
631 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Transformation.php
632 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Pattern.php
633 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Patterns.php
634 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/English/Uninflected.php
635 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitutions.php
636 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Substitution.php
637 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Rules/Word.php
638 /vendor/doctrine/inflector/lib/Doctrine/Inflector/Inflector.php
639 /vendor/doctrine/inflector/lib/Doctrine/Inflector/CachedWordInflector.php
640 /vendor/doctrine/inflector/lib/Doctrine/Inflector/RulesetInflector.php
641 /classes/Gender.php
642 /classes/Risk.php
643 /classes/Meta.php
644 /modules/revsliderprestashop/revsliderprestashop.php
645 /modules/revsliderprestashop/rev-loader.php
646 /modules/revsliderprestashop/includes/revslider_db.class.php
647 /modules/revsliderprestashop/includes/data.class.php
648 /modules/revsliderprestashop/includes/functions.class.php
649 /modules/revsliderprestashop/includes/em-integration.class.php
650 /modules/revsliderprestashop/includes/cssparser.class.php
651 /modules/revsliderprestashop/includes/woocommerce.class.php
652 /modules/revsliderprestashop/includes/wpml.class.php
653 /modules/revsliderprestashop/includes/colorpicker.class.php
654 /modules/revsliderprestashop/includes/navigation.class.php
655 /modules/revsliderprestashop/includes/object-library.class.php
656 /modules/revsliderprestashop/admin/includes/loadbalancer.class.php
657 /modules/revsliderprestashop/admin/includes/plugin-update.class.php
658 /modules/revsliderprestashop/includes/extension.class.php
659 /modules/revsliderprestashop/includes/favorite.class.php
660 /modules/revsliderprestashop/includes/aq-resizer.class.php
661 /modules/revsliderprestashop/includes/external-sources.class.php
662 /modules/revsliderprestashop/includes/page-template.class.php
663 /modules/revsliderprestashop/includes/slider.class.php
664 /modules/revsliderprestashop/includes/slide.class.php
665 /modules/revsliderprestashop/includes/output.class.php
666 /modules/revsliderprestashop/public/revslider-front.class.php
667 /modules/revsliderprestashop/includes/backwards.php
668 /modules/revsliderprestashop/admin/includes/class-pclzip.php
669 /modules/revsliderprestashop/admin/includes/license.class.php
670 /modules/revsliderprestashop/admin/includes/addons.class.php
671 /modules/revsliderprestashop/admin/includes/template.class.php
672 /modules/revsliderprestashop/admin/includes/functions-admin.class.php
673 /modules/revsliderprestashop/admin/includes/folder.class.php
674 /modules/revsliderprestashop/admin/includes/import.class.php
675 /modules/revsliderprestashop/admin/includes/export.class.php
676 /modules/revsliderprestashop/admin/includes/export-html.class.php
677 /modules/revsliderprestashop/admin/includes/newsletter.class.php
678 /modules/revsliderprestashop/admin/revslider-admin.class.php
679 /modules/revsliderprestashop/includes/update.class.php
680 /modules/revsliderprestashop/includes/resize-imag.php
681 /modules/revsliderprestashop/translations/fr.php
682 /classes/Address.php
683 /classes/ImageType.php
684 /classes/State.php
685 /src/Core/Security/PasswordPolicyConfiguration.php
686 /src/Core/Configuration/DataConfigurationInterface.php
687 /src/Core/Filter/FrontEndObject/MainFilter.php
688 /src/Core/Filter/FilterInterface.php
689 /src/Core/Filter/FrontEndObject/CartFilter.php
690 /src/Core/Filter/HashMapWhitelistFilter.php
691 /src/Core/Filter/CollectionFilter.php
692 /src/Core/Filter/FrontEndObject/ProductFilter.php
693 /src/Core/Filter/FrontEndObject/EmbeddedAttributesFilter.php
694 /src/Core/Filter/FrontEndObject/CustomerFilter.php
695 /src/Core/Filter/FrontEndObject/ShopFilter.php
696 /src/Core/Filter/FrontEndObject/ConfigurationFilter.php
697 /modules/ps_shoppingcart/ps_shoppingcart.php
698 /src/Core/Module/WidgetInterface.php
699 /modules/ps_googleanalytics/ps_googleanalytics.php
700 /modules/ps_googleanalytics/classes/Hook/HookDisplayHeader.php
701 /modules/ps_googleanalytics/classes/Hook/HookInterface.php
702 /vendor/smarty/smarty/libs/sysplugins/smarty_template_compiled.php
703 /var/cache/prod/smarty/compile/warehouse/ee/78/8a/ee788a7ffa4b95e0a488ef6dc4b9f3c8b40ce111_2.file.ps_googleanalytics.tpl.php
704 /vendor/smarty/smarty/libs/plugins/modifier.escape.php
705 /modules/iqitcompare/iqitcompare.php
706 /modules/iqitcompare/translations/fr.php
707 /modules/iqitcontactpage/iqitcontactpage.php
708 /modules/iqitcontactpage/translations/fr.php
709 /modules/iqitcookielaw/iqitcookielaw.php
710 /modules/iqitcookielaw/translations/fr.php
711 /modules/iqitcountdown/iqitcountdown.php
712 /modules/iqitcountdown/translations/fr.php
713 /modules/iqitelementor/iqitelementor.php
714 /modules/iqitelementor/src/IqitElementorLanding.php
715 /modules/iqitelementor/src/IqitElementorTemplate.php
716 /modules/iqitelementor/src/IqitElementorProduct.php
717 /modules/iqitelementor/src/IqitElementorCategory.php
718 /modules/iqitelementor/src/IqitElementorContent.php
719 /modules/iqitelementor/src/iqitElementorWpHelper.php
720 /modules/iqitelementor/includes/plugin-elementor.php
721 /modules/iqitelementor/src/widgets/IqitElementorWidget_Brands.php
722 /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsList.php
723 /modules/iqitelementor/src/widgets/IqitElementorWidget_ProductsListTabs.php
724 /modules/iqitelementor/src/widgets/IqitElementorWidget_Modules.php
725 /modules/iqitelementor/src/widgets/IqitElementorWidget_CustomTpl.php
726 /modules/iqitelementor/src/widgets/IqitElementorWidget_Menu.php
727 /modules/iqitelementor/src/widgets/IqitElementorWidget_RevolutionSlider.php
728 /modules/iqitelementor/src/widgets/IqitElementorWidget_Newsletter.php
729 /modules/iqitelementor/src/widgets/IqitElementorWidget_Blog.php
730 /modules/iqitelementor/src/widgets/IqitElementorWidget_Search.php
731 /modules/iqitelementor/src/widgets/IqitElementorWidget_Links.php
732 /modules/iqitelementor/src/widgets/IqitElementorWidget_ContactForm.php
733 /modules/iqitelementor/translations/fr.php
734 /modules/iqitfreedeliverycount/iqitfreedeliverycount.php
735 /modules/iqitfreedeliverycount/translations/fr.php
736 /modules/iqitmegamenu/iqitmegamenu.php
737 /modules/iqitmegamenu/models/IqitMenuTab.php
738 /modules/iqitmegamenu/models/IqitMenuHtml.php
739 /modules/iqitmegamenu/models/IqitMenuLinks.php
740 /modules/iqitmegamenu/translations/fr.php
741 /modules/iqitsizecharts/iqitsizecharts.php
742 /modules/iqitsizecharts/src/IqitSizeCharts.php
743 /modules/iqitsizecharts/translations/fr.php
744 /modules/iqitwishlist/iqitwishlist.php
745 /modules/iqitwishlist/src/IqitWishlistProduct.php
746 /modules/iqitwishlist/translations/fr.php
747 /modules/iqitextendedproduct/iqitextendedproduct.php
748 /modules/iqitextendedproduct/src/IqitThreeSixty.php
749 /modules/iqitextendedproduct/src/IqitProductVideo.php
750 /modules/iqitextendedproduct/translations/fr.php
751 /classes/assets/PrestashopAssetsLibraries.php
752 /modules/iqitsociallogin/iqitsociallogin.php
753 /modules/iqitsociallogin/translations/fr.php
754 /modules/gmerchantcenterpro/gmerchantcenterpro.php
755 /modules/gmerchantcenterpro/translations/fr.php
756 /modules/gmerchantcenterpro/lib/moduleTools.php
757 /modules/gmerchantcenterpro/conf/moduleConfiguration.php
758 /modules/gmerchantcenterpro/lib/moduleUpdate.php
759 /modules/gmerchantcenterpro/lib/install/installController.php
760 /modules/gmerchantcenterpro/lib/install/installSql.php
761 /modules/gmerchantcenterpro/lib/install/installInterface.php
762 /modules/gmerchantcenterpro/models/Feeds.php
763 /modules/gmerchantcenterpro/lib/hook/hookController.php
764 /modules/gmerchantcenterpro/lib/hook/hookDisplay.php
765 /modules/gmerchantcenterpro/lib/hook/hookBase.php
766 /modules/gmerchantcenterpro/lib/dao/moduleDao.php
767 /var/cache/prod/smarty/compile/warehouse/f7/5f/75/f75f75b788ebecd0995da205f357ac74693f8076_2.file.header.tpl.php
768 /modules/stripe_official/stripe_official.php
769 /modules/stripe_official/vendor/stripe/stripe-php/lib/Event.php
770 /modules/stripe_official/vendor/stripe/stripe-php/lib/ApiResource.php
771 /modules/stripe_official/vendor/stripe/stripe-php/lib/StripeObject.php
772 /modules/stripe_official/vendor/stripe/stripe-php/lib/ApiOperations/Request.php
773 /modules/stripe_official/classes/services/PrestashopTranslationService.php
774 /src/Adapter/Localization/LegacyTranslator.php
775 /modules/stripe_official/smarty/plugins/modifier.stripelreplace.php
776 /modules/stripe_official/vendor/stripe/stripe-php/lib/Stripe.php
777 /modules/stripe_official/vendor/stripe/stripe-php/lib/Util/ApiVersion.php
778 /modules/wizardai/vendor/prestashop/module-lib-service-container/src/DependencyInjection/ServiceContainer.php
779 /modules/stripe_official/classes/services/StripeDisplayHeaderService.php
780 /modules/abandonedcart/abandonedcart.php
781 /modules/abandonedcart/classes/abandonedcart_core.php
782 /modules/abandonedcart/translations/fr.php
783 /var/cache/prod/smarty/compile/warehouse/7f/09/a0/7f09a045a9b3f592faaac1a3835665419330db11_2.file.abandonedcart_front.tpl.php
784 /modules/vivawalletsmartcheckout/vivawalletsmartcheckout.php
785 /modules/vivawalletsmartcheckout/src/Helpers/Config.php
786 /modules/vivawalletsmartcheckout/config/app.php
787 /modules/vivawalletsmartcheckout/src/Helpers/General.php
788 /modules/vivawalletsmartcheckout/translations/fr.php
789 /modules/vivawalletsmartcheckout/vendor/vivawallet/vivawallet-php/lib/Application.php
790 /src/Core/Product/Search/ProductSearchContext.php
791 /src/Core/Product/Search/ProductSearchQuery.php
792 /src/Core/Product/Search/SortOrder.php
793 /modules/ps_facetedsearch/ps_facetedsearch.php
794 /modules/ps_facetedsearch/src/HookDispatcher.php
795 /modules/ps_facetedsearch/src/Hook/Attribute.php
796 /modules/ps_facetedsearch/src/Hook/AbstractHook.php
797 /modules/ps_facetedsearch/src/Hook/AttributeGroup.php
798 /modules/ps_facetedsearch/src/Hook/Category.php
799 /modules/ps_facetedsearch/src/Hook/Configuration.php
800 /modules/ps_facetedsearch/src/Hook/Design.php
801 /modules/ps_facetedsearch/src/Hook/Feature.php
802 /modules/ps_facetedsearch/src/Form/Feature/FormModifier.php
803 /modules/ps_facetedsearch/src/Form/Feature/FormDataProvider.php
804 /modules/ps_facetedsearch/src/Hook/FeatureValue.php
805 /modules/ps_facetedsearch/src/Form/FeatureValue/FormModifier.php
806 /modules/ps_facetedsearch/src/Form/FeatureValue/FormDataProvider.php
807 /modules/ps_facetedsearch/src/Hook/Product.php
808 /modules/ps_facetedsearch/src/Hook/ProductSearch.php
809 /modules/ps_facetedsearch/src/Hook/SpecificPrice.php
810 /modules/ps_facetedsearch/src/Filters/Provider.php
811 /modules/ps_facetedsearch/src/URLSerializer.php
812 /modules/ps_facetedsearch/src/Filters/DataAccessor.php
813 /modules/ps_facetedsearch/src/Product/SearchProvider.php
814 /src/Core/Product/Search/FacetsRendererInterface.php
815 /src/Core/Product/Search/ProductSearchProviderInterface.php
816 /modules/ps_facetedsearch/src/Filters/Converter.php
817 /modules/ps_facetedsearch/src/Product/SearchFactory.php
818 /src/Core/Product/Search/ProductSearchResult.php
819 /modules/ps_facetedsearch/src/Product/Search.php
820 /modules/ps_facetedsearch/src/Adapter/MySQL.php
821 /modules/ps_facetedsearch/src/Adapter/AbstractAdapter.php
822 /modules/ps_facetedsearch/src/Adapter/InterfaceAdapter.php
823 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ArrayCollection.php
824 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Collection.php
825 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/ReadableCollection.php
826 /vendor/doctrine/collections/lib/Doctrine/Common/Collections/Selectable.php
827 /modules/ps_facetedsearch/src/Filters/Products.php
828 /classes/stock/StockAvailable.php
829 /modules/ps_facetedsearch/src/Filters/Block.php
830 /modules/ps_facetedsearch/src/Definition/Availability.php
831 /src/Core/Product/Search/Facet.php
832 /src/Core/Product/Search/Filter.php
833 /vendor/prestashop/decimal/src/DecimalNumber.php
834 /vendor/prestashop/decimal/src/Builder.php
835 /src/Core/Product/Search/FacetCollection.php
836 /classes/ProductAssembler.php
837 /classes/Combination.php
838 /classes/tax/Tax.php
839 /classes/Manufacturer.php
840 /classes/SpecificPrice.php
841 /classes/tax/TaxManagerFactory.php
842 /classes/tax/TaxRulesTaxManager.php
843 /classes/tax/TaxManagerInterface.php
844 /classes/tax/TaxCalculator.php
845 /classes/GroupReduction.php
846 /src/Core/Localization/CLDR/ComputingPrecision.php
847 /src/Core/Localization/CLDR/ComputingPrecisionInterface.php
848 /classes/Pack.php
849 /override/classes/order/Order.php
850 /classes/order/Order.php
851 /classes/Feature.php
852 /classes/ProductPresenterFactory.php
853 /src/Adapter/Presenter/Product/ProductListingPresenter.php
854 /src/Adapter/Presenter/Product/ProductPresenter.php
855 /src/Adapter/Product/ProductColorsRetriever.php
856 /src/Adapter/HookManager.php
857 /src/Core/Product/ProductPresentationSettings.php
858 /src/Adapter/Presenter/Product/ProductListingLazyArray.php
859 /src/Adapter/Presenter/Product/ProductLazyArray.php
860 /classes/Image.php
861 /src/Core/Image/ImageFormatConfiguration.php
862 /src/Core/Image/ImageFormatConfigurationInterface.php
863 /classes/FeatureFlag.php
864 /src/Core/FeatureFlag/FeatureFlagSettings.php
865 /vendor/prestashop/decimal/src/Operation/Multiplication.php
866 /vendor/prestashop/decimal/src/Operation/Addition.php
867 /var/cache/prod/smarty/compile/warehouse/d4/1d/65/d41d65d76b9471b5d365fe06cf1737c89a53af9f_2.module.ps_facetedsearchviewstemplatesfrontcatalogfacets.tpl.php
868 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_block.php
869 /vendor/smarty/smarty/libs/plugins/modifier.count.php
870 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_inheritance.php
871 /var/cache/prod/smarty/compile/warehouse/fb/ea/98/fbea98a84e509d7477392fb3e2519b1e908ae1d0_2.module.ps_facetedsearchviewstemplatesfrontcatalogfacetsdropdown.tpl.php
872 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_foreach.php
873 /var/cache/prod/smarty/compile/warehouse/2e/80/73/2e807335546cfa2360c36327ac89dd2fcb054379_2.module.ps_facetedsearchviewstemplatesfrontcatalogactivefilters.tpl.php
874 /src/Core/Product/Search/Pagination.php
875 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/a7/2d/dc/a72ddcc3457e523238167bfb787364e010571602_2.file.category.tpl.php
876 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_capture.php
877 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/90/cf/46/90cf4679dc49439c314d4747bbab91e7cd883211_2.file.product-list.tpl.php
878 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/20/1d/59/201d594b12ddb0579e97d2d00a38f32349d7f8e2_2.file.layout-full-width.tpl.php
879 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/9f/c0/0d/9fc00de9dab18af4bad561c5978e37a5cf7ba8dc_2.file.layout-both-columns.tpl.php
880 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/cb/45/38/cb4538e80db186323bd2c849a93c3a874eb9fa44_2.file.helpers.tpl.php
881 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_runtime_tplfunction.php
882 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/a3/5d/99/a35d9996c0259409d557b9de6f17182667bd08c0_2.file.head.tpl.php
883 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/d8/66/63/d8666378896e3199131756b2a049789ce82f9145_2.file.head-jsonld.tpl.php
884 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/8e/7c/ff/8e7cff5cfb78f6670e25ee2a2964eb6ccbe1b9d5_2.file.product-list-jsonld.tpl.php
885 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/b5/08/e2/b508e285f88ade9f85c8711af34aa86844c85366_2.file.pagination-seo.tpl.php
886 /vendor/smarty/smarty/libs/plugins/modifier.replace.php
887 /vendor/smarty/smarty/libs/plugins/shared.mb_str_replace.php
888 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/52/ed/5b/52ed5bf4088d07f918e31ad1872568dff1a15122_2.file.stylesheets.tpl.php
889 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/2a/77/40/2a7740ed942475bcc06c5e40d5346b6b574f1441_2.file.javascript.tpl.php
890 /classes/ProductDownload.php
891 /src/Core/Cart/Calculator.php
892 /src/Core/Cart/CartRowCollection.php
893 /src/Core/Cart/Fees.php
894 /src/Core/Cart/AmountImmutable.php
895 /src/Core/Cart/CartRuleCollection.php
896 /src/Core/Cart/CartRuleCalculator.php
897 /src/Adapter/Product/PriceCalculator.php
898 /src/Core/Cart/CartRow.php
899 /vendor/symfony/symfony/src/Symfony/Component/Translation/PluralizationRules.php
900 /src/Core/Util/String/StringModifier.php
901 /src/Core/Util/String/StringModifierInterface.php
902 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/05/ac/4e/05ac4e59da39afc94ba29fd4c5bed100b6b3da19_2.file.product-activation.tpl.php
903 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/05/4d/41/054d41abc5a541ea4fd30d63caa94ec106d2993b_2.file.header.tpl.php
904 /modules/iqitlinksmanager/iqitlinksmanager.php
905 /modules/iqitlinksmanager/src/IqitLinkBlockRepository.php
906 /modules/iqitlinksmanager/src/IqitLinkBlock.php
907 /modules/iqitlinksmanager/src/IqitLinkBlockPresenter.php
908 /modules/iqitlinksmanager/translations/fr.php
909 /vendor/smarty/smarty/libs/sysplugins/smarty_template_cached.php
910 /vendor/smarty/smarty/libs/sysplugins/smarty_cacheresource.php
911 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_cacheresource_file.php
912 /var/cache/prod/smarty/cache/iqitlinksmanager/1/1/1/21/displayNav1/warehouse/a9/f2/c1/a9f2c1869604c8c628073c46891a26fcf1453e27.iqitlinksmanagerviewstemplateshookiqitlinksmanager.tpl.php
913 /modules/ps_languageselector/ps_languageselector.php
914 /modules/ps_currencyselector/ps_currencyselector.php
915 /var/cache/prod/smarty/compile/warehouse/73/27/77/73277702161b17505d668b28b8368941cf42c568_2.module.iqitwishlistviewstemplateshookdisplaynav.tpl.php
916 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/03/c2/a5/03c2a55aa51a9b7d61e7f129a111606f12475287_2.file.header-3.tpl.php
917 /modules/iqitsearch/iqitsearch.php
918 /modules/iqitsearch/translations/fr.php
919 /vendor/smarty/smarty/libs/sysplugins/smarty_internal_method_gettemplatevars.php
920 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/d9/9b/94/d99b947421dcff226f28b1d6cb674c91f17399db_2.module.iqitsearchviewstemplateshookiqitsearchbtn.tpl.php
921 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/46/29/db/4629dbb3c4efa13c090c633dc2e46e5f2b42bed3_2.module.iqitsearchviewstemplateshooksearchbar.tpl.php
922 /modules/ps_customersignin/ps_customersignin.php
923 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/72/be/19/72be192e406191c1cad554abe284e159adeb4234_2.module.ps_customersigninps_customersigninbtn.tpl.php
924 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/b4/a4/76/b4a476e0a8201677b298f7c0f8ca1ac698e1bac3_2.module.ps_shoppingcartps_shoppingcartbtn.tpl.php
925 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/35/65/5e/35655e6409b6198f29dd6e732ef9598dec599880_2.module.ps_shoppingcartps_shoppingcart.tpl.php
926 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/f6/e9/f2/f6e9f2b1680a466582d2199d038efe2cfa3a83f7_2.module.ps_shoppingcartps_shoppingcartcontent.tpl.php
927 /var/cache/prod/smarty/cache/iqitmegamenu/index/1/1/1/21/warehouse/70/ca/47/70ca47640f8f16a0dd1dc3b1fce177bbeed38257.iqitmegamenuviewstemplateshookhorizontal.tpl.php
928 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/ce/2d/19/ce2d19cd13f5f27943d104183b745be20e3618a6_2.file.mobile-header-1.tpl.php
929 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/7a/30/38/7a3038780284d52e9fcd7a66e51e5b86a166106b_2.module.iqitsearchviewstemplateshooksearchbarmobile.tpl.php
930 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/be/ee/e6/beeee6f3d87613010f8af1cabc4c4562f8cf600a_2.module.ps_customersigninps_customersigninmobile.tpl.php
931 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/d4/e1/57/d4e1571b6b210795247564db06deb17061778b51_2.module.ps_shoppingcartps_shoppingcartmqty.tpl.php
932 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/28/b8/a6/28b8a6fb36f22bef1e0b5c53910267c19ceae859_2.file.breadcrumb.tpl.php
933 /modules/iqitproductsnav/iqitproductsnav.php
934 /modules/iqitproductsnav/translations/fr.php
935 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/f1/e6/1e/f1e61e7ca59d67ddb45735d3ba11885aabdcd7c1_2.file.notifications.tpl.php
936 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/1d/15/44/1d154420732e4f5ec7164570156b8e82b8e743cc_2.file.category-header.tpl.php
937 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/8f/2c/f2/8f2cf264e8ef24eff54cdc3881bd1071ff6abcc5_2.file.products-top.tpl.php
938 /vendor/smarty/smarty/libs/plugins/modifier.regex_replace.php
939 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/ca/43/26/ca432646d2c581a6631dbab0f8a0ded19562cc5d_2.file.sort-orders.tpl.php
940 /var/cache/prod/smarty/compile/warehouse/81/a1/04/81a1040ed0eeab6f58198f9907167c7fced628c5_2.module.ps_facetedsearchps_facetedsearch.tpl.php
941 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/52/57/07/52570740bcdee3193f952d35d0d11ce53ff537f4_2.file.products.tpl.php
942 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/45/91/09/4591095b1d399add495fc541674f2fceb9d0f0e3_2.file.product.tpl.php
943 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/cb/91/6c/cb916c508b6fcc743788f1d7f95631e94668cb9d_2.file.product-miniature-1.tpl.php
944 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/31/03/a9/3103a9a485af7d714612ac0c47dbcfbc05c4fd95_2.file.product-miniature-thumb.tpl.php
945 /var/cache/prod/smarty/compile/warehouse/e9/21/d5/e921d51c062189725606e51308456f33ad945843_2.module.iqitwishlistviewstemplateshookproductminiature.tpl.php
946 /var/cache/prod/smarty/compile/warehouse/90/53/a0/9053a0dd520a39bef75969a0e9efeeae750df91b_2.module.iqitcompareviewstemplateshookproductminiature.tpl.php
947 /var/cache/prod/smarty/compile/warehouse/55/c7/a8/55c7a89f423f7f64b1b84881dcb668e4d788f013_2.module.iqitcountdownviewstemplateshookproduct.tpl.php
948 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/6c/98/2d/6c982d5090ff11db9654f1a7f6945865bc19603f_2.file.product-miniature-btn.tpl.php
949 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/8f/7a/83/8f7a832567456fbcc9b33e35ba7ca0da997b29d7_2.file.pagination.tpl.php
950 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/b1/d3/1b/b1d31b2d2e40bf3996d3350fd9793c705dd5bee6_2.file.products-bottom.tpl.php
951 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/99/9e/63/999e637a129f69005ecaa1ec5a360060ed703447_2.file.footer.tpl.php
952 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/7b/ea/10/7bea10cca96ef6b28b8f036ef026a7c11e3bde56_2.file.footer-1.tpl.php
953 /var/cache/prod/smarty/cache/iqitlinksmanager/1/1/1/21/displayFooter/warehouse/a9/f2/c1/a9f2c1869604c8c628073c46891a26fcf1453e27.iqitlinksmanagerviewstemplateshookiqitlinksmanager.tpl.php
954 /var/cache/prod/smarty/compile/warehouse/47/ac/57/47ac57039d904771d1de42366e1791900bdd2c2f_2.file.pixelheader.tpl.php
955 /var/cache/prod/smarty/compile/warehouse/d5/a3/51/d5a351153329745771ab994e1aac2c50a2871ed1_2.file.pages_viewed.tpl.php
956 /var/cache/prod/smarty/compile/warehouse/e8/03/5a/e8035a8d1c12c085b510041163fece5592f47256_2.file.addtocart17.tpl.php
957 /var/cache/prod/smarty/compile/warehouse/77/34/89/773489e70d2bbbc33a3532f583f69463b9e8d34b_2.file.wishlist-iqitwishlist.tpl.php
958 /var/cache/prod/smarty/compile/warehouse/d8/97/09/d897090b6df2dbd807e718e356ae88dacdc94b72_2.file.category.tpl.php
959 /var/cache/prod/smarty/compile/warehouse/0b/1e/ae/0b1eae8b95d210de6545ab4d36ef1e0da4a2995c_2.file.newsletter.tpl.php
960 /var/cache/prod/smarty/compile/warehouse/bb/a9/2e/bba92e35e07193f35df4d88c25fef9c1ee267db4_2.file.page_time_event.tpl.php
961 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/2f/e6/59/2fe659ce5c8a3b849eecceed2fd2484c04ba6f2b_2.file.social-links.tpl.php
962 /modules/ps_emailsubscription/ps_emailsubscription.php
963 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/ca/11/75/ca1175f42cce659c415ef88a938d72e6064791dd_2.file.footer-copyrights-1.tpl.php
964 /var/cache/prod/smarty/compile/warehouselayouts_layout_full_width_tpl/b2/b4/18/b2b418437d59a5c40ab3bf79b4a0534fdfc59e9d_2.file.password-policy-template.tpl.php
965 /classes/form/CustomerLoginForm.php
966 /classes/form/AbstractForm.php
967 /classes/form/FormInterface.php
968 /src/Core/Foundation/Templating/RenderableInterface.php
969 /classes/form/CustomerLoginFormatter.php
970 /classes/form/FormFormatterInterface.php
971 /classes/ValidateConstraintTranslator.php
972 /src/Core/Util/InternationalizedDomainNameConverter.php
973 /src/Core/Foundation/Templating/RenderableProxy.php
974 /var/cache/prod/smarty/compile/warehouse/52/f1/b8/52f1b8b385d74962f57df5c0ac1b0e91d62e4760_2.module.iqitwishlistviewstemplateshookdisplaymodal.tpl.php
975 /classes/form/FormField.php
976 /var/cache/prod/smarty/compile/warehouse/30/f5/ac/30f5acd1c8eb485e903c518c39df62f6dab88d7e_2.file.login-form.tpl.php
977 /var/cache/prod/smarty/compile/warehouse/21/f2/27/21f227e16d661dac3c649c0ff89b74dcf6812c75_2.file.form-errors.tpl.php
978 /var/cache/prod/smarty/compile/08/dc/b1/08dcb1adde6be40af6fcc0544d63eb4badcd22a6_2.file.form-fields.tpl.php
979 /var/cache/prod/smarty/compile/21/f2/27/21f227e16d661dac3c649c0ff89b74dcf6812c75_2.file.form-errors.tpl.php
980 /var/cache/prod/smarty/cache/iqitsociallogin/1/1/1/21/warehouse/7b/d5/c3/7bd5c305fe941e7514c4da4c50a911312eb62349.iqitsocialloginviewstemplateshookauthentication.tpl.php
981 /var/cache/prod/smarty/compile/warehouse/d4/a2/00/d4a200912ea9e133f46cf39b7eadc37ea7dd3d2f_2.module.iqitcompareviewstemplateshookdisplaymodal.tpl.php
982 /var/cache/prod/smarty/cache/iqitcookielaw/1/1/1/21/warehouse/6c/9a/c7/6c9ac7fc236180074d341c4bb3247222ad3545d0.iqitcookielawviewstemplateshookiqitcookielaw.tpl.php
983 /modules/ps_googleanalytics/classes/Hook/HookDisplayBeforeBodyClosingTag.php
984 /modules/ps_googleanalytics/classes/Handler/GanalyticsJsHandler.php
985 /modules/ps_googleanalytics/classes/Handler/GanalyticsDataHandler.php
986 /modules/ps_googleanalytics/classes/Repository/GanalyticsDataRepository.php
987 /modules/ps_googleanalytics/classes/Wrapper/ProductWrapper.php
988 /modules/ps_googleanalytics/classes/GoogleAnalyticsTools.php
989 /var/cache/prod/smarty/compile/warehouse/5c/93/46/5c93465cfee83ad9edb76aeff8896d92c35ee986_2.file.ga_tag.tpl.php